Results

Parseable data
Matches to PDB90
Dali: mol1A,

Query: mol1A

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, to pre-computed structural neighbours in the Dali Database, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3dla-C 31.4 19.2  296   657   27 PDB  MOLECULE: GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE;                     


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=mol1A Sbjct=3dlaC Z-score=31.4

back to top
DSSP  ---------LEEEEEEEEELLLLLLLHHHHHHHHHHHHHHHHLLLLLEEELLLLLLLLLL
Query ---------SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYP   51
ident              | |      | || | ||   |   |     || |  |||  | || 
Sbjct smnfysayqHGFVRVAACTHHTTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYS   60
DSSP  lllllllllLLEEEEEEEELLLLLLLHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLLL


DSSP  LHHHHHLHHHHHHHHHHHHHHHHHHHhllLLLLLEEEEEEEELLllllllllllLLEEEE
Query VEDLALRSSFVEASRTALRELAARLAeegFGELPVLVGYLDRSEsaqpkygqpaGAPRNA  111
ident  ||  |  |   |   ||  |    |          ||   |                | 
Sbjct IEDVLLQDSLLDAVEDALLDLVTESA---DLLPVLVVGAPLRHR----------HRIYNT  107
DSSP  LHHHHHLHHHHHHHHHHHHHHHHHHL---LLLLEEEEEEEEEEL----------LEEEEE


DSSP  EEEEELLEEEEEEELLLLLLLLLLLHHHHLLLLL----------------EEEEEEE---
Query AAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGD----------------TMPIVRL---  152
ident | | ||| |     |  || |  | | |   |||                |         
Sbjct AVVIHRGAVLGVVPKSYLPTYREFYERRQMAPGDgergtiriggadvafgTDLLFAAsdl  167
DSSP  EEEEELLEEEEEEELLLLLLLLLLLHHHHEELLLlllleeeelleeeellLLEEEEElll


DSSP  LLEEEEEEEHHHHHLLLLHHHHHHHLLLLEEEEEELLLLLLLLLLHHHHHHHHHHHHHLL
Query HGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGC  212
ident  |      ||||          |  |||  |     ||        |  | |        
Sbjct PGFVLHVEICEDMFVPMPPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASARCLA  227
DSSP  LLLEEEEEEHHHHHLLLLHHHHHHHHLLLEEEEELLLLLLLLHHHHHHHHHHHHHHHLLL


DSSP  EEEEEELEE-EELL-EEEELLLEEELLlLLEEEELLLLL--LEEEEEEEEEL--------
Query TTAYLAMIG-GQDE-LVFDGDSIVVDRdGEVVARAPQFS--EGCVVLDLDLP--------  260
ident    | |         |  ||        |   |    |       | | |          
Sbjct AYVYAAAGEgESTTdLAWDGQTMIWEN-GALLAESERFPkgVRRSVADVDTEllrserlr  286
DSSP  EEEEELLLLlLLLLlLLLLLLEEEEEL-LEEEEELLLLLllLEEEEEEEEHHhhhhhhhh


DSSP  --------lllllLLLLlllllleEEEEELLlllLLLLLLLLL-----------------
Query --------aaeaePPTGvvddglrIDRLVISeepLPAYEAELA-----------------  295
ident                           |              |                  
Sbjct mgtfddnrrhhreLTES-------FRRIDFAldpPAGDIGLLReverfpfvpadpqrlqq  339
DSSP  lhhhhhhhhhlhhHHHL-------LEEEEELlllLLLLLLLLLlllllllllllhhhhhh


DSSP  --------------llllllllhhhhhhhhhhhhhhhhhhlllllleeeellllhhhhhh
Query --------------ggyadrldadeevysalvvglrayvakngfrsvliglsggidsalv  341
ident                                                             
Sbjct dcyeayniqvsgleqrlraldypkvvigvsggldsthalivathamdregrprsdilafa  399
DSSP  hhhhhhhhhhhhhhhhhhhlllleeeeellllhhhhhhhhhhhhhhhhllllhhheeeee


DSSP  hhhhhhhhlhhheeeeelllLLLLHHHHHHHhhhhhhhlleeeelllhhhhhhhhhhhll
Query aaiacdalgaqnvygvsmpsKYSSDHSKGDAaelarrtglnfrtvsiepmfdaymaslgl  401
ident                                                             
Sbjct lpgfknnaiklaralgvtfsEIDIGDTARLM-lhtighpysvgekvydvtfenvqaglrt  458
DSSP  lllllhhh