Results

Parseable data
Matches to PDB90
Dali: mol1A,

Query: mol1A

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, to pre-computed structural neighbours in the Dali Database, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1npe-A 23.8  3.0  243   263   12 PDB  MOLECULE: NIDOGEN;                                                   
   2:  3fvz-A 20.3  3.1  237   329   15 PDB  MOLECULE: PEPTIDYL-GLYCINE ALPHA-AMIDATING MONOOXYGENASE;            
   3:  2p4o-A 20.2  3.0  234   302   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
   4:  1q7f-B 20.1  3.1  223   282   14 PDB  MOLECULE: BRAIN TUMOR CG10719-PA;                                    
   5:  2ism-B 19.7  2.6  228   333   15 PDB  MOLECULE: PUTATIVE OXIDOREDUCTASE;                                   
   6:  1l0q-A 19.3  3.6  234   391   14 PDB  MOLECULE: SURFACE LAYER PROTEIN;                                     
   7:  3hrp-A 19.1  2.9  230   400    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
   8:  2ghs-A 19.1  3.0  231   294   12 PDB  MOLECULE: AGR_C_1268P;                                               
   9:  3e5z-A 19.0  3.1  221   290   13 PDB  MOLECULE: PUTATIVE GLUCONOLACTONASE;                                 
  10:  1rwi-A 18.9  3.1  216   256   12 PDB  MOLECULE: SERINE/THREONINE-PROTEIN KINASE PKND;                      
  11:  3dr2-A 18.8  3.1  221   299   12 PDB  MOLECULE: EXPORTED GLUCONOLACTONASE;                                 
  12:  3kya-A 18.7  2.8  228   471   14 PDB  MOLECULE: PUTATIVE PHOSPHATASE;                                      
  13:  1v04-A 18.7  3.2  226   332   12 PDB  MOLECULE: SERUM PARAOXONASE/ARYLESTERASE 1;                          
  14:  3bws-A 18.6  3.4  240   407    9 PDB  MOLECULE: PROTEIN LP49;                                              
  15:  2qe8-A 18.5  2.7  226   336    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
  16:  2dso-C 18.5  3.5  232   323   12 PDB  MOLECULE: DRP35;                                                     
  17:  1pjx-A 18.5  3.2  223   314   11 PDB  MOLECULE: DIISOPROPYLFLUOROPHOSPHATASE;                              
  18:  2vpj-A 18.5  3.2  242   289   12 PDB  MOLECULE: KELCH-LIKE PROTEIN 12;                                     
  19:  2hqs-A 18.5  3.3  236   412    9 PDB  MOLECULE: PROTEIN TOLB;                                              
  20:  2g8s-A 18.3  2.7  226   347    9 PDB  MOLECULE: GLUCOSE/SORBOSONE DEHYDROGENASES;                          
  21:  1ri6-A 18.2  3.4  237   333    8 PDB  MOLECULE: PUTATIVE ISOMERASE YBHE;                                   
  22:  2dyh-A 18.0  3.1  242   296    9 PDB  MOLECULE: KELCH-LIKE ECH-ASSOCIATED PROTEIN 1;                       
  23:  2fp9-A 17.9  3.3  231   305   11 PDB  MOLECULE: STRICTOSIDINE SYNTHASE;                                    
  24:  1jof-A 17.8  3.8  248   365    6 PDB  MOLECULE: CARBOXY-CIS,CIS-MUCONATE CYCLASE;                          
  25:  3das-A 17.8  3.2  227   334   10 PDB  MOLECULE: PUTATIVE OXIDOREDUCTASE;                                   
  26:  3frx-B 17.8  3.6  225   313   11 PDB  MOLECULE: GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-           
  27:  2p9w-A 17.7  3.1  228   333    8 PDB  MOLECULE: MAL S 1 ALLERGENIC PROTEIN;                                
  28:  1fwx-A 17.6  3.7  253   591    9 PDB  MOLECULE: NITROUS OXIDE REDUCTASE;                                   
  29:  2qc5-A 17.4  3.7  220   298   14 PDB  MOLECULE: STREPTOGRAMIN B LACTONASE;                                 
  30:  3bg1-A 17.3  3.5  222   285    6 PDB  MOLECULE: PROTEIN SEC13 HOMOLOG;                                     
  31:  1c9u-B 17.1  3.0  230   452   13 PDB  MOLECULE: SOLUBLE QUINOPROTEIN GLUCOSE DEHYDROGENASE;                
  32:  2h9l-A 17.0  3.5  224   321   13 PDB  MOLECULE: WD-REPEAT PROTEIN 5;                                       
  33:  3fgb-A 16.9  3.6  235   349    7 PDB  MOLECULE: UNCHARACTERIZED PROTEIN Q89ZH8_BACTN;                      
  34:  3dsm-A 16.6  3.7  241   327   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BACUNI_02894;                      
  35:  1qni-A 16.5  3.7  243   572    8 PDB  MOLECULE: NITROUS-OXIDE REDUCTASE;                                   
  36:  1p22-A 16.3  3.3  219   402   11 PDB  MOLECULE: F-BOX/WD-REPEAT PROTEIN 1A;                                
  37:  3ewe-A 16.3  3.4  206   255    9 PDB  MOLECULE: NUCLEOPORIN SEH1;                                          
  38:  3fm0-A 16.1  3.5  216   328    8 PDB  MOLECULE: PROTEIN CIAO1;                                             
  39:  2ce8-A 16.0  3.4  222   337    9 PDB  MOLECULE: TRANSDUCIN-LIKE ENHANCER PROTEIN 1;                        
  40:  3dm0-A 16.0  3.4  219   675   10 PDB  MOLECULE: MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH             
  41:  3ei4-B 15.9  3.6  218   368   10 PDB  MOLECULE: DNA DAMAGE-BINDING PROTEIN 1;                              
  42:  3ei1-B 15.9  3.5  220   355    8 PDB  MOLECULE: DNA DAMAGE-BINDING PROTEIN 1;                              
  43:  2pbi-D 15.9  3.1  214   354    9 PDB  MOLECULE: REGULATOR OF G-PROTEIN SIGNALING 9;                        
  44:  2woz-A 15.8  3.7  244   307   11 PDB  MOLECULE: KELCH REPEAT AND BTB DOMAIN-CONTAINING PROTEIN             
  45:  3ii7-A 15.8  3.5  235   288    8 PDB  MOLECULE: KELCH-LIKE PROTEIN 7;                                      
  46:  1vyh-C 15.7  3.1  207   310   13 PDB  MOLECULE: PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB              
  47:  3iiy-A 15.6  3.2  224   364    9 PDB  MOLECULE: POLYCOMB PROTEIN EED;                                      
  48:  3gfc-A 15.6  3.5  221   339   12 PDB  MOLECULE: HISTONE-BINDING PROTEIN RBBP4;                             
  49:  2ojh-A 15.5  3.6  230   277   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN ATU1656/AGR_C_3050;                
  50:  1kit-A 15.4  3.6  240   757   11 PDB  MOLECULE: SIALIDASE;                                                 
  51:  1n7d-A 15.4  3.0  203   639   12 PDB  MOLECULE: LOW-DENSITY LIPOPROTEIN RECEPTOR;                          
  52:  3h71-B 15.3  3.5  233   477    8 PDB  MOLECULE: SIALIDASE A;                                               
  53:  3cfv-B 15.3  3.5  213   393    6 PDB  MOLECULE: HISTONE-BINDING PROTEIN RBBP7;                             
  54:  3c99-A 15.3  3.4  210   380    5 PDB  MOLECULE: CHROMATIN ASSEMBLY FACTOR 1 P55 SUBUNIT;                   
  55:  2z2o-C 15.3  3.3  211   299   11 PDB  MOLECULE: VIRGINIAMYCIN B LYASE;                                     
  56:  1w8n-A 15.2  3.5  232   601    9 PDB  MOLECULE: BACTERIAL SIALIDASE;                                       
  57:  3fcs-A 15.0  3.6  233   911   11 PDB  MOLECULE: INTEGRIN, ALPHA 2B;                                        
  58:  1sli-A 15.0  3.4  236   679    9 PDB  MOLECULE: INTRAMOLECULAR TRANS-SIALIDASE;                            
  59:  3hfq-A 15.0  3.1  208   341    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN LP_2219;                           
  60:  3h6j-A 15.0  3.3  236   438    7 PDB  MOLECULE: NEURAMINIDASE;                                             
  61:  2ece-A 14.9  3.7  246   455   12 PDB  MOLECULE: 462AA LONG HYPOTHETICAL SELENIUM-BINDING PROTEIN;          
  62:  3jro-A 14.9  3.6  213   701    9 PDB  MOLECULE: FUSION PROTEIN OF PROTEIN TRANSPORT PROTEIN SEC13          
  63:  3elq-B 14.8  3.4  223   566   13 PDB  MOLECULE: ARYLSULFATE SULFOTRANSFERASE;                              
  64:  3dw8-B 14.8  3.3  222   421    9 PDB  MOLECULE: SERINE/THREONINE-PROTEIN PHOSPHATASE 2A 65 KDA             
  65:  3f3f-A 14.8  3.3  206   308    6 PDB  MOLECULE: NUCLEOPORIN SEH1;                                          
  66:  3ije-A 14.6  3.9  238   938   12 PDB  MOLECULE: INTEGRIN ALPHA-V;                                          
  67:  1dil-A 14.5  3.6  233   381    9 PDB  MOLECULE: SIALIDASE;                                                 
  68:  2hes-X 14.5  3.2  207   308   12 PDB  MOLECULE: YDR267CP;                                                  
  69:  3k6s-A 14.4  4.0  227  1082    9 PDB  MOLECULE: INTEGRIN ALPHA-X;                                          
  70:  3k6s-C 14.4  4.0  226   885    9 PDB  MOLECULE: INTEGRIN ALPHA-X;                                          
  71:  2ags-A 14.4  3.4  234   634    4 PDB  MOLECULE: SIALIDASE;                                                 
  72:  2bf6-A 14.4  3.1  227   448    8 PDB  MOLECULE: EXO-ALPHA-SIALIDASE;                                       
  73:  2f10-A 14.4  3.2  231   349    8 PDB  MOLECULE: SIALIDASE 2;                                               
  74:  1erj-C 14.4  3.4  208   357   10 PDB  MOLECULE: TRANSCRIPTIONAL REPRESSOR TUP1;                            
  75:  3dwl-H 14.3  3.4  211   337    9 PDB  MOLECULE: ACTIN-RELATED PROTEIN 3;                                   
  76:  2jkb-A 14.1  3.7  236   661    8 PDB  MOLECULE: SIALIDASE B;                                               
  77:  1nr0-A 14.1  3.3  222   610    5 PDB  MOLECULE: ACTIN INTERACTING PROTEIN 1;                               
  78:  3ho5-B 14.0  3.3  233   451   12 PDB  MOLECULE: HEDGEHOG-INTERACTING PROTEIN;                              
  79:  3i2n-A 13.7  3.5  205   343    8 PDB  MOLECULE: WD REPEAT-CONTAINING PROTEIN 92;                           
  80:  3b69-A 13.6  3.5  234   626    6 PDB  MOLECULE: TRANS-SIALIDASE;                                           
  81:  3ei1-A 13.5  3.9  217  1105   10 PDB  MOLECULE: DNA DAMAGE-BINDING PROTEIN 1;                              
  82:  3e0c-A 13.5  3.7  217  1011   10 PDB  MOLECULE: DNA DAMAGE-BINDING PROTEIN 1;                              
  83:  2cn3-A 13.4  3.5  223   728   12 PDB  MOLECULE: BETA-1,4-XYLOGLUCAN HYDROLASE;                             
  84:  1iub-A 13.4  3.3  218   312    7 PDB  MOLECULE: FUCOSE-SPECIFIC LECTIN;                                    
  85:  2cn2-A 13.2  3.6  217   704   11 PDB  MOLECULE: BETA-1,4-XYLOGLUCAN HYDROLASE;                             
  86:  1vcu-B 13.2  3.1  224   373    7 PDB  MOLECULE: SIALIDASE 2;                                               
  87:  2aq5-A 13.2  3.5  219   395    8 PDB  MOLECULE: CORONIN-1A;                                                
  88:  3a0f-A 13.1  3.6  210   753   12 PDB  MOLECULE: XYLOGLUCANASE;                                             
  89:  1aom-B 13.1  4.0  227   559    9 PDB  MOLECULE: NITRITE REDUCTASE;                                         
  90:  2zwa-B 13.1  3.6  230   684   10 PDB  MOLECULE: LEUCINE CARBOXYL METHYLTRANSFERASE 2;                      
  91:  1nex-B 13.0  4.3  212   444    7 PDB  MOLECULE: CENTROMERE DNA-BINDING PROTEIN COMPLEX CBF3                
  92:  1jju-B 12.9  3.8  215   337   10 PDB  MOLECULE: QUINOHEMOPROTEIN AMINE DEHYDROGENASE;                      
  93:  2wg4-B 12.9  3.3  218   421   14 PDB  MOLECULE: SONIC HEDGEHOG PROTEIN N-PRODUCT;                          
  94:  2wft-B 12.8  3.4  214   408   13 PDB  MOLECULE: HEDGEHOG-INTERACTING PROTEIN;                              
  95:  2zkq-a 12.8  3.4  200   306    8 PDB  MOLECULE: 18S RIBOSOMAL RNA;                                         
  96:  1u2v-C 12.8  3.2  198   357   10 PDB  MOLECULE: ACTIN-RELATED PROTEIN 3;                                   
  97:  1z4w-A 12.7  3.9  229   448    9 PDB  MOLECULE: HEMAGGLUTININ-NEURAMINIDASE;                               
  98:  1k32-A 12.7  3.3  211  1023    9 PDB  MOLECULE: TRICORN PROTEASE;                                          
  99:  2pm9-A 12.7  3.3  206   384    7 PDB  MOLECULE: PROTEIN TRANSPORT PROTEIN SEC31;                           
 100:  1gjq-A 12.6  4.0  223   541    8 PDB  MOLECULE: NITRITE REDUCTASE;                                         
 101:  1sq9-A 12.6  3.4  184   378   13 PDB  MOLECULE: ANTIVIRAL PROTEIN SKI8;                                    
 102:  2vdu-D 12.6  3.7  201   376    8 PDB  MOLECULE: TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE-                    
 103:  1e8t-B 12.5  3.9  227   449    7 PDB  MOLECULE: HEMAGGLUTININ-NEURAMINIDASE;                               
 104:  1sqj-B 12.5  3.6  210   771    8 PDB  MOLECULE: OLIGOXYLOGLUCAN REDUCING-END-SPECIFIC                      
 105:  1v2i-A 12.4  3.9  230   431    9 PDB  MOLECULE: HEMAGGLUTININ-NEURAMINIDASE GLYCOPROTEIN;                  
 106:  1mg2-A 12.4  3.8  230   382   11 PDB  MOLECULE: METHYLAMINE DEHYDROGENASE, HEAVY CHAIN;                    
 107:  1b9x-A 12.4  3.5  206   340    7 PDB  MOLECULE: PROTEIN (TRANSDUCIN);                                      
 108:  2j04-B 12.3  3.5  221   471    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YPL007C;                              
 109:  3gre-A 12.3  3.9  218   408    9 PDB  MOLECULE: SERINE/THREONINE-PROTEIN KINASE VPS15;                     
 110:  1q47-B 12.2  3.9  229   495    5 PDB  MOLECULE: SEMAPHORIN 3A;                                             
 111:  1s18-A 12.2  3.5  204   317    8 PDB  MOLECULE: APYRASE;                                                   
 112:  2uvk-B 12.1  3.4  214   349    7 PDB  MOLECULE: YJHT;                                                      
 113:  2ovq-B 12.1  4.0  202   444    5 PDB  MOLECULE: S-PHASE KINASE-ASSOCIATED PROTEIN 1A;                      
 114:  1shy-B 12.0  3.5  217   499    7 PDB  MOLECULE: HEPATOCYTE GROWTH FACTOR;                                  
 115:  2uzy-B 11.8  3.4  213   630    8 PDB  MOLECULE: INTERNALIN B;                                              
 116:  1cvm-A 11.8  3.8  189   353    9 PDB  MOLECULE: PHYTASE;                                                   
 117:  1v0e-A 11.7  3.5  227   666    8 PDB  MOLECULE: ENDO-ALPHA-SIALIDASE;                                      
 118:  3eu7-A 11.5  3.7  215   313    8 PDB  MOLECULE: PARTNER AND LOCALIZER OF BRCA2;                            
 119:  1xip-A 11.4  3.6  208   367    6 PDB  MOLECULE: NUCLEOPORIN NUP159;                                        
 120:  1r5m-A 11.4  3.9  200   351   11 PDB  MOLECULE: SIR4-INTERACTING PROTEIN SIF2;                             
 121:  2j04-A 11.3  4.0  218   587    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YPL007C;                              
 122:  3b7f-A 11.1  3.9  203   368   10 PDB  MOLECULE: GLYCOSYL HYDROLASE, BNR REPEAT;                            
 123:  3hx6-A 11.0  3.7  203   491    5 PDB  MOLECULE: TYPE 4 FIMBRIAL BIOGENESIS PROTEIN PILY1;                  
 124:  3d12-A 11.0  3.9  224   428   10 PDB  MOLECULE: HEMAGGLUTININ-NEURAMINIDASE;                               
 125:  2zb6-A 10.9  3.8  222   427    4 PDB  MOLECULE: HEMAGGLUTININ PROTEIN;                                     
 126:  1kv9-A 10.8  4.1  208   664   12 PDB  MOLECULE: TYPE II QUINOHEMOPROTEIN ALCOHOL DEHYDROGENASE;            
 127:  1yfq-A 10.8  3.3  176   342    9 PDB  MOLECULE: CELL CYCLE ARREST PROTEIN BUB3;                            
 128:  2vsk-A 10.7  3.9  219   400    8 PDB  MOLECULE: HEMAGGLUTININ-NEURAMINIDASE;                               
 129:  1pgu-B 10.7  3.9  201   608    7 PDB  MOLECULE: ACTIN INTERACTING PROTEIN 1;                               
 130:  2h47-F 10.6  4.1  202   362    9 PDB  MOLECULE: AROMATIC AMINE DEHYDROGENASE;                              
 131:  3hxj-A 10.5  3.8  164   306   18 PDB  MOLECULE: PYRROLO-QUINOLINE QUINONE;                                 
 132:  3fsn-B 10.4  3.9  227   514    7 PDB  MOLECULE: RETINAL PIGMENT EPITHELIUM-SPECIFIC 65 KDA                 
 133:  3c75-H 10.4  4.2  207   375   10 PDB  MOLECULE: METHYLAMINE DEHYDROGENASE HEAVY CHAIN;                     
 134:  2iwa-A 10.4  3.8  165   254    9 PDB  MOLECULE: GLUTAMINE CYCLOTRANSFERASE;                                
 135:  2oit-A 10.3  3.8  209   434   10 PDB  MOLECULE: NUCLEOPORIN 214KDA;                                        
 136:  1g72-A 10.2  4.1  205   571    9 PDB  MOLECULE: METHANOL DEHYDROGENASE HEAVY SUBUNIT;                      
 137:  1oyg-A 10.1  4.2  212   440    9 PDB  MOLECULE: LEVANSUCRASE;                                              
 138:  2gop-A 10.1  4.0  197   320   11 PDB  MOLECULE: TRILOBED PROTEASE;                                         
 139:  2hye-A 10.0  4.1  208  1140    7 PDB  MOLECULE: DNA DAMAGE-BINDING PROTEIN 1;                              
 140:  1jmx-B  9.9  3.7  192   339    7 PDB  MOLECULE: AMINE DEHYDROGENASE;                                       
 141:  2hty-A  9.7  3.9  214   385    8 PDB  MOLECULE: NEURAMINDASE;                                              
 142:  2qr5-A  9.7  4.3  202   576    9 PDB  MOLECULE: ACYLAMINO-ACID-RELEASING ENZYME;                           
 143:  1yiq-A  9.6  4.1  202   684   10 PDB  MOLECULE: QUINOHEMOPROTEIN ALCOHOL DEHYDROGENASE;                    
 144:  1olz-A  9.4  4.0  201   621    9 PDB  MOLECULE: SEMAPHORIN 4D;                                             
 145:  2w5n-A  9.4  3.8  195   365    7 PDB  MOLECULE: ALPHA-L-ARABINOFURANOSIDASE;                               
 146:  1gyh-A  9.3  4.0  188   318    2 PDB  MOLECULE: ARABINAN ENDO-1,5-ALPHA-L-ARABINOSIDASE A;                 
 147:  3c7g-A  9.2  3.7  190   488    8 PDB  MOLECULE: ENDO-1,4-BETA-XYLANASE;                                    
 148:  1lrw-A  9.1  3.7  204   600    9 PDB  MOLECULE: METHANOL DEHYDROGENASE SUBUNIT 1;                          
 149:  2htv-A  9.1  4.0  216   388   10 PDB  MOLECULE: NEURAMINIDASE;                                             
 150:  1mda-H  9.1  3.8  191   368    9 PDB  MOLECULE: METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT);                 
 151:  2ht5-A  9.0  4.1  216   387    5 PDB  MOLECULE: NEURAMINIDASE;                                             
 152:  3cpn-A  9.0  3.8  192   319   10 PDB  MOLECULE: BETA-XYLOSIDASE, FAMILY 43 GLYCOSYL HYDROLASE;             
 153:  1flg-A  8.9  3.6  192   582    9 PDB  MOLECULE: PROTEIN (QUINOPROTEIN ETHANOL DEHYDROGENASE);              
 154:  1kb0-A  8.8  3.6  186   670   11 PDB  MOLECULE: QUINOHEMOPROTEIN ALCOHOL DEHYDROGENASE;                    
 155:  1v0z-A  8.6  4.1  215   389   10 PDB  MOLECULE: NEURAMINIDASE;                                             
 156:  1yif-A  8.6  4.0  191   532   10 PDB  MOLECULE: BETA-1,4-XYLOSIDASE;                                       
 157:  1y4w-A  8.5  4.0  191   517    4 PDB  MOLECULE: EXO-INULINASE;                                             
 158:  2d0v-A  8.4  3.8  193   597   11 PDB  MOLECULE: METHANOL DEHYDROGENASE LARGE SUBUNIT;                      
 159:  1a4g-A  8.3  3.6  180   390    8 PDB  MOLECULE: NEURAMINIDASE;                                             
 160:  3kst-A  8.3  3.5  186   291   10 PDB  MOLECULE: ENDO-1,4-BETA-XYLANASE;                                    
 161:  1ing-A  8.2  4.0  206   388    9 PDB  MOLECULE: INFLUENZA A SUBTYPE N2 NEURAMINIDASE;                      
 162:  2exh-A  8.2  4.1  189   533    8 PDB  MOLECULE: BETA-D-XYLOSIDASE;                                         
 163:  1nca-N  8.1  4.2  207   389    7 PDB  MOLECULE: INFLUENZA A SUBTYPE N9 NEURAMINIDASE;                      
 164:  1xks-A  8.1  4.4  189   374    5 PDB  MOLECULE: NUCLEAR PORE COMPLEX PROTEIN NUP133;                       
 165:  3hxr-A  8.0  4.1  201   660    4 PDB  MOLECULE: NUCLEOPORIN NUP120;                                        
 166:  1uv4-A  8.0  4.2  175   291    9 PDB  MOLECULE: ARABINAN-ENDO 1,5-ALPHA-L-ARABINASE;                       
 167:  1uyp-A  7.9  3.7  184   432    5 PDB  MOLECULE: BETA-FRUCTOSIDASE;                                         
 168:  2oaj-A  7.9  3.8  191   875    8 PDB  MOLECULE: PROTEIN SNI1;                                              
 169:  3c5m-B  7.7  4.2  202   378    7 PDB  MOLECULE: OLIGOGALACTURONATE LYASE;                                  
 170:  3cu9-A  7.7  4.1  182   314    7 PDB  MOLECULE: INTRACELLULAR ARABINANASE;                                 
 171:  2aep-A  7.6  3.9  200   388   11 PDB  MOLECULE: NEURAMINIDASE;                                             
 172:  1k3i-A  7.6  3.6  188   651   10 PDB  MOLECULE: GALACTOSE OXIDASE PRECURSOR;                               
 173:  1y7b-A  7.6  3.6  185   534   10 PDB  MOLECULE: BETA-XYLOSIDASE, FAMILY 43 GLYCOSYL HYDROLASE;             
 174:  1su3-B  7.6  4.2  150   416    8 PDB  MOLECULE: INTERSTITIAL COLLAGENASE;                                  
 175:  2ac1-A  7.5  3.8  181   537    9 PDB  MOLECULE: INVERTASE;                                                 
 176:  1st8-A  7.3  4.2  190   537    7 PDB  MOLECULE: FRUCTAN 1-EXOHYDROLASE IIA;                                
 177:  1bpo-B  7.2  3.9  191   493    6 PDB  MOLECULE: PROTEIN (CLATHRIN);                                        
 178:  3c2u-A  7.2  4.1  185   538    9 PDB  MOLECULE: XYLOSIDASE/ARABINOSIDASE;                                  
 179:  2zuy-A  7.1  3.6  183   603   10 PDB  MOLECULE: YESX PROTEIN;                                              
 180:  1yrz-A  7.0  3.9  178   522    6 PDB  MOLECULE: XYLAN BETA-1,4-XYLOSIDASE;                                 
 181:  1w18-B  6.8  4.1  183   493    7 PDB  MOLECULE: LEVANSUCRASE;                                              
 182:  3kci-A  6.8  4.3  179   366    7 PDB  MOLECULE: PROBABLE E3 UBIQUITIN-PROTEIN LIGASE HERC2;                
 183:  1fbl-A  6.7  4.1  138   367   11 PDB  MOLECULE: FIBROBLAST (INTERSTITIAL) COLLAGENASE (MMP-1);             
 184:  1yr2-A  6.5  4.0  159   680    9 PDB  MOLECULE: PROLYL OLIGOPEPTIDASE;                                     
 185:  2bwr-A  6.4  4.5  190   401    6 PDB  MOLECULE: PSATHYRELLA VELUTINA LECTIN;                               
 186:  1vkd-A  6.4  3.4  160   327   10 PDB  MOLECULE: CONSERVED HYPOTHETICAL PROTEIN TM1225;                     
 187:  3beq-A  6.3  4.0  184   385    6 PDB  MOLECULE: NEURAMINIDASE;                                             
 188:  1tl2-A  6.2  3.9  167   235    9 PDB  MOLECULE: PROTEIN (TACHYLECTIN-2);                                   
 189:  1w6s-C  6.1  3.6  151   596   14 PDB  MOLECULE: METHANOL DEHYDROGENASE SUBUNIT 1;                          
 190:  1a12-A  6.1  4.4  181   401    7 PDB  MOLECULE: REGULATOR OF CHROMOSOME CONDENSATION 1;                    
 191:  2biw-A  6.1  5.0  184   479    9 PDB  MOLECULE: APOCAROTENOID-CLEAVING OXYGENASE;                          
 192:  2z8r-A  5.8  4.0  190   583    5 PDB  MOLECULE: YESW PROTEIN;                                              
 193:  1itv-A  5.6  3.6  123   195    7 PDB  MOLECULE: MMP9;                                                      
 194:  2ecf-A  5.2  4.6  167   700   10 PDB  MOLECULE: DIPEPTIDYL PEPTIDASE IV;                                   
 195:  3c7x-A  5.1  4.1  134   196   10 PDB  MOLECULE: MATRIX METALLOPROTEINASE-14;                               
 196:  1h2z-A  5.0  4.6  143   712    8 PDB  MOLECULE: PROLYL ENDOPEPTIDASE;                                      
 197:  1xfd-A  5.0  4.9  163   723    7 PDB  MOLECULE: DIPEPTIDYL AMINOPEPTIDASE-LIKE PROTEIN 6;                  
 198:  1z68-A  4.8  4.5  160   719    5 PDB  MOLECULE: FIBROBLAST ACTIVATION PROTEIN, ALPHA SUBUNIT;              
 199:  1r9m-B  4.7  4.7  184   733    7 PDB  MOLECULE: DIPEPTIDYL PEPTIDASE IV;                                   
 200:  2gbc-A  4.7  4.4  161   730    6 PDB  MOLECULE: DIPEPTIDYL PEPTIDASE 4;                                    
 201:  2bkl-B  4.7  3.9  133   677    7 PDB  MOLECULE: PROLYL ENDOPEPTIDASE;                                      
 202:  1pex-A  4.6  4.1  120   192    7 PDB  MOLECULE: COLLAGENASE-3;                                             
 203:  1jtd-B  4.5  4.0  155   273    6 PDB  MOLECULE: TEM-1 BETA-LACTAMASE;                                      
 204:  1qjs-A  4.4  4.6  137   408    7 PDB  MOLECULE: HEMOPEXIN;                                                 
 205:  3ba0-A  4.4  4.2  124   365    2 PDB  MOLECULE: MACROPHAGE METALLOELASTASE;                                
 206:  2b4w-A  4.0  4.4  136   292    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN, CONSERVED;                           
 207:  2gu3-A  4.0  3.1   55   128   11 PDB  MOLECULE: YPMB PROTEIN;                                              
 208:  1n7v-A  3.7  4.5  159   533    4 PDB  MOLECULE: ADSORPTION PROTEIN P2;                                     
 209:  1suu-A  3.7  3.5  133   293    6 PDB  MOLECULE: DNA GYRASE SUBUNIT A;                                      
 210:  3f6k-A  3.4  7.5  140   657    4 PDB  MOLECULE: SORTILIN;                                                  
 211:  2bs5-A  3.3  2.8   78    90    9 PDB  MOLECULE: LECTIN;                                                    
 212:  2d5l-A  3.2  4.0  146   665   12 PDB  MOLECULE: DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE;                    
 213:  2d73-A  3.2 12.3   88   717    9 PDB  MOLECULE: ALPHA-GLUCOSIDASE SUSB;                                    
 214:  1n7u-A  3.1  4.4  130   554    7 PDB  MOLECULE: ADSORPTION PROTEIN P2;                                     
 215:  2oqe-B  3.1  4.7   97   657    9 PDB  MOLECULE: PEROXISOMAL COPPER AMINE OXIDASE;                          
 216:  3b77-A  3.0  4.0   73   188    3 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
 217:  2be1-A  2.9  3.5  107   301   10 PDB  MOLECULE: SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE           
 218:  2dyc-A  2.9  4.1   85   147    5 PDB  MOLECULE: GALECTIN-4;                                                
 219:  1gxd-A  2.8  4.0  112   624    7 PDB  MOLECULE: 72 KDA TYPE IV COLLAGENASE;                                
 220:  1dyn-A  2.8  3.1   52   113    4 PDB  MOLECULE: DYNAMIN;                                                   
 221:  1lqm-H  2.7  2.6   45    84    7 PDB  MOLECULE: URACIL-DNA GLYCOSYLASE;                                    
 222:  2q1f-A  2.6  4.4  143   991    9 PDB  MOLECULE: CHONDROITINASE;                                            
 223:  1nd4-A  2.6  9.3   73   255    5 PDB  MOLECULE: AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE;                      
 224:  2a5z-C  2.5  4.0  107   244    4 PDB  MOLECULE: HYPOTHETICAL PROTEIN SO2946;                               
 225:  2dn6-A  2.5  5.3   53   115    4 PDB  MOLECULE: KIAA0640 PROTEIN;                                          
 226:  1p32-A  2.3  4.3   81   182    6 PDB  MOLECULE: MITOCHONDRIAL MATRIX PROTEIN, SF2P32;                      
 227:  1m98-A  2.3  2.7   63   316   10 PDB  MOLECULE: ORANGE CAROTENOID PROTEIN;                                 
 228:  1j7l-A  2.3 11.7   81   263    4 PDB  MOLECULE: AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE;                      
 229:  3bwb-A  2.3 11.3   73   288    5 PDB  MOLECULE: SPERMIDINE SYNTHASE;                                       
 230:  2jc6-A  2.3  4.3   54   278    7 PDB  MOLECULE: CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE           
 231:  1nkg-A  2.2 16.5   94   508    7 PDB  MOLECULE: RHAMNOGALACTURONASE B;                                     
 232:  3dob-B  2.1  2.9   63   148   14 PDB  MOLECULE: HEAT SHOCK 70 KDA PROTEIN F44E5.5;                         
 233:  3hko-A  2.1  9.5   68   319    6 PDB  MOLECULE: CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH           
 234:  2hel-A  2.1 12.2   72   256    7 PDB  MOLECULE: EPH RECEPTOR A4;                                           
 235:  2vwi-A  2.1  7.9   63   236    5 PDB  MOLECULE: SERINE/THREONINE-PROTEIN KINASE OSR1;                      
 236:  1ni2-A  2.1  4.4   50   296    8 PDB  MOLECULE: EZRIN;                                                     
 237:  1qmo-E  2.0  4.4   65   117    9 PDB  MOLECULE: MANNOSE BINDING LECTIN, FRIL;                              
 238:  3fka-B  2.0  2.2   48   120    8 PDB  MOLECULE: UNCHARACTERIZED NTF-2 LIKE PROTEIN;                        
 239:  1rn7-A  2.0  2.3   48   112    8 PDB  MOLECULE: CYSTATIN D;                                                
 240:  3fbv-D  2.0  4.3   62   425    5 PDB  MOLECULE: SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=mol1A Sbjct=1npeA Z-score=23.8

back to top
DSSP  lLLEEEEELllLLEEEEEEL----LLLE-EEEEEELLLlLLLLEEEELL-LLLEEEELL-
Query sPQHLLVGGsgWNKIAIINK----DTKE-IVWEYPLEKgWECNSVAATK-AGEILFSYS-   53
ident    |||       ||           |                  |              
Sbjct -GTHLLFAQ--TGKIERLPLerntMKKTeAKAFLHIPA-KVIIGLAFDCvDKVVYWTDIs   56
DSSP  -LEEEEEEE--EEEEEEEEEllllLLHHhLEEEEEEEE-EEEEEEEEELlLLEEEEEELl


DSSP  -LEEEEELL-LLLEEEEEElLLLLEEEEEEELLL-LLEEEEEELLlEEEEEELLLLLEEE
Query -KGAKXITR-DGRELWNIAaPAGCEXQTARILPD-GNALVAWCGHpSTILEVNXKGEVLS  110
ident            |     |                              |      |    
Sbjct ePSIGRASLhGGEPTTIIR-QDLGSPEGIALDHLgRTIFWTDSQL-DRIEVAKMDGTQRR  114
DSSP  lLEEEEEELlLLLLEEEEL-LLLLLEEEEEEELLlLEEEEEELLL-LEEEEEELLLLLLE


DSSP  EEEELLllllhhHLLLLLEEL-LLLLEEEEELL--LLEEEEEL-LLLLEEEEEE-LLLLL
Query KTEFETgierphAQFRQINKN-KKGNYLVPLFA--TSEVREIA-PNGQLLNSVK-LSGTP  165
ident                | |      ||                               | |
Sbjct VLFDTG-----lVNPRGIVTDpVRGNLYWTDWNrdNPKIETSHmDGTNRRILAQdNLGLP  169
DSSP  EEELLL-----lLLEEEEEEElLLLEEEEEELLllLLEEEEEElLLLLLEEEELlLLLLE


DSSP  LEEEEL-LLLLEEEELLLLLEEEEELLLLLLEEEEEEHhhlllllLLEEEEEEELLlLLE
Query FSSAFL-DNGDCLVACGDAHCFVQLNLESNRIVRRVNAndiegvqLFFVAQLFPLQnGGL  224
ident     |              |    ||                   |             |
Sbjct NGLTFDaFSSQLCWVDAGTHRAECLNPAQPGRRKVLEG-------LQYPFAVTSYG-KNL  221
DSSP  EEEEEElLLLEEEEEELLLLEEEEEELLEEEEEEEEEL-------LLLEEEEEEEL-LEE


DSSP  EEEEELlllllhhhllLLLEEEEL-LLLLEEEEELLlLLLLLLLEEEEELL--
Query YICNWQghdreagkgkHPQLVEID-SEGKVVWQLNDkVKFGXISTICPIRE--  274
ident |   |                  |    |         |      |       
Sbjct YYTDWK----------TNSVIAMDlAISKEMDTFHP-HKQTRLYGITIALSqc  263
DSSP  EEEELL----------LLEEEEEElLLLEEEEEELL-LLLLLLLLEEEELLll


No 2: Query=mol1A Sbjct=3fvzA Z-score=20.3

back to top
DSSP  llleeeeellllleeeeeelLLLEEE---EEEELLllLLLLEEEELLLLLEEEELLL---
Query spqhllvggsgwnkiaiinkDTKEIV---WEYPLEkgWECNSVAATKAGEILFSYSK---   54
ident                        |       | |        ||                
Sbjct ------------hhhhhhdfHVEEELdwpGVYLLP--GQVSGVALDSKNNLVIFHRGdhv   46
DSSP  ------------llllllleEEEELLllhHHHLLL--LLEEEEEELLLLLEEEEELLlll


DSSP  -----------------------EEEEELL-LLLE-EEEEELLllLEEEEEEELLLLLEE
Query -----------------------GAKXITR-DGRE-LWNIAAPagCEXQTARILPDGNAL   89
ident                            |                        |  |||  
Sbjct wdgnsfdskfvyqqrglgpieedTILVIDPnNAEIlQSSGKNL-fYLPHGLSIDTDGNYW  105
DSSP  llllllllllllllhhhllllllLEEEELLlLLLEeEEELLLL-lLLEEEEEELLLLLEE


DSSP  EEEELLlEEEEEELLLL--LEEEEEEE--LLLL-llhhHLLLLLEEL-LLLLEEEEEL-L
Query VAWCGHpSTILEVNXKG--EVLSKTEF--ETGI-erphAQFRQINKN-KKGNYLVPLF-A  142
ident |                    |         |       |          |   |     
Sbjct VTDVAL-HQVFKLDPHSkeGPLLILGRsmQPGSdqnhfCQPTDVAVEpSTGAVFVSDGyC  164
DSSP  EEELLL-LEEEEELLLLllLLLEEELLllLLLLlllllLLEEEEEELlLLLLEEEEELlL


DSSP  LLEEEEELLLLLEEEEEE-----------LLLLLLEEEEL-LLLLEEEELLLLLEEEEEL
Query TSEVREIAPNGQLLNSVK-----------LSGTPFSSAFL-DNGDCLVACGDAHCFVQLN  190
ident  |      | |                      | | |         ||           
Sbjct NSRIVQFSPSGKFVTQWGeessgssprpgQFSVPHSLALVpHLDQLCVADRENGRIQCFK  224
DSSP  LLEEEEELLLLLEEEEELeelllllllllEELLEEEEEEElLLLEEEEEELLLLEEEEEE


DSSP  LLLLLEEEEEEHHhlllLLLLEEEEEEELLlLLEEEEEELLlLLLHhhLLLLLEEEEL-L
Query LESNRIVRRVNANdiegVQLFFVAQLFPLQnGGLYICNWQGhDREAgkGKHPQLVEID-S  249
ident       ||              |        | |   |              |      |
Sbjct TDTKEFVREIKHA----SFGRNVFAISYIP-GFLFAVNGKP-YFGD--QEPVQGFVMNfS  276
DSSP  LLLLLEEEEELLL----LLLLLEEEEEEEL-LEEEEEELLL-LLLL--LLLLLEEEEElL


DSSP  LLLEEEEELLLLLLL-LLLEEEEELL---------------------------
Query EGKVVWQLNDKVKFG-XISTICPIRE---------------------------  274
ident  |          |       |                                
Sbjct SGEIIDVFKPVRKHFdMPHDIVASEDgtvyigdahtntvwkftltekmehrsv  329
DSSP  LLLEEEEELLLLLLLlLEEEEEELLLleeeeeellllleeeeeeeelllllll


No 3: Query=mol1A Sbjct=2p4oA Z-score=20.2

back to top
DSSP  ------------------------------------lLLEEEEELLLLLEEEEEELLlLE
Query ------------------------------------sPQHLLVGGSGWNKIAIINKDtKE   24
ident                                           |       |  |  |   
Sbjct saglppiyadkpielapakiitsfpvntflenlasapDGTIFVTNHEVGEIVSITPD-GN   59
DSSP  llllllllllllllllleeeeeeellllleeeeeellLLLEEEEELLLLEEEEELLL-LL


DSSP  EEEEEELLllLLLLEEEELLLLLEEEELL-----LEEEEELLLLLEEEEEELLLLLEEEE
Query IVWEYPLEkgWECNSVAATKAGEILFSYS-----KGAKXITRDGRELWNIAAPAGCEXQT   79
ident        |        | |  |                    ||        |       
Sbjct QQIHATVE--GKVSGLAFTSNGDLVATGWnadsiPVVSLVKSDGTVETLLTLPDAIFLNG  117
DSSP  EEEEEELL--LEEEEEEELLLLLEEEEEElllllEEEEEELLLLLEEEEEELLLLLLEEE


DSSP  EEELLLLLEEEEEELlLEEEEEELLL-LLEEEEEEEL--LLLL--LHHHLLLLLEELLLl
Query ARILPDGNALVAWCGhPSTILEVNXK-GEVLSKTEFE--TGIE--RPHAQFRQINKNKKg  134
ident    | |   | |       |              |                         
Sbjct ITPLSDTQYLTADSY-RGAIWLIDVVqPSGSIWLEHPxlARSNseSVFPAANGLKRFGN-  175
DSSP  EEELLLLEEEEEELL-LLEEEEEELLlLEEEEEEELHhhLLLLllLLLLLEEEEEEELL-


DSSP  LEEEEELLLLEEEEELL-----LLLEEEEEELLlLLLEEEELLLLLEEEELLLLLEEEEE
Query NYLVPLFATSEVREIAP-----NGQLLNSVKLSgTPFSSAFLDNGDCLVACGDAHCFVQL  189
ident    |          |        |     |         ||   |    |       |  
Sbjct FLYVSNTEKXLLLRIPVdstdkPGEPEIFVEQT-NIDDFAFDVEGNLYGATHIYNSVVRI  234
DSSP  EEEEEELLLLEEEEEELlllllLLLLEEEEELL-LLLLEEELLLLLEEEELLLLLLEEEE


DSSP  LLlLLLEeEEEEHhhllLLLLLEEEEEEELL----LLLEEEEEE-LLLL---LLHHhllL
Query NLeSNRIvRRVNAndieGVQLFFVAQLFPLQ----NGGLYICNW-QGHD---REAGkgkH  241
ident                               |        |                    
Sbjct AP-DRST-TIIAQ---aEQGVIGSTAVAFGQtegdCTAIYVVTNgGXFLpppTGVV---P  286
DSSP  LL-LLLE-EEEEL---hHHLLLLEEEEEELLllllLLEEEEEELlLLLLlllLLLL---L


DSSP  LLEEEELLLlleeeeelllllllllleeeeell
Query PQLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident    |                             
Sbjct ANVVRLEVG-----------------kpgyplg  302
DSSP  EEEEEEELL-----------------lllllll


No 4: Query=mol1A Sbjct=1q7fB Z-score=20.1

back to top
DSSP  ----------------------------------llLEEEEELLLLLEEEEEELLlLEEE
Query ----------------------------------spQHLLVGGSGWNKIAIINKDtKEIV   26
ident                                         |       | |  |      
Sbjct ksqikrqrmiyhckfgefgvmegqftepsgvavnaqNDIIVADTNNHRIQIFDKE-GRFK   59
DSSP  lllllleeeleeeeelllllllllllleeeeeelllLLEEEEEHHHLEEEEELLL-LLEE


DSSP  EEEELLLL-----LLLLEEEEL-LLLLEEEELL---LEEEEELLL-LLEEEEEELLllLE
Query WEYPLEKG-----WECNSVAAT-KAGEILFSYS---KGAKXITRD-GRELWNIAAPagCE   76
ident                 | ||     | |                         |      
Sbjct FQFGECGKrdsqlLYPNRVAVVrNSGDIIVTERsptHQIQIYNQYgQFVRKFGATI-lQH  118
DSSP  EEELLLLLlllllLLEEEEEEElLLLEEEEEELhhhLEEEEELLLlLEEEEELLLL-lLL


DSSP  EEEEEELLLLLEEEEEELLlEEEEEELLLLLEEEEEEELLLlllhhHLLLLLEELLLLLE
Query XQTARILPDGNALVAWCGHpSTILEVNXKGEVLSKTEFETGierphAQFRQINKNKKGNY  136
ident          |   |  |            | || |                   | |   
Sbjct PRGVTVDNKGRIIVVECKV-MRVIIFDQNGNVLHKFGCSKH----lEFPNGVVVNDKQEI  173
DSSP  EEEEEELLLLLEEEEELLL-LEEEEELLLLLEEEEEELLLL----lLLEEEEEELLLLEE


DSSP  EEEELLLLEEEEELLLLLEEEEEEL---LLLLLEEEELLLLLEEEELLL-lLEEEEELLl
Query LVPLFATSEVREIAPNGQLLNSVKL---SGTPFSSAFLDNGDCLVACGD-aHCFVQLNLe  192
ident          |      || |           |       ||  | |              
Sbjct FISDNRAHCVKVFNYEGQYLRQIGGegiTNYPIGVGINSNGEILIADNHnnFNLTIFTQ-  232
DSSP  EEEELLLLEEEEEELLLLEEEEELLlllLLLEEEEEELLLLLEEEEELLllLEEEEELL-


DSSP  LLLEEEEEEHHhlllLLLLEEEEEEELLLLLEEEEEELlllllhhhlllLLEEEELLLLl
Query SNRIVRRVNANdiegVQLFFVAQLFPLQNGGLYICNWQghdreagkgkhPQLVEIDSEGk  252
ident                |             |                     |        
Sbjct DGQLISALESK----VKHAQCFDVALMDDGSVVLASKD-----------YRLYIYRYVQ-  276
DSSP  LLLEEEEEEEL----LLLLLEEEEEELLLLEEEEEELL-----------LEEEEEELLL-


DSSP  eeeeelllllllllleeeeell
Query vvwqlndkvkfgxisticpire  274
ident                       
Sbjct ----------------lapvgm  282
DSSP  ----------------llllll


No 5: Query=mol1A Sbjct=2ismB Z-score=19.7

back to top
DSSP  --------------------lLLEEEEELLlLLEEEEEEllLLEEEEEEELLLLL----L
Query --------------------sPQHLLVGGSgWNKIAIINkdTKEIVWEYPLEKGW----E   36
ident                          |        |               |         
Sbjct glrveevvgglevpwalaflpDGGMLIAER-PGRIRLFR--EGRLSTYAELSVYHrgesG   57
DSSP  llleeeeellllleeeeeellLLLEEEEEL-LLEEEEEE--LLEEEEEEELLLLLllllL


DSSP  LLEEEELLLL----LEEEELL-------LEEEEELLL----LLEEEEEE-LLLL----LE
Query CNSVAATKAG----EILFSYS-------KGAKXITRD----GRELWNIA-APAG----CE   76
ident     |                                              ||       
Sbjct LLGLALHPRFpqepYVYAYRTvaegglrNQVVRLRHLgergVLDRVVLDgIPARphglHS  117
DSSP  EEEEEELLLLllllLEEEEEEellllleEEEEEEEELllleEEEEEEEEeELLLllllLL


DSSP  EEEEEELLLLLEEEEEEL------------lLEEEEEELLLLLEE-------------EE
Query XQTARILPDGNALVAWCG------------hPSTILEVNXKGEVL-------------SK  111
ident        |||   |                    ||     ||                 
Sbjct GGRIAFGPDGMLYVTTGEvyerelaqdlaslGGKILRLTPEGEPApgnpflgrrgarpEV  177
DSSP  LLLEEELLLLLEEEELLLlllhhhhhlllllLLEEEEELLLLLLLlllllllllllllLE


DSSP  EEELLllllhhHLLLLLEELL-LLLEEEEELL--------LLEEEEELLLLL--------
Query TEFETgierphAQFRQINKNK-KGNYLVPLFA--------TSEVREIAPNGQ--------  154
ident                        |                  ||  | | |         
Sbjct YSLGH------RNPQGLAWHPkTGELFSSEHGpsgeqgygHDEVNLIVPGGNygwprvvg  231
DSSP  EEELL------LLLLLLEELLlLLLEEEEELLllllllllLEEEEEELLLLLllllllll


DSSP  -------EEEEEEL--LLLLLEEEELLlLLEEEELLLLLEEEEELLL------LLLEEEE
Query -------LLNSVKL--SGTPFSSAFLDnGDCLVACGDAHCFVQLNLE------SNRIVRR  199
ident                    |   ||   ||  ||         | ||          |  
Sbjct rgndpryRDPLYFWpqGFPPGNLAFFR-GDLYVAGLRGQALLRLVLEgergrwRVLRVET  290
DSSP  lllllllLLLLEEEllLLLEEEEEEEL-LEEEEEELLLLEEEEEEEEeelleeEEEEEEE


DSSP  EEHhhllllLLLEEEEEEELLLLLEEEEEELL--LLLLHhhLLLLLEEEELlllleeeee
Query VNAndiegvQLFFVAQLFPLQNGGLYICNWQG--HDREAgkGKHPQLVEIDsegkvvwql  257
ident                       | ||                                  
Sbjct ALS------GFGRLREVQVGPDGALYVTTSNRdgRGQVR--PGDDRVLRLL---------  333
DSSP  EEE------LLLLEEEEEELLLLLEEEEELLLllLLLLL--LLLLLEEEEL---------


DSSP  lllllllllleeeeell
Query ndkvkfgxisticpire  274
ident                  
Sbjct -----------------  333
DSSP  -----------------


No 6: Query=mol1A Sbjct=1l0qA Z-score=19.3

back to top
DSSP  lLLEEEEELLLLLEEEEEELLLLEEEEEEELLllLLLLEEEELLLL-LEEEELL--LEEE
Query sPQHLLVGGSGWNKIAIINKDTKEIVWEYPLEkgWECNSVAATKAG-EILFSYS--KGAK   57
ident          |    |  |           |               |              
Sbjct -STFAYIANSESDNISVIDVTSNKVTATIPVG--SNPXGAVISPDGtKVYVANAhsNDVS   57
DSSP  -LEEEEEEELLLLEEEEEELLLLEEEEEEELL--LLEEEEEELLLLlEEEEEEHhhLEEE


DSSP  EELL-LLLEEEEEELlllLEEEEEEELLLL-LEEEEEELlLEEEEEELL-LLLEEEEEEE
Query XITR-DGRELWNIAApagCEXQTARILPDG-NALVAWCGhPSTILEVNX-KGEVLSKTEF  114
ident  |            |      |     |||    |      ||          |      
Sbjct IIDTaTNNVIATVPA--gSSPQGVAVSPDGkQVYVTNXA-SSTLSVIDTtSNTVAGTVKT  114
DSSP  EEELlLLEEEEEEEL--lLLEEEEEELLLLlEEEEEELL-LLEEEEEELlLLEEEEEEEL


DSSP  llllllhhHLLLLLEELLL-LLEEEEELLLLEEEEELL-LLLEEEEEELLLLLLEEEELL
Query etgierphAQFRQINKNKK-GNYLVPLFATSEVREIAP-NGQLLNSVKLSGTPFSSAFLD  172
ident                         |       |  |        | |     |   |   
Sbjct -------gKSPLGLALSPDgKKLYVTNNGDKTVSVINTvTKAVINTVSVGRSPKGIAVTP  167
DSSP  -------lLLEEEEEELLLlLEEEEEELLLLEEEEEELlLLEEEEEEELLLLEEEEEELL


DSSP  L-LLEEEELLLLLEEEEELLLLLLEEEEEEHhhlllllLLEEEEEEELLL-LLEEEEEel
Query N-GDCLVACGDAHCFVQLNLESNRIVRRVNAndiegvqLFFVAQLFPLQN-GGLYICNwq  230
ident       ||  |           |     |                         |  |  
Sbjct DgTKVYVANFDSXSISVIDTVTNSVIDTVKV-------EAAPSGIAVNPEgTKAYVTN--  218
DSSP  LlLEEEEEELLLLEEEEEELLLLEEEEEEEL-------LLEEEEEEELLLlLEEEEEE--


DSSP  llLLLH---------------hhLLLLleeeellllleEEEE------------------
Query ghDREA---------------gkGKHPqlveidsegkvVWQL------------------  257
ident   |                       |                                 
Sbjct -vDKYFntvsxidtgtnkitariPVGPdpagiavtpdgKKVYvalsfxntvsvidtatnt  277
DSSP  -eLLLLleeeeeelllleeeeeeELLLleeeeeellllLEEEeeelllleeeeeelllle


DSSP  -lLLLLLL-LLLEE--EEELL---------------------------------------
Query -nDKVKFG-XISTI--CPIRE---------------------------------------  274
ident        |                                                    
Sbjct itATXAVGkNPYASgqFIGSIpvqpvypsadfksnitsgyiflsepvqftdlskdatewk  337
DSSP  eeEEEELLlLEELLllLEEELlllllllllleeellllleeelllleeeeelllllleee


DSSP  ------------------------------------------------------
Query ------------------------------------------------------  274
ident                                                       
Sbjct wdfgdgssskkqnpthtysetgiytvrltvsnsngtdsqistvnvvlkgsptps  391
DSSP  eellllleellllleellllleeeeeeeeeeelleeeeeeeeeeeellllllll


No 7: Query=mol1A Sbjct=3hrpA Z-score=19.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct atydpnqpvtvesfxpvegklrekvivkgsnfgtdkskvkvyfvdeaaerlstvigidnn   60
DSSP  llllllllleeeeeelleelllleeeeeeelllllhhheeeeeelllleeeeeeeeeell


DSSP  --------------llleeeeellllleeeeeelLLLEEEEEE----ELLL---------
Query --------------spqhllvggsgwnkiaiinkDTKEIVWEY----PLEK---------   33
ident                                                             
Sbjct tlyclaprqlpggnrikvivdgkevttdgtfkyeQAQNVSTISgsasKDGNddgdlasak  120
DSSP  eeeeelllllleeeeeeeeelleeeelllleeelLLEEEEEEEelllLLLLlllllllll


DSSP  lLLLLEEEELLLLLEEEELL--LEEEEELL-LLLEEEEEELllllEEEEEEELLLL-LEE
Query gWECNSVAATKAGEILFSYS--KGAKXITR-DGRELWNIAApagcEXQTARILPDG-NAL   89
ident        ||      |           |   |                      |     
Sbjct fKYXWGIAAVGNNTVLAYQRddPRVRLISVdDNKVTTVHPG---fKGGKPAVTKDKqRVY  177
DSSP  lLLEEEEEELLLLEEEEEELllLEEEEEELlLLEEEEEEEL---lLLLLLEELLLLlEEE


DSSP  EEEELLLEEEEEELL--LLLEEEEEEELLLLLlhhHLLLLLEELLL-LLEEEEELlLLEE
Query VAWCGHPSTILEVNX--KGEVLSKTEFETGIErphAQFRQINKNKK-GNYLVPLFaTSEV  146
ident         |                                                   
Sbjct SIGWEGTHTVYVYXKasGWAPTRIGQLGSTFS---GKIGAVALDETeEWLYFVDS-NKNF  233
DSSP  EELLLLLLEEEEEEHhhLLLEEEEEELLLLLL---LLLLLLEELLLlLEEEEELL-LLEE


DSSP  EEELL-LLLEEEEEEL-------lllLLEEEEL-LLLLEEEELLLLLEEEEELLlLLLEE
Query REIAP-NGQLLNSVKL-------sgtPFSSAFL-DNGDCLVACGDAHCFVQLNLeSNRIV  197
ident                |                                            
Sbjct GRFNVkTQEVTLIKQLelsgslgtnpGPYLIYYfVDSNFYXSDQNLSSVYKITP-DGECE  292
DSSP  EEEELlLLLEEEEEELllllllllllLLEEEEElLLLEEEEEELLLLEEEEELL-LLLEE


DSSP  EEEEH---------hHLLLlLLLEEEEEEELLLLLEEEEEELLllllhhhllLLLEEEEL
Query RRVNA---------nDIEGvQLFFVAQLFPLQNGGLYICNWQGhdreagkgkHPQLVEID  248
ident                  |               |  ||                 |   |
Sbjct WFCGSatqktvqdglREEA-LFAQPNGXTVDEDGNFYIVDGFK---------GYCLRKLD  342
DSSP  EEEELlllllllleeHHHL-LLLLEEEEEELLLLLEEEEELLL---------LLEEEEEE


DSSP  L-LLLEEEEEL---LLLL---------LLLLLEEEEELL-------------------
Query S-EGKVVWQLN---DKVK---------FGXISTICPIRE-------------------  274
ident    | |                     |     ||   |                   
Sbjct IlDGYVSTVAGqvdVASQidgtpleatFNYPYDICYDGEggywiaeawgkairkyave  400
DSSP  LlLLEEEEEEElllLLLLlllllllllLLLEEEEEELLLleeeeeelllleeeeeeel


No 8: Query=mol1A Sbjct=2ghsA Z-score=19.1

back to top
DSSP  --------------------------lLLEEEEELLLLLEEEEEELLLLEEeEEEELLll
Query --------------------------sPQHLLVGGSGWNKIAIINKDTKEIvWEYPLEkg   34
ident                                                         |   
Sbjct atvfpfagrvldetpxllgegptfdpaSGTAWWFNILERELHELHLASGRK-TVHALP--   57
DSSP  leeelllleeeelllllleeeeeeellLLEEEEEEHHHLEEEEEELLLLEE-EEEELL--


DSSP  LLLLEEEELLLLLEEEELLLEEEEELL-LLLEE-EEEEL--LLLLEEEEEEELLLLLEEE
Query WECNSVAATKAGEILFSYSKGAKXITR-DGREL-WNIAA--PAGCEXQTARILPDGNALV   90
ident       |       |     |        |             |      |  | |    
Sbjct FXGSALAKISDSKQLIASDDGLFLRDTaTGVLTlHAELEsdLPGNRSNDGRXHPSGALWI  117
DSSP  LLEEEEEEEELLEEEEEELLEEEEEELlLLLEEeEELLLllLLLEEEEEEEELLLLLEEE


DSSP  EEEL-----LLEEEEEELlLLLEeEEEEELLllllhhHLLLLLEELL-LLLEEEEELLLL
Query AWCG-----HPSTILEVNxKGEVlSKTEFETgierphAQFRQINKNK-KGNYLVPLFATS  144
ident    |         |  |  || |  |                |                 
Sbjct GTXGrkaetGAGSIYHVA-KGKV-TKLFADI------SIPNSICFSPdGTTGYFVDTKVN  169
DSSP  EEEElllllLLEEEEEEE-LLEE-EEEEEEE------LLEEEEEELLlLLEEEEEELLLL


DSSP  EEEEEL-------LLLLEEEEEEL---LLLLLEEEELLLLLEEEELLLLLEEEEELLlLL
Query EVREIA-------PNGQLLNSVKL---SGTPFSSAFLDNGDCLVACGDAHCFVQLNLeSN  194
ident              | |            |    |     |    |               
Sbjct RLXRVPldartglPTGKAEVFIDStgiKGGXDGSVCDAEGHIWNARWGEGAVDRYDT-DG  228
DSSP  EEEEEElllllllLLLLLEEEEELlllLLEEEEEEELLLLLEEEEEELLLEEEEELL-LL


DSSP  LEEEEEEHhhllllLLLEEEEEEEL--LLLLEEEEEELLLLL--LHHHLLL-LLEEEELL
Query RIVRRVNAndiegvQLFFVAQLFPL--QNGGLYICNWQGHDR--EAGKGKH-PQLVEIDS  249
ident     |                          |       |                |   
Sbjct NHIARYEV------PGKQTTCPAFIgpDASRLLVTSAREHLDddAITANPQhGLTFELGI  282
DSSP  LEEEEEEL------LLLLEEEEEEEllLLLEEEEEELLLLLLhhHHHHLLLlLLEEELLL


DSSP  Llleeeeelllllllllleeeeell
Query Egkvvwqlndkvkfgxisticpire  274
ident |                        
Sbjct E-------------vkgrfeplyrl  294
DSSP  L-------------lllllllllll


No 9: Query=mol1A Sbjct=3e5zA Z-score=19.0

back to top
DSSP  llleeeeellllleeeeeelLLLEEeEEEELLllLLLLEEEELLL-LLEEEELL--LEEE
Query spqhllvggsgwnkiaiinkDTKEIvWEYPLEkgWECNSVAATKA-GEILFSYS--KGAK   57
ident                                             |     ||        
Sbjct -----tlraarpefldlfpaGAEAR-RLADGF--TWTEGPVYVPArSAVIFSDVrqNRTW   52
DSSP  -----leeellhhhhhhlllLLLLE-EEELLL--LLEEEEEEEHHhLEEEEEEHhhLEEE


DSSP  EELLLLLEEEEEELlllLEEEEEEELLLLLEEEEEELLlEEEEEELLLLLEEEEEEELLL
Query XITRDGRELWNIAApagCEXQTARILPDGNALVAWCGHpSTILEVNXKGEVLSKTEFETG  117
ident     ||                      |       |           |           
Sbjct AWSDDGQLSPEXHP--sHHQNGHCLNKQGHLIACSHGL-RRLERQREPGGEWESIADSFE  109
DSSP  EEELLLLEEEEELL--lLLEEEEEELLLLLEEEEELLL-LEEEEELLLLLLEEEEELEEL


DSSP  lllhhHLLLLLEELLLLLEEEEELL-----------------LLEEEEELLLLLEEEEEE
Query ierphAQFRQINKNKKGNYLVPLFA-----------------TSEVREIAPNGQLLNSVK  160
ident                 |                            |   || | |     
Sbjct -gkklNSPNDVCLAPDGSLWFSDPTygidkpeegyggexelpGRWVFRLAPDGTLSAPIR  168
DSSP  -leelLLLLLEEELLLLLEEEEELLhhhhlhhhlllllllllLLEEEEELLLLLEEEEEL


DSSP  LLLLLLEEEELLLLLEEEELLLLLEEEEELLL---LLLEEEEEEHhhlllLLLLEEEEEE
Query LSGTPFSSAFLDNGDCLVACGDAHCFVQLNLE---SNRIVRRVNAndiegVQLFFVAQLF  217
ident     |   |||  |  ||            |                   |       | 
Sbjct DRVKPNGLAFLPSGNLLVSDTGDNATHRYCLNargETEYQGVHFT-----VEPGKTDGLR  223
DSSP  LLLLEEEEEELLLLLEEEEELLLLEEEEEEELlllLEEEEEEEEL-----LLLLLLLLEE


DSSP  ELLLLLEEEEEEllllllhhhlllLLEEEELLLLLEEEEELllllLLLLLEEEEELL---
Query PLQNGGLYICNWqghdreagkgkhPQLVEIDSEGKVVWQLNdkvkFGXISTICPIRE---  274
ident     |                            |               |  |       
Sbjct VDAGGLIWASAG------------DGVHVLTPDGDELGRVL---tPQTTSNLCFGGPegr  268
DSSP  ELLLLLEEEEEL------------LEEEEELLLLLEEEEEE---lLLLLLEEEEELLlll


DSSP  ----------------------
Query ----------------------  274
ident                       
Sbjct tlyxtvstefwsietnvrgleh  290
DSSP  eeeeeelleeeeeellllllll


No 10: Query=mol1A Sbjct=1rwiA Z-score=18.9

back to top
DSSP  ----------------------llLEEEEELLL-LLEEEEEEllllEEEEEEELLllLLL
Query ----------------------spQHLLVGGSG-WNKIAIINkdtkEIVWEYPLEkgWEC   37
ident                             |   |                           
Sbjct gqtvlpftgidfrlspsgvavdsaGNVYVTSEGmYGRVVKLA----GTTVLPFNG-lYQP   55
DSSP  leeellllllllllleeeeeelllLLEEEEELLlLLEEEEEL----LEEELLLLL-lLLL


DSSP  LEEEELLLLLEEEELL-LEEEEELLLL-LEEEE-EELLllLEEEEEEELLLLLEEEEEEL
Query NSVAATKAGEILFSYS-KGAKXITRDG-RELWN-IAAPagCEXQTARILPDGNALVAWCG   94
ident    |   ||                                          |   ||  |
Sbjct QGLAVDGAGTVYVTDFnNRVVTLAAGSnNQTVLpFDGL--NYPEGLAVDTQGAVYVADRG  113
DSSP  LLEEELLLLLEEEEELlLEEEEELLLLlLLEELlLLLL--LLEEEEEELLLLLEEEEEHH


DSSP  LlEEEEEELLLLLEEEEEEELLllllhhHLLLLLEELLLLLEEEEELLLLEEEEELL-LL
Query HpSTILEVNXKGEVLSKTEFETgierphAQFRQINKNKKGNYLVPLFATSEVREIAP-NG  153
ident                    |                   ||  |       |        
Sbjct N-NRVVKLAAGSKTQTVLPFTG-----lNDPDGVAVDNSGNVYVTDTDNNRVVKLEAeSN  167
DSSP  H-LEEEEELLLLLLLEELLLLL-----lLLLLEEEELLLLLEEEEEHHHLEEEEELLlLL


DSSP  LEEEE--EELLlLLLEEEELLLLLEEEELLLLLEEEEELLLLLLEeEEEEHhhlllLLLL
Query QLLNS--VKLSgTPFSSAFLDNGDCLVACGDAHCFVQLNLESNRIvRRVNAndiegVQLF  211
ident              |   |    |   |        | |   |                | 
Sbjct NQVVLpfTDIT-APWGIAVDEAGTVYVTEHNTNQVVKLLAGSTTS-TVLPF-----TGLN  220
DSSP  LEEELllLLLL-LEEEEEELLLLLEEEEELLLLEEEEELLLLLLL-EELLL-----LLLL


DSSP  EEEEEEELLLLLEEEEEELlllllhhhllLLLEEEELLLlleeeeelllllllllleeee
Query FVAQLFPLQNGGLYICNWQghdreagkgkHPQLVEIDSEgkvvwqlndkvkfgxisticp  271
ident              |                   |   |                      
Sbjct TPLAVAVDSDRTVYVADRG----------NDRVVKLTSL-----------------ehhh  253
DSSP  LEEEEEELLLLLEEEEEHH----------HLEEEEELLL-----------------hhhh


DSSP  ell
Query ire  274
ident    
Sbjct hhh  256
DSSP  lll


No 11: Query=mol1A Sbjct=3dr2A Z-score=18.8

back to top
DSSP  ---------llleeeeellllleeeeeeLLLLEEEEEEELLllLLLLEEEELL-LLLEEE
Query ---------spqhllvggsgwnkiaiinKDTKEIVWEYPLEkgWECNSVAATK-AGEILF   50
ident                                      |           |          
Sbjct hcrvrpagpavpadcdpprithaalaarLGDARLLTLYDQA--TWSEGPAWWEaQRTLVW   58
DSSP  lleeellllleelllllleellhhhhhhHLLLLLEEEELLL--LLEEEEEEEHhHLEEEE


DSSP  ELL--LEEEEELLLLLEE-EEEELlllLEEEEEEELLLLLEEEEEELLlEEEEEELLLLL
Query SYS--KGAKXITRDGREL-WNIAApagCEXQTARILPDGNALVAWCGHpSTILEVNXKGE  107
ident |            ||       |                       |    |      | 
Sbjct SDLvgRRVLGWREDGTVDvLLDAT---AFTNGNAVDAQQRLVHCEHGR-RAITRSDADGQ  114
DSSP  EELllLEEEEEELLLLEEeEEELL---LLEEEEEELLLLLEEEEELLL-LEEEEELLLLL


DSSP  EeEEEEELLLlllhhHLLLLLEELLLLLEEEEELL-----------------LLEEEEEL
Query VlSKTEFETGierphAQFRQINKNKKGNYLVPLFA-----------------TSEVREIA  150
ident                           |                            |    
Sbjct A-HLLVGRYA-gkrlNSPNDLIVARDGAIWFTDPPfglrkpsqgcpadpelaHHSVYRLP  172
DSSP  E-EEEELEEL-leelLLLLLEEELLLLLEEEELLLhhhllhhhlllllllllLEEEEEEL


DSSP  L-LLLEEEEEELLlLLLEEEELLLL-LEEEELLL--LLEEEEELLL--LLLEEEEEEHhh
Query P-NGQLLNSVKLSgTPFSSAFLDNG-DCLVACGD--AHCFVQLNLE--SNRIVRRVNAnd  204
ident |    |     |   |   ||        |                       |      
Sbjct PdGSPLQRMADLD-HPNGLAFSPDEqTLYVSQTPegSVEITAFAWRdgALHDRRHFAS--  229
DSSP  LlLLLLEEEEEEL-LEEEEEELLLLlEEEEEELLllLLEEEEEEEEllEEEEEEEEEL--


DSSP  lllLLLLEEEEEEELLLLLEEEEEEllllllhhhlllLLEEEELLLLLEEEEELllllLL
Query iegVQLFFVAQLFPLQNGGLYICNWqghdreagkgkhPQLVEIDSEGKVVWQLNdkvkFG  264
ident    |             | |                       || |            |
Sbjct ---VPDGLPDGFCVDRGGWLWSSSG------------TGVCVFDSDGQLLGHIP---tPG  271
DSSP  ---LLLLLLLLEEELLLLLEEELLL------------LEEEEELLLLLEEEEEE---lLL


DSSP  LLLEEEEELL------------------
Query XISTICPIRE------------------  274
ident   |                         
Sbjct TASNCTFDQAqqrlfitggpclwmlplp  299
DSSP  LLLEEEELLLlleeeeeelleeeeeell


No 12: Query=mol1A Sbjct=3kyaA Z-score=18.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vetgafdpskpvaisdftpkeggayqklliygenfgtdvskvkvkiggkdaivinvksty   60
DSSP  lllllllllllleeeeeelleelllleeeeeeelllllhhheeeeelleeeleeeellle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vycfvpsgafsgeieitvgegenavtttasttfsyekkxvvgtlcgyrnnrddqgwrdgp  120
DSSP  eeeellllllllleeeeellhhhleeeellllleellleeeeeeeellllllllllllee


DSSP  -----------------------llLEEEEELLLLLEEEEEELLLLEEEEEEEL--LLLL
Query -----------------------spQHLLVGGSGWNKIAIINKDTKEIVWEYPL--EKGW   35
ident                           ||     |   |  |                   
Sbjct fdgpegvkccgfsdngrlafdplnkDHLYICYDGHKAIQLIDLKNRXLSSPLNIntIPTN  180
DSSP  lllllllllllllleeeeeeelleeEEEEEEEELEEEEEEEELLLLEEEEEELLllLLLL


DSSP  LLLEEEEL--------LLLLEEEELLL--------EEEEELLL--------LLEEEEEEL
Query ECNSVAAT--------KAGEILFSYSK--------GAKXITRD--------GRELWNIAA   71
ident    | |           |                     | |                | 
Sbjct RIRSIAFNkkiegyadEAEYXIVAIDYdgkgdespSVYIIKRNadgtfddrSDIQLIAAY  240
DSSP  LEEEEEELllllllllLLLEEEEEELLlllhhheeEEEEEELLllllllllLLEEEEEEE


DSSP  lllLEEEEEEELL-LLLEEEEEELLlEEEEEELLLLL-------------------EEEE
Query pagCEXQTARILP-DGNALVAWCGHpSTILEVNXKGE-------------------VLSK  111
ident         | | |  |                                            
Sbjct ---KQCNGATIHPiNGELYFNSYEK-GQVFRLDLVDYfktiknggswdpivknnpnTFKQ  296
DSSP  ---LLLLLEEELLlLLLEEEEELLL-LEEEEELHHHHhhhhhllllllllhhhlllLEEE


DSSP  EEELLLLllhHHLLlLLEEL-LLLLEEEEELLLLEEEEEL-------LLLLEeEEEE---
Query TEFETGIerpHAQFrQINKN-KKGNYLVPLFATSEVREIA-------PNGQLlNSVK---  160
ident              | ||                                    | |    
Sbjct LFTIADP---SWEF-QIFIHpTGKYAYFGVINNHYFXRSDydeikkeFITPY-NFVGgyk  351
DSSP  EEELLLL---LLLE-EEEELlLLLEEEEEELLLLEEEEEEeelllleELLLE-EEEElll


DSSP  ------------LLLLLLEEEELLL--------LLEEEELLLLLEEEEELLlLLLEEEEE
Query ------------LSGTPFSSAFLDN--------GDCLVACGDAHCFVQLNLeSNRIVRRV  200
ident                 |    |  |         |         |               
Sbjct qsgyrddvgteaRXNNPCQGVFVKNpdytgeeeYDFYFVDRLNFCVRKVTP-EGIVSTYA  410
DSSP  llllllllhhhlLLLLEEEEEEEELllllllllEEEEEEEHHHLEEEEELL-LLLEEEEE


DSSP  EHH-----------------HLLLLLLLEEEEEEELL-LLLEEEEEELlllllhhhllLL
Query NAN-----------------DIEGVQLFFVAQLFPLQ-NGGLYICNWQghdreagkgkHP  242
ident                       |      |  |         |                 
Sbjct GRGastsladgnqwgtddgdLREVARFRDVSGLVYDDvKEXFYVHDQV----------GH  460
DSSP  ELLllhhhhhlllllllleeLLLLLLLLLEEEEEEELlLLEEEEEELL----------LL


DSSP  LEEEELLLlleeeeelllllllllleeeeell
Query QLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident     |  |                        
Sbjct TIRTISXE---------------------qee  471
DSSP  EEEEEEEL---------------------lll


No 13: Query=mol1A Sbjct=1v04A Z-score=18.7

back to top
DSSP  -llleeeeellllleeeeeelLLLE-EEEEEELLllLLLLEEEELLLLLEEEELL-----
Query -spqhllvggsgwnkiaiinkDTKE-IVWEYPLEkgWECNSVAATKAGEILFSYS-----   53
ident                                                |    |       
Sbjct lfdrqkssfqtrfnvhrevtpVELPnCNLVKGID--NGSEDLEILPNGLAFISSGlkydk   58
DSSP  lllhhhhhhhhhlllllllllLLLLlLEELLLLL--LLLLEEEELLLLEEEEEELlllll


DSSP  -LEEEEELL---LLLEEEEE-----elLLLLEEEEEEELLL----LLEEEEEELL-LEEE
Query -KGAKXITR---DGRELWNI-----aaPAGCEXQTARILPD----GNALVAWCGH-PSTI   99
ident                                         |       ||       || 
Sbjct sGKILLMDLnekEPAVSELEiigntldISSFNPHGISTFIDddntVYLLVVNHPGsSSTV  118
DSSP  lLEEEEEELlllLLLEEELEeelllllHHHLLEEEEEEEELllllEEEEEEELLLlLLEE


DSSP  EEELLL-----LLEEEEEEELLllllhhhLLLLLEELLlLLEEEEELLL-----------
Query LEVNXK-----GEVLSKTEFETgierphaQFRQINKNKkGNYLVPLFAT-----------  143
ident               |                  |                          
Sbjct EVFKFQeeeksLLHLKTIRHKL-----lpSVNDIVAVGpEHFYATNDHYfidpylkswem  173
DSSP  EEEEEElllleEEEEEEELLLL-----llLEEEEEEEElLEEEEEELLLlllhhhhhhhh


DSSP  ------LEEEEELLLlLEEEEEELLLLLLEEEEL-LLLLEEEELLLLLEEEEELLL---L
Query ------SEVREIAPNgQLLNSVKLSGTPFSSAFL-DNGDCLVACGDAHCFVQLNLE---S  193
ident       | |    ||                    |      |   ||            
Sbjct hlglawSFVTYYSPN-DVRVVAEGFDFANGINISpDGKYVYIAELLAHKIHVYEKHanwT  232
DSSP  hlllllEEEEEELLL-LEEEEEEEELLEEEEEELlLLLEEEEEEHHHLEEEEEEELlllL


DSSP  LLEEEEEEHhhlllllLLEEEEEEEL-LLLLEEEEEELLLLL----lhhhllllLEEEEL
Query NRIVRRVNAndiegvqLFFVAQLFPL-QNGGLYICNWQGHDR----eagkgkhpQLVEID  248
ident     |              |         | |         |                | 
Sbjct LTPLRVLSF-------DTLVDNISVDpVTGDLWVGCHPNGMRiffydaenppgsEVLRIQ  285
DSSP  EEEEEEEEL-------LLEEEEEEELlLLLLEEEEEELLHHHhhllllllllleEEEEEE


DSSP  L----LLLEEEEELLL-LLLLLLLEEEEELL----------------
Query S----EGKVVWQLNDK-VKFGXISTICPIRE----------------  274
ident      | ||                                      
Sbjct DilseEPKVTVVYAENgTVLQGSTVAAVYKGklligtvfhkalycdl  332
DSSP  LllllLLEEEEEEEELlLLLLLEEEEEEELLeeeeeelllleeeeel


No 14: Query=mol1A Sbjct=3bwsA Z-score=18.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gteivkfsihpykgtvirlgeeilpfkvlemdknialvexaipvykdekeielklsspgf   60
DSSP  leeeeeeeeellllleeeelleelleeeeeeelleeeeeeeeellllllleeeeeellll


DSSP  ---------------------------------------------lLLEEEEELLLLLEE
Query ---------------------------------------------sPQHLLVGGSGWNKI   15
ident                                                  |          
Sbjct qnssyrirkpeelneklialdkegithrfisrfktgfqpksvrfidNTRLAIPLLEDEGX  120
DSSP  lleeeeellhhhhllleeellllllleeeeeeeelllllllleellLLEEEEELLLLLLE


DSSP  EEEELLLLEeEEEEE----lLLLLLLLEEEELL-LLLEEEELL--LEEEEELL-LLLEEE
Query AIINKDTKEiVWEYP----lEKGWECNSVAATK-AGEILFSYS--KGAKXITR-DGRELW   67
ident                      |              |   |                   
Sbjct DVLDINSGQ-TVRLSppekyKKKLGFVETISIPeHNELWVSQXqaNAVHVFDLkTLAYKA  179
DSSP  EEEELLLLL-EEEELllhhhHLLLLEEEEEEEHhHLEEEEEEHhhLEEEEEELlLLLEEE


DSSP  EEELLllLEEEEEEELLL-LLEEEEEELLlEEEEEELL-LLLEEEEeEELLllllhhhLL
Query NIAAPagCEXQTARILPD-GNALVAWCGHpSTILEVNX-KGEVLSKtEFETgierphaQF  125
ident                 |               |            |              
Sbjct TVDLT-gKWSKILLYDPIrDLVYCSNWIS-EDISVIDRkTKLEIRK-TDKI------gLP  230
DSSP  EEELL-lLLEEEEEEELLlLEEEEEELLL-LEEEEEELlLLEEEEE-LLLL------lEE


DSSP  LLLEELLLL-LEEEEELL-------LLEEEEELL-LLLEEEEEELLLLLLEEEELLLL-L
Query RQINKNKKG-NYLVPLFA-------TSEVREIAP-NGQLLNSVKLSGTPFSSAFLDNG-D  175
ident |     | |       |                     |       |             
Sbjct RGLLLSKDGkELYIAQFSasnqesgGGRLGIYSXdKEKLIDTIGPPGNKRHIVSGNTEnK  290
DSSP  EEEEELLLLlEEEEEEEElllllllLEEEEEEELlLLEEEEEEEEEELEEEEEELLLLlE


DSSP  EEEELLLLLEEEEELLLLLLEEEEEEHhhlllllLLEEEEEEELLL-LLEEEEEELlLLL
Query CLVACGDAHCFVQLNLESNRIVRRVNAndiegvqLFFVAQLFPLQN-GGLYICNWQgHDR  234
ident   |            |                                 ||         
Sbjct IYVSDXCCSKIEVYDLKEKKVQKSIPV-------FDKPNTIALSPDgKYLYVSCRG-PNH  342
DSSP  EEEEELLLLEEEEEELLLLEEEEEEEL-------LLLEEEEEELLLlLEEEEEELL-LLL


DSSP  L------HHHLLLLlEEEELLL---LLEEeEELL--------------------LLLLLl
Query E------AGKGKHPqLVEIDSE---GKVVwQLND--------------------KVKFGx  265
ident         |         ||      |                                 
Sbjct PtegylkKGLVLGK-VYVIDTTtdtVKEF-WEAGnqptgldvspdnrylvisdfLDHQI-  399
DSSP  LllllllLLLLLLE-EEEEELLlleEEEE-EELLlleeeeeellllleeeeeelLLLEE-


DSSP  lleeeeell
Query isticpire  274
ident          
Sbjct -rvyrrdgf  407
DSSP  -eeeeelll


No 15: Query=mol1A Sbjct=2qe8A Z-score=18.5

back to top
DSSP  llleeeeellllleeeeeelllLEEEEEEELLlllLLLEEEELLLLLEEEELLL------
Query spqhllvggsgwnkiaiinkdtKEIVWEYPLEkgwECNSVAATKAGEILFSYSK------   54
ident                          |                |  |    |         
Sbjct ----------------------RLEVVAELSL---APGNITLTPDGRLFLSLHQfyqpex   35
DSSP  ----------------------LLEEEEEELL---LEEEEEELLLLLEEEEELHhhllll


DSSP  EEEEELLLLLEEEE-------EELLlllEEEEEEELLLLLEEEEEEL----LLEEEEEEL
Query GAKXITRDGRELWN-------IAAPagcEXQTARILPDGNALVAWCG----HPSTILEVN  103
ident      | ||            |                |       |             
Sbjct QVAELTQDGLIPFPpqsgnaiITFD---TVLGIKSDGNGIVWXLDNGnqskSVPKLVAWD   92
DSSP  LEEEEELLEEEELLlllllllLLLL---LEEEEEELLLLEEEEEELHhhhlLLLEEEEEE


DSSP  LL-LLEEEEEEEL--LLLLLhhHLLLLLEELL-LLLEEEEELL---LLEEEEELL-LLLE
Query XK-GEVLSKTEFE--TGIERphAQFRQINKNK-KGNYLVPLFA---TSEVREIAP-NGQL  155
ident                                           |              |  
Sbjct TLnNQLSRVIYLPppITLSN--SFVNDLAVDLiHNFVYISDPApddKAALIRVDLqTGLA  150
DSSP  LLlLEEEEEEELLllLLLLL--LLLLEEEEELlLLEEEEEELLlhhHLEEEEEELlLLLE


DSSP  EEEEE----LLLL--------------------------LLEEEELLL-LLEEEELLLLL
Query LNSVK----LSGT--------------------------PFSSAFLDN-GDCLVACGDAH  184
ident                                                             
Sbjct ARVLQgypgIAPEdidlvidgvpvqigqpdgtvirphlgVNGIVLDAEnEWLYLSPXHST  210
DSSP  EEELLllllLLLLlllleelleelleellllleelllllEEEEEELLLlLEEEEEELLLL


DSSP  EEEEELLLLL-----------LEEEEEEHhhlllllLLEEEEEEELLLLLEEEEEELlll
Query CFVQLNLESN-----------RIVRRVNAndiegvqLFFVAQLFPLQNGGLYICNWQghd  233
ident                          |                         |        
Sbjct SXYRIKSADLsnlqltdaelgSKIERYSE-------KPICDGISIDKDHNIYVGDLA---  260
DSSP  EEEEEEHHHHllllllhhhhhLLLEEEEE-------LLLLLLEEELLLLLEEEEEHH---


DSSP  llhhhllLLLEEEELLL-LLEEEEELLLlLLLLLLEEEEELL------------------
Query reagkgkHPQLVEIDSE-GKVVWQLNDKvKFGXISTICPIRE------------------  274
ident        |     | |          |  |                              
Sbjct -------HSAIGVITSAdRAYKLLVTDE-KLSWTDSFNFGSDgylyfdcnqlhhsaplna  312
DSSP  -------HLEEEEEELLlLEEEEEEELH-HHLLEEEEEELLLlleeeeellhhhlhhhll


DSSP  ------------------------
Query ------------------------  274
ident                         
Sbjct genisappyyifrlkplaagivgr  336
DSSP  lllllllleeeeeellllllllll


No 16: Query=mol1A Sbjct=2dsoC Z-score=18.5

back to top
DSSP  llleeeeellllleeeeeeLLLL----------------------EEEEEEELLLLLLLL
Query spqhllvggsgwnkiaiinKDTK----------------------EIVWEYPLEKGWECN   38
ident                      |                          |     ||    
Sbjct ---------------sqqdLPTLfysgksnsavpiiseselqtitAEPWLEISKKGLQLE   45
DSSP  ---------------llllLLLLlllhhhhlllllllhhhlleeeLEEEEEEELLLLLEE


DSSP  EEEELLLLLEEEELL--LEEEEELL-LLLEEEEEELLllLEEEEEEELLLLLEEEEEELL
Query SVAATKAGEILFSYS--KGAKXITR-DGRELWNIAAPagCEXQTARILPDGNALVAWCGH   95
ident        |              |                       |  ||   |   | 
Sbjct GLNFDRQGQLFLLDVfeGNIFKINPeTKEIKRPFVSH-kANPAAIKIHKDGRLFVCYLGD  104
DSSP  EEEELLLLLEEEEELllLEEEEELLlLLLEEEEEELL-lLLEEEEEELLLLLEEEEELLL


DSSP  ---LEEEEEELLLLLEEEEEEE-LLLLllhhhLLLLLEELLLLLEEEEELL------LLE
Query ---PSTILEVNXKGEVLSKTEF-ETGIerphaQFRQINKNKKGNYLVPLFA------TSE  145
ident       |      |  |                        ||      |          
Sbjct fksTGGIFAATENGDNLQDIIEdLSTA----yCINDMVFDSKGGFYFTDFRgystnpLGG  160
DSSP  lllLLEEEEELLLLLLLEEEELlLLLL----lLEEEEEELLLLLEEEEELLllllllLEE


DSSP  EEEELLLLLEEEE-EELLLLLLEEEELLLL-LEEEELLLLLEEEEELL----LLLL--EE
Query VREIAPNGQLLNS-VKLSGTPFSSAFLDNG-DCLVACGDAHCFVQLNL----ESNR--IV  197
ident |    |                  |         |    |       |            
Sbjct VYYVSPDFRTVTPiIQNISVANGIALSTDEkVLWVTETTANRLHRIALeddgVTIQpfGA  220
DSSP  EEEELLLLLLEEEeEEEELLEEEEEELLLLlEEEEEEHHHLEEEEEEEllllLLEEeeEE


DSSP  EEEEHhhlllLLLLEEEEEEELLLLLEEEEEELLllllhhhllllLEEEELLLLLEEEEE
Query RRVNAndiegVQLFFVAQLFPLQNGGLYICNWQGhdreagkgkhpQLVEIDSEGKVVWQL  257
ident                           ||                         |    | 
Sbjct TIPYY----fTGHEGPDSCCIDSDDNLYVAMYGQ----------gRVLVFNKRGYPIGQI  266
DSSP  EEEEE----lLLLLEEEEEEELLLLLEEEEEELL----------lEEEEELLLLLEEEEE


DSSP  LLLLL----LLLLLEEEEELL------------------------------------
Query NDKVK----FGXISTICPIRE------------------------------------  274
ident                   |                                      
Sbjct LIPGRdeghMLRSTHPQFIPGtnqliicsndiemgggsmlytvngfakghqsfqfql  323
DSSP  ELLLHhhllLLLLLEEEELLLlleeeeeeelhhhllleeeeeeellllllllhhhll


No 17: Query=mol1A Sbjct=1pjxA Z-score=18.5

back to top
DSSP  llleeeeellllleeeeeellLLEEEEEEELlllLLLLEEEELLLLLEEEELL-------
Query spqhllvggsgwnkiaiinkdTKEIVWEYPLekgWECNSVAATKAGEILFSYS-------   53
ident                                            | |              
Sbjct ---------------meipviEPLFTKVTED--iPGAEGPVFDKNGDFYIVAPevevngk   43
DSSP  ---------------lllleeLLLLEEEELL--lLLLEEEEELLLLLEEEEELlleelle


DSSP  --LEEEEELLL-LLEEEEEELL---LLLEEEEEEELL-LLLEEEEEELllEEEEEELLLL
Query --KGAKXITRD-GRELWNIAAP---AGCEXQTARILP-DGNALVAWCGhpSTILEVNXKG  106
ident        |    |             |                ||        | |   |
Sbjct paGEILRIDLKtGKKTVICKPEvngYGGIPAGCQCDRdANQLFVADMR--LGLLVVQTDG  101
DSSP  elLEEEEELLLlLLEEEEELLEellEELLEEEEEELLlLLEEEEEELL--LEEEEEELLL


DSSP  LEeEEEEELLllllhhhLLLLLEELLLLLEEEEELL---------------LLEEEEELL
Query EVlSKTEFETgierphaQFRQINKNKKGNYLVPLFA---------------TSEVREIAP  151
ident                            ||      |                        
Sbjct TF-EEIAKKDsegrrmqGCNDCAFDYEGNLWITAPAgevapadytrsmqekFGSIYCFTT  160
DSSP  LE-EELLLLLlllllllLLLEEEELLLLLEEEEELLlllllllllllllllLEEEEEELL


DSSP  LLLEEEEEELLLLLLEEEELLL-----LLEEEELLLLLEEEEELLL---LLLEEEEEEHh
Query NGQLLNSVKLSGTPFSSAFLDN-----GDCLVACGDAHCFVQLNLE---SNRIVRRVNAn  203
ident  ||          |   |             ||                           
Sbjct DGQMIQVDTAFQFPNGIAVRHMndgrpYQLIVAETPTKKLWSYDIKgpaKIENKKVWGH-  219
DSSP  LLLEEEEEEEELLEEEEEEEELlllleEEEEEEELLLLEEEEEEEEellEEEEEEEEEE-


DSSP  hlllLLLL--EEEEEEELLLLLEEEEEELlllllhhhllLLLEEEELLLL-LEEEEELLl
Query diegVQLF--FVAQLFPLQNGGLYICNWQghdreagkgkHPQLVEIDSEG-KVVWQLNDk  260
ident                       |   ||                     |          
Sbjct ---iPGTHegGADGMDFDEDNNLLVANWG----------SSHIEVFGPDGgQPKMRIRC-  265
DSSP  ---lLLLLllEEEEEEELLLLLEEEEEEL----------LLEEEEELLLLlLLLEEEEL-


DSSP  lLLLLLLEEEEELL------------------------------------
Query vKFGXISTICPIRE------------------------------------  274
ident   |   |                                           
Sbjct -PFEKPSNLHFKPQtktifvtehennavwkfewqrngkkqycetlkfgif  314
DSSP  -LLLLEEEEEELLLlleeeeeelllleeeeeellllllllhhhlllllll


No 18: Query=mol1A Sbjct=2vpjA Z-score=18.5

back to top
DSSP  LLLEEEEELLL------LLEEEEEELLLLEEEEE-EELLLlLLLLEEEELLlLLEEEELL
Query SPQHLLVGGSG------WNKIAIINKDTKEIVWE-YPLEKgWECNSVAATKaGEILFSYS   53
ident     ||| |                  | |         |              |     
Sbjct ANEVLLVVGGFgsqqspIDVVEKYDPKTQEWSFLpSITRK-RRYVASVSLH-DRIYVIGG   58
DSSP  LLEEEEEELLEellleeLLLEEEEELLLLEEEELlLLLLL-LLLLEEEEEL-LEEEEELL


DSSP  ------LEEEEELL-------LLLEEEEEELlllLEEE-EEEELlLLLEEEEEEL----l
Query ------KGAKXITR-------DGRELWNIAApagCEXQ-TARILpDGNALVAWCG----h   95
ident                                         |  |      |         
Sbjct ydgrsrLSSVECLDytadedgVWYSVAPMNV---RRGLaGATTL-GDMIYVSGGFdgsrr  114
DSSP  llllllLLLEEEEElllllllLLEEELLLLL---LLLLlEEEEE-LLEEEEELLLlllll


DSSP  lEEEEEELL-LLLEEEEEEELLllllhhHLLLLLEELLlLLEEEEEL-----LLLEEEEE
Query pSTILEVNX-KGEVLSKTEFETgierphAQFRQINKNKkGNYLVPLF-----ATSEVREI  149
ident                      |                 |                |   
Sbjct hTSMERYDPnIDQWSMLGDMQT-----aREGAGLVVAS-GVIYCLGGydglnILNSVEKY  168
DSSP  lLEEEEEELlLLEEEEEEELLL-----lLLLLEEEEEL-LEEEEELLlllllLLLLEEEE


DSSP  LL-LLLEEEEEEL-LLLL-LEEEELLlLLEEEELLL-----LLEEEEELLLLLLEEEEEE
Query AP-NGQLLNSVKL-SGTP-FSSAFLDnGDCLVACGD-----AHCFVQLNLESNRIVRRVN  201
ident  |  |   |             | |      |  |             |           
Sbjct DPhTGHWTNVTPMaTKRSgAGVALLN-DHIYVVGGFdgtahLSSVEAYNIRTDSWTTVTS  227
DSSP  ELlLLEEEEELLLlLLLLlLEEEEEL-LEEEEELLLlllllLLLEEEEELLLLEEEEELL


DSSP  HhhlllLLLLEeEEEEELLlLLEEEEEELLLLLlhhhlllLLEEEEL-LLLLEEEEELLl
Query AndiegVQLFFvAQLFPLQnGGLYICNWQGHDReagkgkhPQLVEID-SEGKVVWQLNDk  260
ident                  |  | ||                      |             
Sbjct M-----TTPRCyVGATVLR-GRLYAIAGYDGNS-----llSSIECYDpIIDSWEVVTSM-  275
DSSP  L-----LLLLLlLEEEEEL-LEEEEELLLLLLL-----leEEEEEEElLLLEEEEEEEE-


DSSP  lLLLLL-LEEEEELL
Query vKFGXI-STICPIRE  274
ident           |  ||
Sbjct -GTQRCdAGVCVLRE  289
DSSP  -EEEEElLEEEEEEL


No 19: Query=mol1A Sbjct=2hqsA Z-score=18.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgs   60
DSSP  llleeeellllleeeeellleelllllllllhhhhhhhhhhhllleeellhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlr  120
DSSP  hhhllhhhhhllllleeeeeeeeellllleeeeeeeeellllllleeeeeeeeelhhhhh


DSSP  --------------------LLLEEEEE-----llllLEEEEEELLLLEEEEEEELLLll
Query --------------------SPQHLLVG-----gsgwNKIAIINKDTKEIVWEYPLEKgw   35
ident                                              |              
Sbjct yaghtasdevfekltgikgaFRTRIAYVvqtnggqfpYELRVSDYDGYNQFVVHRSPQ--  178
DSSP  hhhhhhhhhhhhhhhlllllLLLEEEEEeelllllllEEEEEEELLLLLLEEEEEELL--


DSSP  LLLEEEEL-LLLLEEEEL----lLEEEEELL-LLLEeEEEELLLlLEEEEEEELLLL-LE
Query ECNSVAAT-KAGEILFSY----sKGAKXITR-DGRElWNIAAPAgCEXQTARILPDG-NA   88
ident    | |                       |   |      |             |||   
Sbjct PLMSPAWSpDGSKLAYVTfesgrSALVIQTLaNGAV-RQVASFP-RHNGAPAFSPDGsKL  236
DSSP  LEEEEEELlLLLEEEEEElllllLEEEEEELlLLLE-EEEELLL-LLEEEEEELLLLlEE


DSSP  EEEEEL-LLEEEEEELL-LLLEeEEEEeLLLLllhhhLLLLLEELLL-LLEEEEEL--LL
Query LVAWCG-HPSTILEVNX-KGEVlSKTEfETGIerphaQFRQINKNKK-GNYLVPLF--AT  143
ident   |                |                             |          
Sbjct AFALSKtGSLNLYVMDLaSGQI-RQVT-DGRS-----NNTEPTWFPDsQNLAFTSDqaGR  289
DSSP  EEEELLlLLLEEEEEELlLLLE-EELL-LLLL-----LEEEEEELLLlLEEEEEELllLL


DSSP  LEEEEELL-LLLEEEEEELLLLLLEEEEL-LLLLEEEEL--llLLEEEEELLLLLLEeEE
Query SEVREIAP-NGQLLNSVKLSGTPFSSAFL-DNGDCLVAC--gdAHCFVQLNLESNRIvRR  199
ident   |       |                   |                    |        
Sbjct PQVYKVNInGGAPQRITWEGSQNQDADVSsDGKFMVMVSsnggQQHIAKQDLATGGV-QV  348
DSSP  LEEEEEELlLLLLEELLLLLLEEEEEEELlLLLEEEEEEelllLEEEEEEELLLLLE-EE


DSSP  EEHhhlllllLLEEEEEEEL-LLLLEEEEEELlllllhhhLLLLLEEEEL-LLLLEeEEE
Query VNAndiegvqLFFVAQLFPL-QNGGLYICNWQghdreagkGKHPQLVEID-SEGKVvWQL  257
ident            |                   |        |    |             |
Sbjct LSS-------TFLDETPSLApNGTMVIYSSSQ--------GMGSVLNLVStDGRFK-ARL  392
DSSP  LLL-------LLLLEEEEELlLLLEEEEEEEE--------LLEEEEEEEElLLLLE-EEL


DSSP  LLlLLLLLLlEEEEEL-----l
Query NDkVKFGXIsTICPIR-----e  274
ident                       
Sbjct PA-TDGQVK-FPAWSPylhhhh  412
DSSP  LL-LLLEEE-EEEELLllllll


No 20: Query=mol1A Sbjct=2g8sA Z-score=18.3

back to top
DSSP  ----------------------LLLEEEEELLlLLEEEEEELLLLEEEEEE-ELLLLL--
Query ----------------------SPQHLLVGGSgWNKIAIINKDTKEIVWEY-PLEKGW--   35
ident                            |                                
Sbjct atvnvevlqdkldhpwalaflpDNHGXLITLR-GGELRHWQAGKGLSAPLSgVPDVWAhg   59
DSSP  llleeeeeeeeelleeeeeellLLLLEEEEEL-LLEEEEEELLLEELLLLLlLLLLLLll


DSSP  --LLLEEEELLLL----LEEEELL---------LEEEEELLL------LLEEEEEELLLL
Query --ECNSVAATKAG----EILFSYS---------KGAKXITRD------GRELWNIAAPAG   74
ident       |           |  |||                                    
Sbjct qgGLLDVVLAPDFaqsrRIWLSYSevgddgkagTAVGYGRLSddlskvTDFRTVFRQXPK  119
DSSP  llLEEEEEELLLHhhhlEEEEEEEeellllleeEEEEEEEELllllleEEEEEEEELLLL


DSSP  -----LEEEEEEELLLLLEEEEEEL------------lLEEEEEELLLLLEE--------
Query -----CEXQTARILPDGNALVAWCG------------hPSTILEVNXKGEVL--------  109
ident                 |    |                          ||          
Sbjct lstgnHFGGRLVFDGKGYLFIALGEnnqrptaqdldklQGKLVRLTDQGEIPddnpfike  179
DSSP  lllllLLLLLEEELLLLEEEEEELLlllhhhhhlllllLLEEEEEELLLLLLllllllll


DSSP  -----eEEEELLllllhhHLLLLLEELL-LLLEEEEELL---LLEEEEELLLLL------
Query -----sKTEFETgierphAQFRQINKNK-KGNYLVPLFA---TSEVREIAPNGQ------  154
ident                           |                 |               
Sbjct sgvraeIWSYGI------RNPQGXAXNPwSNALWLNEHGprgGDEINIPQKGKNygwpla  233
DSSP  llllllEEEELL------LEEEEEEEELlLLEEEEEEELlllLEEEELLLLLLLllllll


DSSP  ----------------------EEEEEEL--LLLLLEEEELL-------LLLEEEELLLL
Query ----------------------LLNSVKL--SGTPFSSAFLD-------NGDCLVACGDA  183
ident                                |      ||                    
Sbjct twginysgfkipeakgeivagtEQPVFYWkdSPAVSGXAFYNsdkfpqwQQKLFIGALKD  293
DSSP  llllllllllllllllllllllLLLLEEEllLLLEEEEEEELllllhhhLLEEEEEELLL


DSSP  LEEEEELLL--LLLEEEEEEHHhllllLLLEEEEEEELLLLLEEEEEELLllllhhhllL
Query HCFVQLNLE--SNRIVRRVNANdiegvQLFFVAQLFPLQNGGLYICNWQGhdreagkgkH  241
ident                  |                      | ||                
Sbjct KDVIVXSVNgdKVTEDGRILTD-----RGQRIRDVRTGPDGYLYVLTDES---------S  339
DSSP  LEEEEEEEEllEEEEEEEELHH-----HLLLEEEEEELLLLLEEEEELLL---------L


DSSP  LLEEEELLllleeeeelllllllllleeeeell
Query PQLVEIDSegkvvwqlndkvkfgxisticpire  274
ident   |                              
Sbjct GELLKVSP-------------------------  347
DSSP  EEEEEEEL-------------------------


No 21: Query=mol1A Sbjct=1ri6A Z-score=18.2

back to top
DSSP  -LLLEEEEELLLLLEEEEEELL---LLEEEEEEELLllLLLLEEEELLLL-LEEEELL--
Query -SPQHLLVGGSGWNKIAIINKD---TKEIVWEYPLEkgWECNSVAATKAG-EILFSYS--   53
ident    |           |   |                                        
Sbjct sLKQTVYIASPESQQIHVWNLNhegALTLTQVVDVP--GQVQPMVVSPDKrYLYVGVRpe   58
DSSP  lLEEEEEEEEHHHLEEEEEEELlllLEEEEEEEELL--LLLLLEEELLLLlEEEEEELll


DSSP  LEEEEELLL-----LLEEEEEELLllLEEEEEEELLLL-LEEEEEELLlEEEEEEL--LL
Query KGAKXITRD-----GRELWNIAAPagCEXQTARILPDG-NALVAWCGHpSTILEVN--XK  105
ident                      | |             |    |                 
Sbjct FRVLAYRIApddgaLTFAAESALP--GSLTHISTDHQGqFVFVGSYNAgNVSVTRLedGL  116
DSSP  LEEEEEEELlllllEEEEEEEELL--LLLLEEEELLLLlEEEEEELLLlEEEEEEEelLE


DSSP  LLEEEEEEELLllllhhHLLLLLEELLL-LLEEEEELLLLEEEEELL----LLLEE--EE
Query GEVLSKTEFETgierphAQFRQINKNKK-GNYLVPLFATSEVREIAP----NGQLL--NS  158
ident                        |         ||                         
Sbjct PVGVVDVVEGL------DGCHSANISPDnRTLWVPALKQDRICLFTVsddgHLVAQdpAE  170
DSSP  EEEEEEEELLL------LLLLLLEELLLlLEEEEEEHHHLEEEEEEEllllLEEEEeeEE


DSSP  EELL--LLLLEEEELLLL-LEEEELLLLLEEEEELLL----LLLEEEEE-EHHHllllll
Query VKLS--GTPFSSAFLDNG-DCLVACGDAHCFVQLNLE----SNRIVRRV-NANDiegvql  210
ident |       |    |  |                  |         |              
Sbjct VTTVegAGPRHMVFHPNEqYAYCVNELNSSVDVWELKdphgNIECVQTLdMMPEnfsdtr  230
DSSP  EELLllLLEEEEEELLLLlEEEEEELLLLEEEEEELLllllLLEEEEEEeLLLLllllll


DSSP  LEEEeEEELLL-LLEEEeEELLLL------------------llhhhllllLEEEellll
Query FFVAqLFPLQN-GGLYIcNWQGHD------------------reagkgkhpQLVEidseg  251
ident               ||                                            
Sbjct WAAD-IHITPDgRHLYA-CDRTASlitvfsvsedgsvlskegfqptetqprGFNV---dh  285
DSSP  LEEE-EEELLLlLEEEE-EELLLLeeeeeeelllllleeeeeeeellllllLEEE---ll


DSSP  leEEEE---llLLLL---------------------LLLLEEEEELL-
Query kvVWQL---ndKVKF---------------------GXISTICPIRE-  274
ident                                                 
Sbjct sgKYLIaagqkSHHIsvyeivgeqgllhekgryavgQGPMWVVVNAHe  333
DSSP  llLEEEeelllLLEEeeeeeelllleeeeeeeeellLLLLEEEEEEEl


No 22: Query=mol1A Sbjct=2dyhA Z-score=18.0

back to top
DSSP  llLEEEEELLL----LLEEEEEELLLLEEEEE-EELLllLLLLEEEELLlLLEEEELL--
Query spQHLLVGGSG----WNKIAIINKDTKEIVWE-YPLEkgWECNSVAATKaGEILFSYS--   53
ident         |             |                           |         
Sbjct vgRLIYTAGGYfrqsLSYLEAYNPSNGSWLRLaDLQV-pRSGLAGCVVG-GLLYAVGGrn   58
DSSP  llLEEEEELLLllllLLLEEEELLLLLLEEELlLLLL-lLLLLEEEEEL-LEEEEELLee


DSSP  --------LEEEEELL---LLLEEEEEELllLLEE-EEEEELlLLLEEEEEEL----LLE
Query --------KGAKXITR---DGRELWNIAApaGCEX-QTARILpDGNALVAWCG----HPS   97
ident           |                                ||            | |
Sbjct nspdgntdSSALDCYNpmtNQWSPCASMS--VPRNrIGVGVI-DGHIYAVGGShgciHHS  115
DSSP  lllllleeLLLEEEEElllLEEEELLLLL--LLLLlLEEEEE-LLEEEEELLEelleELL


DSSP  EEEEELL-LLLEEEEEEELLllllhhHLLLLLEELLlLLEEEEEL-----LLLEEEEELL
Query TILEVNX-KGEVLSKTEFETgierphAQFRQINKNKkGNYLVPLF-----ATSEVREIAP  151
ident           |        |                                       |
Sbjct SVERYEPeRDEWHLVAPMLT-----rRIGVGVAVLN-RLLYAVGGfdgtnRLNSAECYYP  169
DSSP  LEEEEELlLLEEEEELLLLL-----lLLLLEEEEEL-LEEEEEEEellllEEEEEEEEEH


DSSP  -LLLEEEEEEL-LLLL-LEEEELLlLLEEEELLL-----LLEEEEELLLLLLEeEEEEHh
Query -NGQLLNSVKL-SGTP-FSSAFLDnGDCLVACGD-----AHCFVQLNLESNRIvRRVNAn  203
ident                       |       | |               |       |   
Sbjct eRNEWRMITPMnTIRSgAGVCVLH-NCIYAAGGYdgqdqLNSVERYDVETETW-TFVAP-  226
DSSP  hHLEEEEELLLlLLLLlLEEEEEL-LEEEEELLLlllllLLLEEEEELLLLEE-EELLL-


DSSP  hlllLLLLEEEEEEELLlLLEEEEEELlLLLLhhhlllLLEEEELL-LLLEEEEELLllL
Query diegVQLFFVAQLFPLQnGGLYICNWQgHDREagkgkhPQLVEIDS-EGKVVWQLNDkvK  262
ident                 | |  |                      |               
Sbjct ---mRHHRSALGITVHQ-GKIYVLGGY-DGHT----flDSVECYDPdSDTWSEVTRM--T  275
DSSP  ---lLLLLLLLEEEEEL-LEEEEELLL-LLLL----llLEEEEEELlLLEEEEEEEL--L


DSSP  LLLL-LEEEEELL--------
Query FGXI-STICPIRE--------  274
ident  |          |        
Sbjct SGRSgVGVAVTMEpcrkqidq  296
DSSP  LLLLlLEEEEELLlllleell


No 23: Query=mol1A Sbjct=2fp9A Z-score=17.9

back to top
DSSP  llleeeeellllleeeeeellllEEEEEEELLlLLLLLEEEEL-LLLLEEEELL-LEEEE
Query spqhllvggsgwnkiaiinkdtkEIVWEYPLEkGWECNSVAAT-KAGEILFSYS-KGAKX   58
ident                                      ||            |        
Sbjct ---------------------piLKEILIEAP-SYAPNSFTFDsTNKGFYTSVQdGRVIK   38
DSSP  ---------------------leEEEEEEELL-LLLLLLEELLlLLLLEEEELLlLEEEE


DSSP  ELLL-LLEEEEEELL------------------LLLEEEEEEELL-LLLEEEEEELllEE
Query ITRD-GRELWNIAAP------------------AGCEXQTARILP-DGNALVAWCGhpST   98
ident              |                                        |     
Sbjct YEGPnSGFVDFAYASpywnkafcenstdaekrpLCGRTYDISYNLqNNQLYIVDCY--YH   96
DSSP  ELLLlLLEEEEEELLllllhhhhlllllhhhhhHHLLEEEEEEELlLLEEEEEELL--LE


DSSP  EEEELLLLLEEEEEEELLLlllhhHLLLLLEEL-LLLLEEEEELL---------------
Query ILEVNXKGEVLSKTEFETGierphAQFRQINKN-KKGNYLVPLFA---------------  142
ident    |   |                            |                       
Sbjct LSVVGSEGGHATQLATSVD-gvpfKWLYAVTVDqRTGIVYFTDVStlyddrgvqqimdts  155
DSSP  EEEELLLLEELEEEELEEL-leelLLEEEEEELlLLLLEEEEELLlllllllhhhhhhhl


DSSP  --LLEEEEELL-LLLEEEEEELLLLLLEEEELLLL-LEEEELLLLLEEEEELLL---LLL
Query --TSEVREIAP-NGQLLNSVKLSGTPFSSAFLDNG-DCLVACGDAHCFVQLNLE---SNR  195
ident   |       |         |    |            |||    |  |   ||      
Sbjct dkTGRLIKYDPsTKETTLLLKELHVPGGAEVSADSsFVLVAEFLSHQIVKYWLEgpkKGT  215
DSSP  llLEEEEEEELlLLEEEEEEEEELLLLEEEELLLLlEEEEEEHHHLEEEEEELLlllLLL


DSSP  EeEEEEHhhlllllLLEEEEEEELLLLLEEEEEELL---LLLLHHhllLLLEEEELLLLL
Query IvRRVNAndiegvqLFFVAQLFPLQNGGLYICNWQG---HDREAGkgkHPQLVEIDSEGK  252
ident                           |                      |     |  | 
Sbjct A-EVLVK-------IPNPGNIKRNADGHFWVSSSEEldgNMHGRV---DPKGIKFDEFGN  264
DSSP  E-EEEEE-------LLLEEEEEELLLLLEEEEEEEElllLLLLLE---EEEEEEELLLLL


DSSP  EEEEELLLLLL--LLLLEEEEEL-----------------l
Query VVWQLNDKVKF--GXISTICPIR-----------------e  274
ident           |       |                      
Sbjct ILEVIPLPPPFagEHFEQIQEHDgllyigtlfhgsvgilvy  305
DSSP  EEEEEELLLLLllLLLLEEEEELleeeeellllleeeeeel


No 24: Query=mol1A Sbjct=1jofA Z-score=17.8

back to top
DSSP  LLLEEEEELLL-lLEEEEEELL----LLEEEEEEELLLLLLLLEEEELLLL-LEEEELLL
Query SPQHLLVGGSG-wNKIAIINKD----TKEIVWEYPLEKGWECNSVAATKAG-EILFSYSK   54
ident    ||  |       |     |    |                          |     |
Sbjct PLHHLXIGTWTppGAIFTVQFDdeklTCKLIKRTEIPQDEPISWXTFDHERkNIYGAAXK   60
DSSP  LEEEEEEEELLllLEEEEEEEEllllEEEEEEEEELLLLLLLLEEEELLLLlEEEEEELL


DSSP  EEEEELLL----LLEEEEEELL---------LLLEEEEEEELLL--LLEEEEEELLL-EE
Query GAKXITRD----GRELWNIAAP---------AGCEXQTARILPD--GNALVAWCGHP-ST   98
ident                                                             
Sbjct KWSSFAVKspteIVHEASHPIGghprandadTNTRAIFLLAAKQppYAVYANPFYKFaGY  120
DSSP  EEEEEEEEelleEEEEEEEELLllhhhhlllLLLEEEEEEELLLllLLEEEEEELLLlLE


DSSP  EEEELLL-----LLEEEEEeELLLLllhhHLLLLLEELLL-LLEEEEELLLLEEEEELLL
Query ILEVNXK-----GEVLSKTeFETGIerphAQFRQINKNKK-GNYLVPLFATSEVREIAPN  152
ident                                                             
Sbjct GNVFSVSetgklEKNVQNY-EYQEN----TGIHGXVFDPTeTYLYSADLTANKLWTHRKL  175
DSSP  EEEEEELlllleEEEEEEE-ELLLL----LLEEEEEELLLlLEEEEEELLLLEEEEEEEL


DSSP  ----LLEEEEEELL---LLLLEEEELLLL-LEEEELLLLLEEEEELLLL----LLEE-EE
Query ----GQLLNSVKLS---GTPFSSAFLDNG-DCLVACGDAHCFVQLNLES----NRIV-RR  199
ident       |  ||        |   |    |                               
Sbjct asgeVELVGSVDAPdpgDHPRWVAXHPTGnYLYALXEAGNRICEYVIDPathxPVYThHS  235
DSSP  llllEEEEEEEELLlllLLEEEEEELLLLlEEEEEELLLLEEEEEEELLllllEEEEeEE


DSSP  EEH--------hhllllllLEEEEEEELLL-LLEEEEEELLllllHHHLlLLLEeEELL-
Query VNA--------ndiegvqlFFVAQLFPLQN-GGLYICNWQGhdreAGKGkHPQLvEIDS-  249
ident                                                             
Sbjct FPLippgipdrdpetgkglYRADVCALTFSgKYXFASSRAN----KFEL-QGYI-AGFKl  289
DSSP  EELllllllllllllllllEEEEEEEELLLlLEEEEEEEEL----LLLL-LLEE-EEEEe


DSSP  -------LLLEeeeELLL------------------------LLLL--------------
Query -------EGKVvwqLNDK------------------------VKFG--------------  264
ident                                                             
Sbjct rdcgsieKQLF-lsPTPTsgghsnavspcpwsdewxaitddqEGWLeiyrwkdeflhrva  348
DSSP  llllleeEEEE-eeELLLllllllleeelllllleeeeelllLLEEeeeeeelleeeeee


DSSP  -------lllEEEEELL
Query -------xisTICPIRE  274
ident                  
Sbjct rvripepgfgXNAIWYD  365
DSSP  eeellllleeEEEEEEL


No 25: Query=mol1A Sbjct=3dasA Z-score=17.8

back to top
DSSP  llleeeeellllleeeeeeLLLLEEEEEEELlllLLLLEEEELLLLLEEEELL--LEEEE
Query spqhllvggsgwnkiaiinKDTKEIVWEYPLekgWECNSVAATKAGEILFSYS--KGAKX   58
ident                               |         |    |  | |         
Sbjct -------------appakgSVKVLRTVATGL---NSPWGLAPLPGGDLLVSSRdeATITR   44
DSSP  -------------llllllLEEEEEEEELLL---LLEEEEEELLLLLEEEEELllLEEEE


DSSP  ELL-LLLEEEEEEL-LLLL----EEEEEEELLL----LLEEEEEEL-LLEEEEEELL---
Query ITR-DGRELWNIAA-PAGC----EXQTARILPD----GNALVAWCG-HPSTILEVNX---  104
ident      ||                        ||                  |        
Sbjct VDAkTGRKTELGEVpGVSPsgegGLLGIALSPDyasdHXVYAYFTSaSDNRIVRXLYdek  104
DSSP  ELLlLLLEEEEEELlLLLLllllLEEEEEELLLhhhhLEEEEEEELlLLEEEEEEELlll


DSSP  ----LLLE-EEEEEELLLLLLhHHLLLLLEELLLLLEEEEELL-------------LLEE
Query ----KGEV-LSKTEFETGIERpHAQFRQINKNKKGNYLVPLFA-------------TSEV  146
ident                             |                               
Sbjct kpsgEQLGaPDTVFRGIPKGV-IHNGGRIAFGPDKXLYAGTGEsgdtglsqdrkslGGKI  163
DSSP  llllLLLLlLEEEEEEELLLL-LLLLLLEEELLLLLEEEELLLlllhhhlllllllLLLE


DSSP  EEELLLLLE---------EEEEELLLLLLEEEELLLLLEEEELLL---lLEEEEELllLL
Query REIAPNGQL---------LNSVKLSGTPFSSAFLDNGDCLVACGD---aHCFVQLNleSN  194
ident     | |                        |  |                         
Sbjct LRXTPDGEPapgnpfpgsPVYSYGHRNVQGLAWDDKQRLFASEFGqdtwDELNAIK--PG  221
DSSP  EEELLLLLLlllllllllLEEELLLLLLLEEEELLLLLEEEEELLllllEEEEEEL--LL


DSSP  LE---------------EEEEEHhhllllLLLEEEEEEELLlLLEEEEEELlllllhhhl
Query RI---------------VRRVNAndiegvQLFFVAQLFPLQnGGLYICNWQghdreagkg  239
ident                     |                     |                 
Sbjct DNygwpeaegkgggsgfHDPVAQ---wstDEASPSGIAYAE-GSVWXAGLR---------  268
DSSP  LLlllllllllllllllLLLLEE---ellLLLLEEEEEEEL-LEEEEEELL---------


DSSP  llLLEEEELL-----LLLEEEEELLLllLLLLLEEEEEL---------------------
Query khPQLVEIDS-----EGKVVWQLNDKvkFGXISTICPIR---------------------  273
ident     |  |              |      |   |  |                       
Sbjct -gERLWRIPLkgtaaAADPQAFLEGE--YGRLRTVAPAGgdklwlvtsntdgrgdakggd  325
DSSP  -lLLEEEEEEelleeLLLLEEELLLL--LLLEEEEEEEElleeeeeelllllllllllll


DSSP  --------l
Query --------e  274
ident          
Sbjct drileleve  334
DSSP  lleeeeeel


No 26: Query=mol1A Sbjct=3frxB Z-score=17.8

back to top
DSSP  ----------------------------lLLEEEEELlLLLEEEEEELL-----LLEEEE
Query ----------------------------sPQHLLVGGsGWNKIAIINKD-----TKEIVW   27
ident                              |  ||                        | 
Sbjct xasnevlvlrgtleghngwvtslatsagqPNLLLSAS-RDKTLISWKLTgddqkFGVPVR   59
DSSP  lllleeeeeeeeelllllleeeeeellllLLEEEEEE-LLLLEEEEEELlllllLEEEEE


DSSP  EEELLlLLLLLEEEELLL-LLEEEELL-LEEEEELL-LLLEEEE-EELLllLEEEEEEEL
Query EYPLEkGWECNSVAATKA-GEILFSYS-KGAKXITR-DGRELWN-IAAPagCEXQTARIL   83
ident                |      |     |         |                   | 
Sbjct SFKGH-SHIVQDCTLTADgAYALSASWdKTLRLWDVaTGETYQRfVGHK--SDVXSVDID  116
DSSP  EELLL-LLLEEEEEELLLlLEEEEEELlLEEEEEELlLLEEEEEeELLL--LLEEEEEEL


DSSP  LLL-LEEEEEELllEEEEEELLLLLEEEEEeELLLlllhhHLLLLLEELL-LLLEEEEEL
Query PDG-NALVAWCGhpSTILEVNXKGEVLSKTeFETGierphAQFRQINKNK-KGNYLVPLF  141
ident                ||     ||  |                 |               
Sbjct KKAsXIISGSRD--KTIKVWTIKGQCLATL-LGHN-----DWVSQVRVVPnSVTIISAGN  168
DSSP  LLLlEEEEEELL--LLEEEEELLLLEEEEE-LLLL-----LLEEEEEELLlLLEEEEEEL


DSSP  lLLEEEEELL-LLLEEEEEE-LLLLLLEEEELLL-LLEEEElLLLLEEEEELLLLLLEEE
Query aTSEVREIAP-NGQLLNSVK-LSGTPFSSAFLDN-GDCLVAcGDAHCFVQLNLESNRIVR  198
ident     |        |                          | |        ||       
Sbjct -DKXVKAWNLnQFQIEADFIgHNSNINTLTASPDgTLIASA-GKDGEIXLWNLAAKKAXY  226
DSSP  -LLEEEEEELlLLEEEEEEElLLLLEEEEEELLLlLEEEEE-ELLLEEEEEELLLLEEEE


DSSP  EEEHhhlllllLLEEEEEEELL-LLLEEEEEEL------------llllLHHH------L
Query RVNAndiegvqLFFVAQLFPLQ-NGGLYICNWQ------------ghdrEAGK------G  239
ident    |          |  |        |                                 
Sbjct TLSA-------QDEVFSLAFSPnRYWLAAATATgikvfsldpqylvddlRPEFagyskaA  279
DSSP  EEEL-------LLLEEEEEELLlLLEEEEEELLeeeeeeelleeeeeeeLLLLllllllL


DSSP  LLLLeeeellllleEEEE--llLLLLlllleeeeell
Query KHPQlveidsegkvVWQL--ndKVKFgxisticpire  274
ident                                      
Sbjct EPHA-vslawsadgQTLFagytDNVI--rvwqvxtan  313
DSSP  LLLE-eeeeellllLEEEeeelLLLE--eeeeeeell


No 27: Query=mol1A Sbjct=2p9wA Z-score=17.7

back to top
DSSP  llleeeeellllleeeeeellllEEEEEEELLLlLLLLEEEELL-LLLEEEELL--LEEE
Query spqhllvggsgwnkiaiinkdtkEIVWEYPLEKgWECNSVAATK-AGEILFSYS--KGAK   57
ident                                                    |        
Sbjct ---------------------alPDQIDVKVKN-LTPEDTIYDRtRQVFYQSNLykGRIE   38
DSSP  ---------------------llLLEEEELLLL-LLLLLEEEELlLLEEEEEELllLEEE


DSSP  EELLL-LLEEEEE---ELLL---LLEEEEEEELL---LLLEEEEEEL------------L
Query XITRD-GRELWNI---AAPA---GCEXQTARILP---DGNALVAWCG------------H   95
ident                 |               |                           
Sbjct VYNPKtQSHFNVVidgASSNgdgEQQMSGLSLLThdnSKRLFAVMKNaksfnfadqsshG   98
DSSP  EELLLlLLEEEELlllLLLLlllLEEEEEEEELLlllLLEEEEEEEEllllllllllllL


DSSP  LEEEEEELLLL----LEEEEEEEL-LLLL------lhhHLLLLLEELLLLLEEEEE-LLL
Query PSTILEVNXKG----EVLSKTEFE-TGIE------rphAQFRQINKNKKGNYLVPL-FAT  143
ident  |     |              ||    |             |      ||  |      
Sbjct ASSFHSFNLPLsensKPVWSVNFEkVQDEfekkagkrpFGVVQSAQDRDGNSYVAFaLGM  158
DSSP  LLEEEEEELLLllllLLLEEEELHhHHHHhhhhhllllEEEEEEEELLLLLEEEEEeELL


DSSP  LEEEEEL--LLLLEeEEEELL------LLLLEEEEL-LLLLEEEELLlLLEEEEELLL--
Query SEVREIA--PNGQLlNSVKLS------GTPFSSAFL-DNGDCLVACGdAHCFVQLNLE--  192
ident                     |             |           |             
Sbjct PAIARVSadGKTVS-TFAWESgnggqrPGYSGITFDpHSNKLIAFGG-PRALTAFDVSkp  216
DSSP  LEEEEELllLLLEE-EEEELLllllllLLLLEEEEElLLLEEEEELL-LLLEEEEELLll


DSSP  LLLEeEEEEhhHLLLLL-LLEEEEEEELL---LLLEEEEEELlllllhhhllllLEEEEL
Query SNRIvRRVNanDIEGVQ-LFFVAQLFPLQ---NGGLYICNWQghdreagkgkhpQLVEID  248
ident        |          |                |                        
Sbjct YAWP-EPVK--INGDFGtLSGTEKIVTVPvgnESVLVGARAP------------YAISFR  261
DSSP  LLLL-EELE--ELLLLLlLLLEEEEEEEEellEEEEEEEELL------------EEEEEE


DSSP  L-----LLLEeEEELlLLLL--LLLLEEEEELL---------------------------
Query S-----EGKVvWQLNdKVKF--GXISTICPIRE---------------------------  274
ident |                                                           
Sbjct SwdnwkSANI-KKTK-RSELqnSGFTAVADYYQgseqglyavsaffdngahggrsdyply  319
DSSP  LlllllEEEE-EEEE-LHHHhlLLEEEEEEEEElleeeeeeeellhhhlllllllleeee


DSSP  --------------
Query --------------  274
ident               
Sbjct kldnsiqnfhhhhh  333
DSSP  ellhhhhlllllll


No 28: Query=mol1A Sbjct=1fwxA Z-score=17.6

back to top
DSSP  ----------LLLEEEEELLLLLEEEEEELLLLEEEEEEELL------------------
Query ----------SPQHLLVGGSGWNKIAIINKDTKEIVWEYPLE------------------   32
ident                           |            |                    
Sbjct adgsvapgqlDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFnrcsatgwgqtnesvrih   60
DSSP  llllllllllLLEEEEELLLLLLEEEEEEELLLLEEEEEELLlllllllllllhhhhhhh


DSSP  --------------------LLLLLLEEEEL------LLLLEEEELL--LEEEEELL-LL
Query --------------------KGWECNSVAAT------KAGEILFSYS--KGAKXITR-DG   63
ident                            |                                
Sbjct ertmsertkkflaangkrihDNGDLHHVHMSftegkyDGRFLFMNDKanTRVARVRCdVM  120
DSSP  hllllhhhhhhhhhllllllLLLLLLLEEEEeelleeEEEEEEEEELllLEEEEEELlLL


DSSP  LEEEEEELLLLLEEEEEEELL---LLLEEEEEELL----------------LEEEEEEL-
Query RELWNIAAPAGCEXQTARILP---DGNALVAWCGH----------------PSTILEVN-  103
ident         |        |                                       |  
Sbjct KCDAILEIPNAKGIHGLRPQKwprSNYVFCNGEDEtplvndgtnmedvanyVNVFTAVDa  180
DSSP  EEEEEEELLLLLLEEEEEELLlllLLEEEEEELLLeellllllllllhhheEEEEEEEEl


DSSP  LLLLEEEEEEELLllllhhhLLLLLEELLL-LLEEEEELLL--------------LEEEE
Query XKGEVLSKTEFETgierphaQFRQINKNKK-GNYLVPLFAT--------------SEVRE  148
ident  | ||                                                       
Sbjct DKWEVAWQVLVSG-------NLDNCDADYEgKWAFSTSYNSekgmtlpemtaaemDHIVV  233
DSSP  LLLEEEEEEEELL-------LLLLEEELLLlLEEEEEELLLlllllhhhhlllleEEEEE


DSSP  ELLL---------------------------lLEEEEEELLLLLLEEEELLL-LLEEEEL
Query IAPN---------------------------gQLLNSVKLSGTPFSSAFLDN-GDCLVAC  180
ident                                            |             || 
Sbjct FNIAeiekaiaagdyqelngvkvvdgrkeassLFTRYIPIANNPHGCNMAPDkKHLCVAG  293
DSSP  EEHHhhhhhhhhllleeelleeeeellhhhllLLEEEEEEELLLLLEEELLLlLEEEEEL


DSSP  LLLlEEEEELLLLL------------LEEEE------------------------eeHHH
Query GDAhCFVQLNLESN------------RIVRR------------------------vnAND  204
ident         |                   |                               
Sbjct KLSpTVTVLDVTRFdavfyenadprsAVVAEpelglgplhtafdgrgnaytslfldsQVV  353
DSSP  LLLlLEEEEEHHHHhhhhhllllhhhHEEELlllllleeeeeelllleeeeeellllEEE


DSSP  L---------------------LLLLLLEEeEEEE-------LLLLLEEEEEELlllllH
Query I---------------------EGVQLFFVaQLFP-------LQNGGLYICNWQghdreA  236
ident                         |       |           |  |            
Sbjct KwniedairayagekvdpikdkLDVHYQPG-HLKTvmgetldATNDWLVCLSKF-----S  407
DSSP  EeehhhhhhhhhlllllleeeeEELLLLEE-EEEElllllllLLLLEEEEEELL-----L


DSSP  HHLL-------lLLEEEELL---LLLEEEEELLlllLLLLLEEEEELL------------
Query GKGK-------hPQLVEIDS---EGKVVWQLNDkvkFGXISTICPIRE------------  274
ident                  ||        |        |                       
Sbjct KDRFlnvgplkpENDQLIDIsgdKMVLVHDGPT---FAEPHDAIAVHPsilsdiksvwdr  464
DSSP  LLLLllllllllEEEEEEELlllLLEEEEEEEE---LLLLLLEEEELLllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct ndpmwaetraqaeadgvdidnwteevirdgnkvrvymssvapsfsiesftvkegdevtvi  524
DSSP  llhhhhhhhhhhhhllllllllllleeeelleeeeeeeeelleellleeeeellleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct vtnldeiddlthgftmgnygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrg  584
DSSP  eeelllllllleeeeelllleeeeelllleeeeeeelllleeeeeellllllllllllee


DSSP  -------
Query -------  274
ident        
Sbjct rmlvepk  591
DSSP  eeeeell


No 29: Query=mol1A Sbjct=2qc5A Z-score=17.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct seawmnfyleefnlsipdsgpygitssedgkvwftqhkankissldqsgrikefevptpd   60
DSSP  llhhhleeeeeeellllllleeeeeellllleeeeelllleeeeellllleeeeelllll


DSSP  ---------llLEEEEELLLLLEEEEEELlLLEEeEEEEL-LLLLLLLEEEELLLLLEEE
Query ---------spQHLLVGGSGWNKIAIINKdTKEIvWEYPL-EKGWECNSVAATKAGEILF   50
ident                    | |||    |       ||||               | | |
Sbjct akvmclivsslGDIWFTENGANKIGKLSK-KGGF-TEYPLpQPDSGPYGITEGLNGDIWF  118
DSSP  lleeeeeelllLLEEEEELLLLEEEEELL-LLLE-EEEELlLLLLLEEEEEELLLLLEEE


DSSP  ELL--LEEEEELLLLLEEeEEEL-LLLLEEEEEEELLLLLEEEEEELLlEEEEEELLLLL
Query SYS--KGAKXITRDGRELwNIAA-PAGCEXQTARILPDGNALVAWCGHpSTILEVNXKGE  107
ident            | ||           |          |             |      | 
Sbjct TQLngDRIGKLTADGTIY-EYDLpNKGSYPAFITLGSDNALWFTENQN-NSIGRITNTGK  176
DSSP  EELllLEEEEELLLLLEE-EEELlLLLLLEEEEEELLLLLEEEEELLL-LEEEEELLLLL


DSSP  EeEEEEELLLLllhhHLLLLLEELLLLLEEEEELLLLEEEEELLLLLEeEEEEL---LLL
Query VlSKTEFETGIerphAQFRQINKNKKGNYLVPLFATSEVREIAPNGQLlNSVKL---SGT  164
ident         |      |    |     |              |   |              
Sbjct L-EEYPLPTNA----AAPVGITSGNDGALWFVEIMGNKIGRITTTGEI-SEYDIptpNAR  230
DSSP  E-EEEELLLLL----LLEEEEEELLLLLEEEEELLLLEEEEELLLLLE-EEEELlllLLL


DSSP  LLEEEELLLLLEEEELLLLLEEEEELLlLLLEeEEEEHHhlllLLLLEEEEEEELLLLLE
Query PFSSAFLDNGDCLVACGDAHCFVQLNLeSNRIvRRVNANdiegVQLFFVAQLFPLQNGGL  224
ident |       |         |          | |                         |  
Sbjct PHAITAGKNSEIWFTEWGANQIGRITN-DNTI-QEYQLQ----TENAEPHGITFGKDGSV  284
DSSP  EEEEEELLLLLEEEEELLLLEEEEELL-LLLE-EEEELL----LLLLLLLLEEELLLLLE


DSSP  EEEEEllllllhhhlllLLEEEELLLlleeeeelllllllllleeeeell
Query YICNWqghdreagkgkhPQLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident                                                   
Sbjct WFALK------------CKIGKLNLN------------------------  298
DSSP  EEELL------------LEEEEEEEL------------------------


No 30: Query=mol1A Sbjct=3bg1A Z-score=17.3

back to top
DSSP  ----------LLLEEEEELlLLLEEEEEELL--LLEEEEEEELLlLLLLLEEEELLL---
Query ----------SPQHLLVGGsGWNKIAIINKD--TKEIVWEYPLEkGWECNSVAATKA---   45
ident               |           |                        ||       
Sbjct dmihdaqmdyYGTRLATCS-SDRSVKIFDVRngGQILIADLRGH-EGPVWQVAWAHPmyg   58
DSSP  lleeeeeelhHHLEEEEEE-LLLEEEEEEEEllEEEEEEEEELL-LLLEEEEEELLHhhl


DSSP  LLEEEELL-LEEEEELL---LLLEEEEEELLlLLEEEEEEELLL---LLEEEEEELllEE
Query GEILFSYS-KGAKXITR---DGRELWNIAAPaGCEXQTARILPD---GNALVAWCGhpST   98
ident                             |             |                 
Sbjct NILASCSYdRKVIIWREengTWEKSHEHAGH-DSSVNSVCWAPHdygLILACGSSD--GA  115
DSSP  LLEEEEELlLLEEEELLlllLLLEEEEELLL-LLLLLEEEELLLlllLLEEEELLL--LL


DSSP  EEEELL----LLLEeEEEEELLLlllhhHLLLLLEELL------------LLLEEEEELl
Query ILEVNX----KGEVlSKTEFETGierphAQFRQINKNK------------KGNYLVPLFa  142
ident |           ||  |                                           
Sbjct ISLLTYtgegQWEV-KKINNAHT-----IGCNAVSWAPavvppsgqkpnyIKRFASGGC-  168
DSSP  EEEEEEllllLEEE-LLLLLLLL-----LLLLLLEELLllllllllllllLLLEELLLL-


DSSP  LLEEEEELL----LLLEEEEEELL-LLLLEEEELLL-----LLEEEELlLLLEEEEELLL
Query TSEVREIAP----NGQLLNSVKLS-GTPFSSAFLDN-----GDCLVACgDAHCFVQLNLE  192
ident                                |                            
Sbjct DNLIKLWKEeedgQWKEEQKLEAHsDWVRDVAWAPSiglptSTIASCS-QDGRVFIWTCD  227
DSSP  LLLLLEEEEllllLEEEEELLLLLlLLEEEEELLLLlllllLEEEEEE-LLLEEEEEELL


DSSP  -----LLLEEEEEEHhhlllllLLEEEEEEELL-LLLEEEEEellllllhhhlllLLEEE
Query -----SNRIVRRVNAndiegvqLFFVAQLFPLQ-NGGLYICNwqghdreagkgkhPQLVE  246
ident                          |           |                    | 
Sbjct dassnTWSPKLLHKF-------NDVVWHVSWSItANILAVSG------------gDNKVT  268
DSSP  lllllLLLLLEEEEL-------LLLEEEEEELLlLLLEEEEE------------lLLLEE


DSSP  EL-------LLLLEEEeelllllllllleeeeell
Query ID-------SEGKVVWqlndkvkfgxisticpire  274
ident                                    
Sbjct LWkesvdgqWVCISDV------------------n  285
DSSP  EEeelllllEEEEEEL------------------l


No 31: Query=mol1A Sbjct=1c9uB Z-score=17.1

back to top
DSSP  -----------------------------------lLLEEEEELLLLLEEEEEELLLLEE
Query -----------------------------------sPQHLLVGGSGWNKIAIINKDTKEI   25
ident                                                 ||   |      
Sbjct dvpltpsqfakaksenfdkkvilsnlnkphallwgpDNQIWLTERATGKILRVNPESGSV   60
DSSP  lllllhhhhhlllllleeeeeeellllleeeeeellLLLEEEEELLLLEEEEELLLLLLL


DSSP  EEEEELLLLL-------LLLEEEELL----LLLEEEELL--------------LEEEEEL
Query VWEYPLEKGW-------ECNSVAATK----AGEILFSYS--------------KGAKXIT   60
ident                       |          |  |                      |
Sbjct KTVFQVPEIVndadgqnGLLGFAFHPdfknNPYIYISGTfknpkstdkelpnqTIIRRYT  120
DSSP  LEEEELLLLLlllllllLEEEEEELLllllLLEEEEEEEeelllllllllleeEEEEEEE


DSSP  LL------LLEEEEEE-LLLL--leeEEEEELLLLLEEEEEELL----------------
Query RD------GRELWNIA-APAG--cexQTARILPDGNALVAWCGH----------------   95
ident                |  |           | ||                          
Sbjct YNkstdtlEKPVDLLAgLPSSkdhqsGRLVIGPDQKIYYTIGDQgrnqlaylflpnqaqh  180
DSSP  EElllleeEEEEEEEEeELLLlllleEEEEELLLLLEEEEELLLllllhhhlllllllll


DSSP  ---------------lEEEEEELLLLLEE-----------EEEEELLllllhhHLLLLLE
Query ---------------pSTILEVNXKGEVL-----------SKTEFETgierphAQFRQIN  129
ident                    |  |  |                                  
Sbjct tptqqelngkdyhtymGKVLRLNLDGSIPkdnpsfngvvsHIYTLGH------RNPQGLA  234
DSSP  lllhhhhhllllllllLEEEEELLLLLLLlllleelleelLEEEELL------LEEEEEE


DSSP  ELLLLLEEEEELL---LLEEEEELLLLL--------------------------------
Query KNKKGNYLVPLFA---TSEVREIAPNGQ--------------------------------  154
ident     |  |          |   |   |                                 
Sbjct FTPNGKLLQSEQGpnsDDEINLIVKGGNygwpnvagykddsgyayanysaaanksikdla  294
DSSP  ELLLLLEEEEEELlllLEEEEELLLLLLlllllllllllllllleelhhhllllllllll


DSSP  -----------------------EEEEEEL-----------------------LLLLLEE
Query -----------------------LLNSVKL-----------------------SGTPFSS  168
ident                              |                          | | 
Sbjct qngvkvaagvpvtkesewtgknfVPPLKTLytvqdtynyndptcgemtyicwpTVAPSSA  354
DSSP  llllllllllleelhhhllllllLLLLEEElllllllllllllllllllllllLLLLLLL


DSSP  EELL---------LLLEEEELLLLLEEEEELL----LLLL-EEEEEEHhhllllLLLEEE
Query AFLD---------NGDCLVACGDAHCFVQLNL----ESNR-IVRRVNAndiegvQLFFVA  214
ident                  ||            |                            
Sbjct YVYKggkkaitgwENTLLVPSLKRGVIFRIKLdptySTTYdDAVPMFK------SNNRYR  408
DSSP  EEELlllllllllLLEEEEELLLLLLEEEEEEllllLLEEeEEELLLL------LLLLEE


DSSP  EEEELLL-LLEEEEEELLL---------LLLHhhlLLLL-EEEELLLlleeeeellllll
Query QLFPLQN-GGLYICNWQGH---------DREAgkgKHPQ-LVEIDSEgkvvwqlndkvkf  263
ident           ||                         |  |                   
Sbjct DVIASPDgNVLYVLTDTAGnvqkddgsvTNTL---ENPGsLIKFTYK-------------  452
DSSP  EEEELLLlLEEEEEELLLLleellllleELLL---LLLLlEEEEEEL-------------


DSSP  lllleeeeell
Query gxisticpire  274
ident            
Sbjct -----------  452
DSSP  -----------


No 32: Query=mol1A Sbjct=2h9lA Z-score=17.0

back to top
DSSP  llleeeeellllleeeeeelLLLEEEEEEELLlLLLLLEEEEL-LLLLEEEELL-LEEEE
Query spqhllvggsgwnkiaiinkDTKEIVWEYPLEkGWECNSVAAT-KAGEILFSYS-KGAKX   58
ident                                       ||           |   |  | 
Sbjct -sgrenlyfqgtqskptpvkPNYALKFTLAGH-TKAVSSVKFSpNGEWLASSSAdKLIKI   58
DSSP  -lhhhhllllllllllllllLLLEEEEEELLL-LLLEEEEEELlLLLEEEEEELlLLEEE


DSSP  ELL-LLLEEEEEELLlLLEEEEEEELLLL-LEEEEEELllEEEEEELlLLLEEEEEEELL
Query ITR-DGRELWNIAAPaGCEXQTARILPDG-NALVAWCGhpSTILEVNxKGEVLSKTEFET  116
ident     ||     |               |      |                   ||    
Sbjct WGAyDGKFEKTISGH-KLGISDVAWSSDSnLLVSASDD-kTLKIWDV-SSGKCLKTLKGH  115
DSSP  EELlLLLEEEEELLL-LLLEEEEEELLLLlEEEEEELL-lLEEEEEL-LLLLEEEEELLL


DSSP  LlllhhHLLLLLEELLL-LLEEEEELlLLEEEEELL-LLLEEEEEELL-LLLLEEEELLL
Query GierphAQFRQINKNKK-GNYLVPLFaTSEVREIAP-NGQLLNSVKLS-GTPFSSAFLDN  173
ident             | |          |    ||      |  |              |   
Sbjct S-----NYVFCCNFNPQsNLIVSGSF-DESVRIWDVkTGKCLKTLPAHsDPVSAVHFNRD  169
DSSP  L-----LLEEEEEELLLlLEEEEEEL-LLLEEEEELlLLLEEEEELLLlLLEEEEEELLL


DSSP  -LLEEEELlLLLEEEEELLLLLLEEEEEEHHhllllLLLEEEEEEELLL-LLEEEEEELl
Query -GDCLVACgDAHCFVQLNLESNRIVRRVNANdiegvQLFFVAQLFPLQN-GGLYICNWQg  231
ident                     |                   |       |           
Sbjct gSLIVSSS-YDGLCRIWDTASGQCLKTLIDD-----DNPPVSFVKFSPNgKYILAATLD-  222
DSSP  lLEEEEEE-LLLEEEEEELLLLLEEEEEELL-----LLLLEEEEEELLLlLEEEEEELL-


DSSP  llllhhhlllLLEEEEL-LLLLEEEEELLL------------------------LLLL--
Query hdreagkgkhPQLVEID-SEGKVVWQLNDK------------------------VKFG--  264
ident             |   | | ||                                      
Sbjct ----------NTLKLWDySKGKCLKTYTGHknekycifanfsvtggkwivsgseDNLVyi  272
DSSP  ----------LEEEEEElLLLEEEEEEELLlllllllleeeellllleeeelllLLLEee


DSSP  -----------------llLEEEEELL----------------------
Query -----------------xiSTICPIRE----------------------  274
ident                                                  
Sbjct wnlqtkeivqklqghtdvvISTACHPTeniiasaalendktiklwksdc  321
DSSP  eellllleeeeelllllleEEEEELLLlleeeeeelllllleeeeelll


No 33: Query=mol1A Sbjct=3fgbA Z-score=16.9

back to top
DSSP  LLLEEEEEllllleeEEEELL---------LLEEEEEE-----------------ELLL-
Query SPQHLLVGgsgwnkiAIINKD---------TKEIVWEY-----------------PLEK-   33
ident                                                             
Sbjct DLTXIVGTytsgdskGLYSFRfneengtatALSEAEVEnpsylvpsadgkfiyavSEFSn   60
DSSP  LEEEEEEElllllllEEEEEEelllllleeEEEEEELLlllleeellllleeeeeELLLl


DSSP  ---------------------------LLLLlEEEELlLLLEEEELL--LEEEEELL---
Query ---------------------------GWECnSVAATkAGEILFSYS--KGAKXITR---   61
ident                               |                             
Sbjct eqaaanafafnkeegtfrllntqktggEDPC-YIITN-GSNVVTANYsgGSISVFPIdkd  118
DSSP  llleeeeeeeelllleeeeeeeeelllLLEE-EEEEL-LLEEEEEELllLEEEEEELlll


DSSP  --LLLEEEEEELLL---------LLEEEEEEELLLL-LEEEEEELLlEEEEEELL-----
Query --DGRELWNIAAPA---------GCEXQTARILPDG-NALVAWCGHpSTILEVNX-----  104
ident                               || |||        |    |          
Sbjct gsLLPASEVVKFKGsgadkerqeKPHLHCVRITPDGkYLFADDLGT-DQIHKFIVnpnak  177
DSSP  llLLLLLEEEELLLlllllllllLLLEEEEEELLLLlEEEEEELLL-LEEEEEEElllll


DSSP  ------LLLEE--EEEEeLLLLllhhHLLLLLEELL-LLLEEEEELLLLEEEEELL---L
Query ------KGEVL--SKTEfETGIerphAQFRQINKNK-KGNYLVPLFATSEVREIAP---N  152
ident                              |                    |         
Sbjct adnedvFLKEGspASYK-VEAG----SGPRHLTFAPnGSYAYLINELSGTVIAFEYndgE  232
DSSP  llllllLEEEEeeEEEE-LLLL----LLEEEEEELLlLLEEEEEELLLLEEEEEEEellE


DSSP  LLEEEEEELL----LLLLEEEELLLL-LEEEELLL-LLEEEEELLL----LLLEEEEEEH
Query GQLLNSVKLS----GTPFSSAFLDNG-DCLVACGD-AHCFVQLNLE----SNRIVRRVNA  202
ident                          |          |                 |     
Sbjct LKEIQTIAADtvgaKGSGDIHISPDGkFLYASNRLkADGLAIFSIHpengXLTKVGYQLT  292
DSSP  EEEEEEEELLllllLLEEEEEELLLLlEEEEEELLlLLEEEEEEELllllLEEEEEEEEL


DSSP  hhlllllLLEEEEEEELLL-LLEEEEEELlllllhhhllLLLEEEELL------LLLEEE
Query ndiegvqLFFVAQLFPLQN-GGLYICNWQghdreagkgkHPQLVEIDS------EGKVVW  255
ident                   |   |                                     
Sbjct -------GIHPRNFIITPNgKYLLVACRD----------SNVIQVYERdtdtglLTDIRK  335
DSSP  -------LLLLLEEEELLLlLEEEEEELL----------LLEEEEEEEllllllEEELLL


DSSP  EELllllLLLLLEEEEell
Query QLNdkvkFGXISTICPire  274
ident              |     
Sbjct DIK----VDKPVCIKF-vp  349
DSSP  LEE----LLLEEEEEE-ll


No 34: Query=mol1A Sbjct=3dsmA Z-score=16.6

back to top
DSSP  lLLEEEEELLL-----lLEEEEEELLLLEEEEEE-------ELLLllLLLEEEELlLLLE
Query sPQHLLVGGSG-----wNKIAIINKDTKEIVWEY-------PLEKgwECNSVAATkAGEI   48
ident     |     |               | |   |         |       |      |  
Sbjct -ASGLFITNEGnfqysnATLSYYDPATCEVENEVfyrangfKLGD--VAQSXVIR-DGIG   56
DSSP  -LLEEEEEELLllllllLEEEEEELLLLEEELLHhhhhhllLLLL--LEEEEEEE-LLEE


DSSP  EEELL--LEEEEELL-LLLEEEEEELLllLEEEEEEeLLLL-LEEEEEELLLEEEEEELL
Query LFSYS--KGAKXITR-DGRELWNIAAPagCEXQTARiLPDG-NALVAWCGHPSTILEVNX  104
ident             |      |   |                   | |              
Sbjct WIVVNnsHVIFAIDInTFKEVGRITGF--TSPRYIH-FLSDeKAYVTQIWDYRIFIINPK  113
DSSP  EEEEHhhLEEEEEELlLLLEEEEEELL--LLEEEEE-EEELlEEEEEELLLLEEEEEELL


DSSP  LLLEeEEEEELLLLLLhhHLLLlLEELLLLLEEEEEL-LLLEEEEELL-LLLEEEEEELL
Query KGEVlSKTEFETGIERphAQFRqINKNKKGNYLVPLF-ATSEVREIAP-NGQLLNSVKLS  162
ident   |                              |           |              
Sbjct TYEI-TGYIECPDXDXesGSTE-QXVQYGKYVYVNCWsYQNRILKIDTeTDKVVDELTIG  171
DSSP  LLEE-EEEEELLLLLLllLLLL-LEEEELLEEEEEELlLLLEEEEEELlLLEEEEEEELL


DSSP  LLLLEEEELLLLLEEEELLLL----------LEEEEELLLLLLEEEEEEHHhlllllLLE
Query GTPFSSAFLDNGDCLVACGDA----------HCFVQLNLESNRIVRRVNANdiegvqLFF  212
ident   | |                                  |                    
Sbjct IQPTSLVXDKYNKXWTITDGGyegspygyeaPSLYRIDAETFTVEKQFKFK----lgDWP  227
DSSP  LLLLLLEELLLLEEEEELLLLllllllllllLEEEEEELLLLEEEEEEELL----llLLL


DSSP  EeEEEELLL-LLEEEEEE------------llllllhHHLLLLLEEEellllleEEEELL
Query VaQLFPLQN-GGLYICNW------------qghdreaGKGKHPQLVEidsegkvVWQLND  259
ident             ||  |                                     |     
Sbjct S-EVQLNGTrDTLYWINNdiwrxpveadrvpvrpfleFRDTKYYGLTvnpnngeVYVADA  286
DSSP  E-EEEELLLlLEEEEELLleeeeelllllllllllllLLLLLEEEEEellllllEEEEEL


DSSP  L---LLLL------------------LLLEEEEELL-----
Query K---VKFG------------------XISTICPIRE-----  274
ident                                |   |     
Sbjct IdyqQQGIvyryspqgklidefyvgiIPGAFCWKLEhhhhh  327
DSSP  LlllLEEEeeeellllleeeeeeeeeLEEEEEEELLlllll


No 35: Query=mol1A Sbjct=1qniA Z-score=16.5

back to top
DSSP  --------LLLEEEEELLLLLEEEEEELLLLEEEEEEELL--------------------
Query --------SPQHLLVGGSGWNKIAIINKDTKEIVWEYPLE--------------------   32
ident                 |                    |                      
Sbjct ahvapgelDEYYGFWSGGHQGEVRVLGVPSMRELMRIPVFnvdsatgwgitneskeilgg   60
DSSP  llllllllLLEEEEEELLLLLLEEEEEELLLEEEEEELLLlllllllllllhhhhhhhll


DSSP  ----LLLLLLEEEEL------LLLLEEEELL--LEEEEELL-LLLEEEEEELLLLLEEEE
Query ----KGWECNSVAAT------KAGEILFSYS--KGAKXITR-DGRELWNIAAPAGCEXQT   79
ident         |                             |             |       
Sbjct dqqyLNGDCHHPHISmtdgryDGKYLFINDKanTRVARIRLdIMKTDKITHIPNVQAIHG  120
DSSP  llllLLLLLLLLEEEeelleeEEEEEEEEELllLEEEEEELlLLEEEEEEELLLLLLEEE


DSSP  EEELL---LLLEEEEEELL---------------LEEEEEEL-LLLLEEEEEEELLllll
Query ARILP---DGNALVAWCGH---------------PSTILEVN-XKGEVLSKTEFETgier  120
ident  |                                             |            
Sbjct LRLQKvpkTNYVFCNAEFVipqpndgtdfsldnsYTMFTAIDaETMDVAWQVIVDG----  176
DSSP  EEELLlllLLEEEEEELLLeelllllllllhhheEEEEEEEElLLLLEEEEEEELL----


DSSP  hhhLLLLLEELLL-LLEEEEELLL--------------LEEEEELLL-------------
Query phaQFRQINKNKK-GNYLVPLFAT--------------SEVREIAPN-------------  152
ident                                         |                   
Sbjct ---NLDNTDADYTgKYATSTCYNSeravdlagtmrndrDWVVVFNVEriaaavkagnfkt  233
DSSP  ---LLLLEEELLLlLEEEEEELLLlllllhhhhlllllLEEEEEEHHhhhhhhhllllll


DSSP  --------------lLEEEEEELLLLLLEEEELLL-LLEEEELLLLLEEEEELLLLL---
Query --------------gQLLNSVKLSGTPFSSAFLDN-GDCLVACGDAHCFVQLNLESN---  194
ident                           |                                 
Sbjct igdskvpvvdgrgesEFTRYIPVPKNPHGLNTSPDgKYFIANGKLSPTVSVIAIDKLddl  293
DSSP  llllllleeelllllLLEEEELLLLLLLLEEELLLlLEEEEELLLLLLEEEEEHHHHhhh


DSSP  ---------LEEEEEE-------------------------HHHL---------------
Query ---------RIVRRVN-------------------------ANDI---------------  205
ident           ||                                                
Sbjct fedkielrdTIVAEPElglgplhttfdgrgnayttlfidsqVCKWniadaikhyngdrvn  353
DSSP  llllllhhhHEEELLLlllleeeeeelllleeeeeelllleEEEEehhhhhhhhllllll


DSSP  -----LLLLLLeeEEEEELL-llleeeeeellllllHHHLL--------lllEEEELL--
Query -----EGVQLFfvAQLFPLQ-ngglyicnwqghdreAGKGK--------hpqLVEIDS--  249
ident        ||                             |                ||   
Sbjct yirqkLDVQYQ-pGHNHASLtesrdadgkwlvvlskFSKDRflpvgplhpenDQLIDIsg  412
DSSP  leeeeEELLLL-eEEEEELLllllllllleeeeeelLLHHHllllllllleeEEEEELll


DSSP  -LLLEEEEELlllLLLLLLEEEEELL----------------------------------
Query -EGKVVWQLNdkvKFGXISTICPIRE----------------------------------  274
ident  | | |                  |                                   
Sbjct eEMKLVHDGP---TYAEPHDCILVRRdqiktkkiyerndpyfascraqaekdgvtlesdn  469
DSSP  lLLEEEEEEE---ELLLLLLEEEEEHhhlllllllllllhhhhhhhhhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct kvirdgnkvrvymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsme  529
DSSP  leeeelleeeeeeeeelleellleeeeellleeeeeeeelllllllleeeeelllleeee


DSSP  -------------------------------------------
Query -------------------------------------------  274
ident                                            
Sbjct ispqqtasvtftagkpgvywyycnwfchalhmemvgrmlveaa  572
DSSP  elllleeeeeeelllleeeeeellllllllhhhleeeeeeell


No 36: Query=mol1A Sbjct=1p22A Z-score=16.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct spaimlqrdfitalpargldhiaenilsyldakslcaaelvckewyrvtsdgmlwkklie   60
DSSP  lllllllllhhhhlhhhllhhhhhhhhllllhhhhhhhhhhlhhhhhhhhhllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct rmvrtdslwrglaerrgwgqylfppnsfyralypkiiqdietiesnwrcgrhslqrihcr  120
DSSP  hhhlllhhhhhhhhlllhhhhlllllhhhhhhhhhhhhhhhhhhhhlllllllllleell


DSSP  ------------lLLEEEEEllLLLEEEEEELLLLEEEEEEELLlLLLLLEEEELlLLLE
Query ------------sPQHLLVGgsGWNKIAIINKDTKEIVWEYPLEkGWECNSVAATkAGEI   48
ident               |    |    | | |  | | |                       |
Sbjct setskgvyclqydDQKIVSG-lRDNTIKIWDKNTLECKRILTGH-TGSVLCLQYD-ERVI  177
DSSP  lllllleeeeellLLEEEEE-eLLLLEEEEELLLLLEEEEELLL-LLLEEEEELL-LLEE


DSSP  EEELL-LEEEEELL-LLLEEEEEELLlLLEEEEEEELlLLLEEEEEELllEEEEEEL--L
Query LFSYS-KGAKXITR-DGRELWNIAAPaGCEXQTARILpDGNALVAWCGhpSTILEVN--X  104
ident     |           |  |              |    |          |         
Sbjct ITGSSdSTVRVWDVnTGEMLNTLIHH-CEAVLHLRFN-NGMMVTCSKD-rSIAVWDMasP  234
DSSP  EEEELlLLEEEEELlLLLEEEEELLL-LLLEEEEELL-LLEEEEEELL-lLEEEEELllL


DSSP  LLLEEEEEEELLLlllhhHLLLLLEELLLlLEEEEELLlLEEEEELL-LLLEEEEEELL-
Query KGEVLSKTEFETGierphAQFRQINKNKKgNYLVPLFAtSEVREIAP-NGQLLNSVKLS-  162
ident     |             |         |                               
Sbjct TDITLRRVLVGHR-----AAVNVVDFDDK-YIVSASGD-RTIKVWNTsTCEFVRTLNGHk  287
DSSP  LLLEEEEEELLLL-----LLEEEEEEELL-EEEEEELL-LEEEEEELlLLLEEEEEELLl


DSSP  LLLLEEEELlLLLEEEELlLLLEEEEELLLLLLEEEEEEHhhlllllLLEEEEEEELLlL
Query GTPFSSAFLdNGDCLVACgDAHCFVQLNLESNRIVRRVNAndiegvqLFFVAQLFPLQnG  222
ident                              |     |              |         
Sbjct RGIACLQYR-DRLVVSGS-SDNTIRLWDIECGACLRVLEG------hEELVRCIRFDN-K  338
DSSP  LLEEEEEEE-LLEEEEEE-LLLLEEEEELLLLLEEEEELL------lLLLEEEEELLL-L


DSSP  LEEEEEELL----------------------llllhhhlllllEEEELllllEEEEE-ll
Query GLYICNWQG----------------------hdreagkgkhpqLVEIDsegkVVWQL-nd  259
ident         |                                  |                
Sbjct RIVSGAYDGkikvwdlvaaldprapagtlclrtlvehsgrvfrLQFDE----FQIVSssh  394
DSSP  EEEEEELLLleeeeehhhhlllllllllleeeeelllllllllEEELL----LLEEElll


DSSP  LLLLlllleeeeell
Query KVKFgxisticpire  274
ident                
Sbjct DDTI-------liwd  402
DSSP  LLEE-------eeel


No 37: Query=mol1A Sbjct=3eweA Z-score=16.3

back to top
DSSP  --------llLEEEEEllLLLEEEEEELL----LLEEEEEEELLlLLLLLEEEELL---L
Query --------spQHLLVGgsGWNKIAIINKD----TKEIVWEYPLEkGWECNSVAATK---A   45
ident            |          |     |      |                        
Sbjct vhdvvydfygRHVATC-sSDQHIKVFKLDkdtsNWELSDSWRAH-DSSIVAIDWASpeyG   58
DSSP  llllllllllLEEEEE-lLLLEEEEEEELllllLEEEEEEEELL-LLLLLEEEELLlllL


DSSP  LLEEEELL-LEEEEELlLLLEEEEEELLLlLEEEEEEELLL---LLEEEEEELllEEEEE
Query GEILFSYS-KGAKXITrDGRELWNIAAPAgCEXQTARILPD---GNALVAWCGhpSTILE  101
ident   |      |  |        |                 |                    
Sbjct RIIASASYdKTVKLWE-EWNKLCTLNDSK-GSLYSVKFAPAhlgLKLACLGND--GILRL  114
DSSP  LEEEEELLlLLEEEEE-LLEEEEEELLLL-LLLLEEEELLLlllLLEEEELLL--LLLLL


DSSP  ELL--------LLLEeEEEEEllllllhhHLLLlLEELL-LLLEEEEELllLEEEEELLl
Query VNX--------KGEVlSKTEFetgierphAQFRqINKNK-KGNYLVPLFatSEVREIAPn  152
ident                 |              |             |              
Sbjct YDAlepsdlrsWTLT-SEMKV--------SDFC-LSWCPsPEKLAVSAL--EQAIIYQR-  161
DSSP  EELllllllllLLEE-LLLLL--------LLLE-EEELLlLLLEEEELL--LLEEEEEL-


DSSP  LLEEEEEELL-LLLLEEEELLL-LLEEEELLlLLEEEEELLL-LLLEeEEEEhhhlllll
Query GQLLNSVKLS-GTPFSSAFLDN-GDCLVACGdAHCFVQLNLE-SNRIvRRVNandiegvq  209
ident                |             |                              
Sbjct LHVAAKLPGHkSLIRSISWAPSyQLIATGCK-DGRIRIFKITeNLQV-ELLS--------  211
DSSP  LEEEEELLLLlLLEEEEEELLLlEEEEEEEL-LLLEEEEEELlLLLL-EEEL--------


DSSP  lLEEEEEEELL-LLLEEEEEEllllllhhhllllleEEELLL-------lLEEEeellll
Query lFFVAQLFPLQ-NGGLYICNWqghdreagkgkhpqlVEIDSE-------gKVVWqlndkv  261
ident    |           |                    |               |       
Sbjct -GEVWSVSWNLtGTILSSAGD------------dgkVRLWKAtysnefkcMSVI------  252
DSSP  -LLEEEEELLLlLLLEEEEEL------------lleEEEEEEllllleeeEEEE------


DSSP  lllllleeeeell
Query kfgxisticpire  274
ident              
Sbjct ----------taq  255
DSSP  ----------ell


No 38: Query=mol1A Sbjct=3fm0A Z-score=16.1

back to top
DSSP  llleeeeellllleeeeeelLLLEEEEE--------------------eELLL-------
Query spqhllvggsgwnkiaiinkDTKEIVWE--------------------yPLEK-------   33
ident                          |                                  
Sbjct ------------------slVLLGRVPAhpdsrcwflawnpagtllascGGDRririwgt   42
DSSP  ------------------leEEEEEELLllllleeeeeelllllleeeeELLLleeeeee


DSSP  ----------------LLLLlEEEEL-LLLLEEEELLL-EEEEELL--LLLEEEEEELLl
Query ----------------GWECnSVAAT-KAGEILFSYSK-GAKXITR--DGRELWNIAAPa   73
ident                       ||                        |           
Sbjct egdswicksvlseghqRTVR-KVAWSpCGNYLASASFDaTTCIWKKnqDFECVTTLEGH-  100
DSSP  elleeeeeeeelllllLLEE-EEEELlLLLEEEEEELLlLEEEEEEllLEEEEEEELLL-


DSSP  LLEEEEEEELLLL-LEEEEEELllEEEEEEL--lLLLEEEEEEELLLlllhhHLLLLLEE
Query GCEXQTARILPDG-NALVAWCGhpSTILEVN--xKGEVLSKTEFETGierphAQFRQINK  130
ident   |       | |           |                                   
Sbjct ENEVKSVAWAPSGnLLATCSRD-kSVWVWEVdeeDEYECVSVLNSHT-----QDVKHVVW  154
DSSP  LLLEEEEEELLLLlEEEEEELL-lLEEEEEElllLLEEEEEEELLLL-----LLEEEEEE


DSSP  L-LLLLEEEEELLlLEEEEELL---LLLEEEEEELL-LLLLEEEELLL-LLEEEELlLLL
Query N-KKGNYLVPLFAtSEVREIAP---NGQLLNSVKLS-GTPFSSAFLDN-GDCLVACgDAH  184
ident                 |                     |  | ||            |  
Sbjct HpSQELLASASYD-DTVKLYREeedDWVCCATLEGHeSTVWSLAFDPSgQRLASCS-DDR  212
DSSP  LlLLLLEEEEELL-LLEEEEEEellEEEEEEEELLLlLLEEEEEELLLlLEEEEEE-LLL


DSSP  EEEEELLL------------LLLEEEEEEHhhlllLLLLEEEEEEEL-LLLLEEEEEELl
Query CFVQLNLE------------SNRIVRRVNAndiegVQLFFVAQLFPL-QNGGLYICNWQg  231
ident                     |                             | |       
Sbjct TVRIWRQYlpgneqgvacspSWKCICTLSG-----FHSRTIYDIAWCqLTGALATACGD-  266
DSSP  LEEEEEEEllllllllllllEEEEEEEELL-----LLLLLEEEEEELlLLLLEEEEELL-


DSSP  llllhhhlllLLEEEELLL---------LLEEEEE-LLLL----------------LLLL
Query hdreagkgkhPQLVEIDSE---------GKVVWQL-NDKV----------------KFGX  265
ident                                   |                         
Sbjct ----------DAIRVFQEDpnsdpqqptFSLTAHLhQAHSqdvncvawnpkepgllASCS  316
DSSP  ----------LLEEEEEELlllllllllEEEEEEElLLLLlleeeeeelllllleeEEEE


DSSP  ---lleeeeell
Query ---isticpire  274
ident             
Sbjct ddgevafwkyqr  328
DSSP  lllleeeeeell


No 39: Query=mol1A Sbjct=2ce8A Z-score=16.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis   60
DSSP  lleeeeeeeeelleeeellllleeellllllllllllllleeeeeeeellllllleeeel


DSSP  -LLLEeeeellllLEEEEEELLL---leeeeeEELL-LLLLLLEEEELLLL-LEEEELLL
Query -SPQHllvggsgwNKIAIINKDT---keivweYPLE-KGWECNSVAATKAG-EILFSYSK   54
ident     |                                      |      |         
Sbjct nPTRH--vytggkGCVKVWDISHpgnkspvsqLDCLnRDNYIRSCKLLPDGcTLIVGGEA  118
DSSP  lLLLE--eeeellLEEEEEELLLllllllleeEELLlLLLLEEEEEELLLLlEEEEEELL


DSSP  -EEEEELLL---LLEEEEEELLllLEEEEEEELLLL-LEEEEEELllEEEEEELLL-LLE
Query -GAKXITRD---GRELWNIAAPagCEXQTARILPDG-NALVAWCGhpSTILEVNXK-GEV  108
ident              |                 | ||              |          
Sbjct sTLSIWDLAaptPRIKAELTSS-aPACYALAISPDSkVCFSCCSD--GNIAVWDLHnQTL  175
DSSP  lEEEEEELLlllLEEEEEEELL-lLLEEEEEELLLLlEEEEEELL--LLEEEEELLlLEE


DSSP  EEEEeELLLlllhhHLLLLLEELLL-LLEEEEELLlLEEEEELL-LLLEEEEEELLLLLL
Query LSKTeFETGierphAQFRQINKNKK-GNYLVPLFAtSEVREIAP-NGQLLNSVKLSGTPF  166
ident                    |                  ||      |  |         |
Sbjct VRQF-QGHT-----DGASCIDISNDgTKLWTGGLD-NTVRSWDLrEGRQLQQHDFTSQIF  228
DSSP  EEEE-LLLL-----LLEEEEEELLLlLEEEEEELL-LEEEEEELlLLLEEEEEELLLLEE


DSSP  EEEEL-LLLLEEEELLlLLEEEEELLLLlLEEEEEEHhhllllLLLEEEEEEELLL-LLE
Query SSAFL-DNGDCLVACGdAHCFVQLNLESnRIVRRVNAndiegvQLFFVAQLFPLQN-GGL  224
ident |           |          |                       |  |         
Sbjct SLGYCpTGEWLAVGME-SSNVEVLHVNK-PDKYQLHL------HESCVLSLKFAYCgKWF  280
DSSP  EEEELlLLLEEEEEEL-LLLEEEEELLL-LLEEEELL------LLLLEEEEEELLLlLEE


DSSP  EEEEELlllllhhhlllLLEEEELL---LLLEeEEELLLllllLLLEEEE----------
Query YICNWQghdreagkgkhPQLVEIDS---EGKVvWQLNDKvkfgXISTICP----------  271
ident                    |                                        
Sbjct VSTGKD-----------NLLNAWRTpygASIF-QSKESS----SVLSCDIsvddkyivtg  324
DSSP  EEEELL-----------LEEEEEELlllLEEE-EEELLL----LEEEEEEllllleeeee


DSSP  ----------ell
Query ----------ire  274
ident              
Sbjct sgdkkatvyeviy  337
DSSP  elllleeeeeeel


No 40: Query=mol1A Sbjct=3dm0A Z-score=16.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii   60
DSSP  lllllleeeellllllhhhhhhhhhhhhhhhllleeeellllhhhhhhhhhhllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct fwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkd  120
DSSP  eeehhhhhhhhhllllllllllhhhhhhllhhhhhhleelleelleeeeeelleeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd  180
DSSP  llllllllhhhhhhhhhhhhhllleeellllllhhhhhhhhhhllleeeeeelleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsav  240
DSSP  eelllhhhhhhhhhhhhhhhlllllllllhhhhhhhhhllleeeeeelhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg  300
DSSP  leeeellleelleellleeeeeeeeellllllhhhhhhhhhhllllhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa  360
DSSP  eellhhhhhhhlllhhhhhhhhhhhhleelllllhhhhhhhhhhhhhhhhhhllllhhhh


DSSP  ---------------------------------lLLEEEEELLlLLEEEEEELLL-----
Query ---------------------------------sPQHLLVGGSgWNKIAIINKDT-----   22
ident                                                |            
Sbjct laaaqtnaaaglvlkgtmrahtdmvtaiatpidnADIIVSASR-DKSIILWKLTKddkay  419
DSSP  hhhhhhhhhllleeeeeeellllleeeeelllllLLEEEEEEL-LLEEEEEELLLlllll


DSSP  LEEEEEEELLlLLLLLEEEELLL-LLEEEELLL-EEEEELL-LLLEEEEEELLlLLEEEE
Query KEIVWEYPLEkGWECNSVAATKA-GEILFSYSK-GAKXITR-DGRELWNIAAPaGCEXQT   79
ident                  |         |               |                
Sbjct GVAQRRLTGH-SHFVEDVVLSSDgQFALSGSWDgELRLWDLaAGVSTRRFVGH-TKDVLS  477
DSSP  LEEEEEEELL-LLLEEEEEELLLlLEEEEEELLlEEEEEELlLLEEEEEEELL-LLLEEE


DSSP  EEELLLL-LEEEEEELllEEEEEELLLLLEEEEEEE---LLLLllhhhLLLLLEELL---
Query ARILPDG-NALVAWCGhpSTILEVNXKGEVLSKTEF---ETGIerphaQFRQINKNK---  132
ident      |      |      ||   |  ||                               
Sbjct VAFSLDNrQIVSASRD--RTIKLWNTLGECKYTISEggeGHRD-----WVSCVRFSPntl  530
DSSP  EEELLLLlLEEEEELL--LLEEEELLLLLEEEEELLlllLLLL-----LEEEEEELLlll


DSSP  LLLEEEEELlLLEEEEELL-LLLEEEEEELL-LLLLEEEELLL-LLEEEELLLLleEEEE
Query KGNYLVPLFaTSEVREIAP-NGQLLNSVKLS-GTPFSSAFLDN-GDCLVACGDAhcFVQL  189
ident              |      |  |        |     |       |     |       
Sbjct QPTIVSASW-DKTVKVWNLsNCKLRSTLAGHtGYVSTVAVSPDgSLCASGGKDG-vVLLW  588
DSSP  LLEEEEEEL-LLLEEEEELlLLLEEEEELLLlLLEEEEEELLLlLEEEEEELLL-lLEEE


DSSP  LLLLLLEEE-------------------------eeEHHH--------LLLLL----lLE
Query NLESNRIVR-------------------------rvNAND--------IEGVQ----lFF  212
ident  |                                                          
Sbjct DLAEGKKLYsleansvihalcfspnrywlcaatehgIKIWdlesksivEDLKVdlkkvIY  648
DSSP  ELLLLEEEEllllllleeeeeellllleeeeeelleEEEEelllleeeEEELLlllllLL


DSSP  EEEEEEL-LLLLEEEEEELlllllhhhllllLEEEELlllleeeeelllllllllleeee
Query VAQLFPL-QNGGLYICNWQghdreagkgkhpQLVEIDsegkvvwqlndkvkfgxisticp  271
ident    |        |                                               
Sbjct CTSLNWSaDGSTLFSGYTD-----------gVIRVWG-----------------------  674
DSSP  EEEEEELlLLLEEEEEELL-----------lEEEEEE-----------------------


DSSP  ell
Query ire  274
ident    
Sbjct --i  675
DSSP  --l


No 41: Query=mol1A Sbjct=3ei4B Z-score=15.9

back to top
DSSP  --------------------------llleeeeellllleeeeeelllleEEEEEELLlL
Query --------------------------spqhllvggsgwnkiaiinkdtkeIVWEYPLEkG   34
ident                                                        |    
Sbjct wvglagpqilppcrsivrtlhqhklgraswpsvqqglqqsflhtldsyriLQKAAPFD-R   59
DSSP  lllllllllllllllhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhlllEEEEELLL-L


DSSP  LLLlEEEELLLL--LEEEELLLE-EEEELLL--lLEEEEEELLLLLEEEEEEELLLL--L
Query WECnSVAATKAG--EILFSYSKG-AKXITRD--gRELWNIAAPAGCEXQTARILPDG--N   87
ident     | |               |                    ||         |     
Sbjct RAT-SLAWHPTHpsTVAVGSKGGdIMLWNFGikdKPTFIKGIGAGGSITGLKFNPLNtnQ  118
DSSP  LEE-EEEELLLLllEEEEEELLLlEEEEELLlllLLEEELLLLLLLLEEELLLLLLLllE


DSSP  EEEEEELllEEEEEELLLLLEEEEEeELLLLLLhhHLLLLLEEL-LLLLEEEEELLlLEE
Query ALVAWCGhpSTILEVNXKGEVLSKTeFETGIERphAQFRQINKN-KKGNYLVPLFAtSEV  146
ident           |      ||  |               |                     |
Sbjct FYASSME--GTTRLQDFKGNILRVF-ASSDTIN--IWFCSLDVSaSSRMVVTGDNV-GNV  172
DSSP  EEEEELL--LEEEEEELLLEEEEEE-EELLLLL--LLEEEELLLlLLLEEEEEELL-LLE


DSSP  EEELLLLLEEEEEEL-LLLLLEEEEL--LLLLEEEELLlLLEEEEELLLLL----LEEEE
Query REIAPNGQLLNSVKL-SGTPFSSAFL--DNGDCLVACGdAHCFVQLNLESN----RIVRR  199
ident       |  |             |           |           |            
Sbjct ILLNMDGKELWNLRMhKKKVTHVALNpcCDWFLATASV-DQTVKIWDLRQVrgkaSFLYS  231
DSSP  EEEELLLLLLLLLLLlLLLLLEEEELllLLLEEEEELL-LLEEEEEELLLLllllLLLEE


DSSP  EEHhhlllllLLEEEEEEELLL-LLEEEEEELlllllhhhlllLLEEEELLL---LLEEE
Query VNAndiegvqLFFVAQLFPLQN-GGLYICNWQghdreagkgkhPQLVEIDSE---GKVVW  255
ident              |           |                                  
Sbjct LPH-------RHPVNAACFSPDgARLLTTDQK-----------SEIRVYSASqwdCPLGL  273
DSSP  EEL-------LLLEEEEEELLLlLLEEEEELL-----------LEEEEELLLlllLLLEE


DSSP  EELLL---llllLLLEE-------------------------------------------
Query QLNDK---vkfgXISTI-------------------------------------------  269
ident              |                                              
Sbjct IPHPHrhfqhltPIKAAwhprynlivvgrypdpnfksctpyelrtidvfdgnsgkmmcql  333
DSSP  EELLLlllllllLLLLEelllllleeeellllllllllllllllleeeelllllleeeee


DSSP  ------------EEELL------------------
Query ------------CPIRE------------------  274
ident                                    
Sbjct ydpessgisslnEFNPMgdtlasamgyhiliwsqe  368
DSSP  lllllllllleeEELLLllleeeeelleeeeelll


No 42: Query=mol1A Sbjct=3ei1B Z-score=15.9

back to top
DSSP  --------------llleeeeellllleeeeeellllEEEEEEELLLLLLLlEEEELLLL
Query --------------spqhllvggsgwnkiaiinkdtkEIVWEYPLEKGWECnSVAATKAG   46
ident                                                     |       
Sbjct gqtsilhyiyksslgqsihaqlrqclqepfirslksyKLHRTASPFDRRVT-SLEWHPTH   59
DSSP  llllhhhhhhhhhlllllhhhhhhhhhhhhhhhhlleEEEEEELLLLLLEE-EEEELLLL


DSSP  --LEEEELLL-EEEEELLLL-LEEEEEELLLL-LEEEEEEELLLL--LEEEEEELllEEE
Query --EILFSYSK-GAKXITRDG-RELWNIAAPAG-CEXQTARILPDG--NALVAWCGhpSTI   99
ident                   |       |                       |       | 
Sbjct ptTVAVGSKGgDIILWDYDVqNKTSFIQGMGPgDAITGMKFNQFNtnQLFVSSIR-gATT  118
DSSP  llEEEEEELLlLEEEEELLLlLLEEEELLLLLlLLEEEEEELLLLllEEEEEELL-lEEE


DSSP  EEELllLLEEEEEEELLLLLLhhHLLLLLEELL-LLLEEEEELlLLEEEEELLLLLEEEE
Query LEVNxkGEVLSKTEFETGIERphAQFRQINKNK-KGNYLVPLFaTSEVREIAPNGQLLNS  158
ident |               |                           |         |     
Sbjct LRDF--SGSVIQVFAKTDSWD--YWYCCVDVSVsRQMLATGDS-TGRLLLLGLDGHEIFK  173
DSSP  EEEL--LLLEEEELLLLLLLL--LLEEEEEEELlLLEEEEEEL-LLEEEEEELLLLEEEE


DSSP  EELL-LLLLEEEEL-LLLL-EEEELLlLLEEEEELLLLL----LEEEEEEHhhlllllLL
Query VKLS-GTPFSSAFL-DNGD-CLVACGdAHCFVQLNLESN----RIVRRVNAndiegvqLF  211
ident  ||         |                      |                        
Sbjct EKLHkAKVTHAEFNpRCDWlMATSSV-DATVKLWDLRNIkdknSYIAEMPH-------EK  225
DSSP  EELLlLLEEEEEEElLEEEeEEEEEL-LLEEEEEELLLLllllLEEEEEEL-------LL


DSSP  EEEEEEEL--LLLLEEEEEELlllllhhhlllLLEEEELLLL--LEEEEELLL----lll
Query FVAQLFPL--QNGGLYICNWQghdreagkgkhPQLVEIDSEG--KVVWQLNDK----vkf  263
ident  |            |                        |    |               
Sbjct PVNAAYFNptDSTKLLTTDQR-----------NEIRVYSSYDwsKPDQIIIHPhrqfqhl  274
DSSP  LEEEEEELllLLLEEEEEELL-----------LEEEEEELLLllLLLEEEELLlllllll


DSSP  lLLLEE----------------------------------------------------EE
Query gXISTI----------------------------------------------------CP  271
ident   |                                                         
Sbjct tPIKATwhpmydlivagrypddqlllndkrtidiydansgglvhqlrdpnaagiislnKF  334
DSSP  lLLLLEellllleeeeelllllllllllllleeeeellllleeeeelllllllllleeEE


DSSP  ELL------------------
Query IRE------------------  274
ident                      
Sbjct SPTgdvlasgmgfniliwnre  355
DSSP  LLLllleeeeelleeeeeeel


No 43: Query=mol1A Sbjct=2pbiD Z-score=15.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gmatdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtl   60
DSSP  llllllllllllhhhhhhhhhhhhhhhhhhhhllllllhhhhllllllllllllleeeee


DSSP  --------------llLEEEEELLlLLEEEEEELLLLEEEEEEELLlLLLLLEEEELLL-
Query --------------spQHLLVGGSgWNKIAIINKDTKEIVWEYPLEkGWECNSVAATKA-   45
ident                            |       |                  |     
Sbjct kghgnkvlcmdwckdkRRIVSSSQ-DGKVIVWDSFTTNKEHAVTMP-CTWVMACAYAPSg  118
DSSP  ellllleeeeeellllLEEEEEEL-LLEEEEEELLLLLEEEEEELL-LLLLLEEEELLLl


DSSP  LLEEEELL-LEEEEELLL--------LLEEEEEELLllLEEEEEEELLLL-LEEEEEELl
Query GEILFSYS-KGAKXITRD--------GRELWNIAAPagCEXQTARILPDG-NALVAWCGh   95
ident   |                                                  | |    
Sbjct CAIACGGLdNKCSVYPLTfdknenmaAKKKSVAMHT--NYLSACSFTNSDmQILTASGD-  175
DSSP  LEEEEELLlLEEEEEELLllllllhhHHLEEEEELL--LLEEEEEELLLLlEEEEEELL-


DSSP  lEEEEEELLL-LLEEEEEEELLllllhhHLLLLLEELL---LLLEEEEELLlLEEEEELL
Query pSTILEVNXK-GEVLSKTEFETgierphAQFRQINKNK---KGNYLVPLFAtSEVREIAP  151
ident   |        |  |             |                               
Sbjct -GTCALWDVEsGQLLQSFHGHG------ADVLCLDLAPsetGNTFVSGGCD-KKAMVWDM  227
DSSP  -LEEEEEELLlLLEEEEEELLL------LLEEEEEELLlllLLEEEEEELL-LLEEEEEL


DSSP  -LLLEEEEEE-LLLLLLEEEELLL-LLEEEELlllleeEEELL--LLLLEEEE-------
Query -NGQLLNSVK-LSGTPFSSAFLDN-GDCLVACgdahcfVQLNL--ESNRIVRR-------  199
ident   ||             |                      |                   
Sbjct rSGQCVQAFEtHESDVNSVRYYPSgDAFASGS--ddatCRLYDlrADREVAIYskesiif  285
DSSP  lLLLEEEEELlLLLLEEEEEELLLlLEEEEEE--llllEEEEEllLLEEEEEElllllll


DSSP  --------------------eEHHH----------LLLLLLLEEEEEEEL-LLLLEEEEE
Query --------------------vNAND----------IEGVQLFFVAQLFPL-QNGGLYICN  228
ident                        |           |       |  |             
Sbjct gassvdfslsgrllfagyndyTINVwdvlkgsrvsILFGHENRVSTLRVSpDGTAFCSGS  345
DSSP  leeeeeellllleeeeeelllLEEEeellllleeeEELLLLLLEEEEEELlLLLLEEEEE


DSSP  ELlllllhhhllllLEEEELlllleeeeelllllllllleeeeell
Query WQghdreagkgkhpQLVEIDsegkvvwqlndkvkfgxisticpire  274
ident |              |                              
Sbjct WD-----------hTLRVWA--------------------------  354
DSSP  LL-----------lEEEEEL--------------------------


No 44: Query=mol1A Sbjct=2wozA Z-score=15.8

back to top
DSSP  -------------LLLEEEEElllLLEEEEEELLLLEEEEE-EELLlLLLLlEEEELLLL
Query -------------SPQHLLVGgsgWNKIAIINKDTKEIVWE-YPLEkGWECnSVAATKAG   46
ident                   |                 |               |   |   
Sbjct pgylndiprhgmfVKDLILLV--nDTAAVAYDPMENECYLTaLAEQiPRNH-SSIVTQQN   57
DSSP  lllllllllllllEEEEEEEE--lLLEEEEEELLLLEEEEEeELLLlLLLE-EEEELLLL


DSSP  LEEEELL------LEEEEELLL-LLEEEEEELLLLLEeeeEEELlLLLEEEEEEL-----
Query EILFSYS------KGAKXITRD-GRELWNIAAPAGCExqtARILpDGNALVAWCG-----   94
ident                                 |            |    |         
Sbjct QVYVVGGlyvplqSYFFQLDNVsSEWVGLPPLPSARClfgLGEV-DDKIYVVAGKdlqte  116
DSSP  LEEEEELllllllLEEEEEELLlLEEEELLLLLLLLLlleEEEE-LLEEEEEEEElllll


DSSP  -LLEEEEEELLL-LLEEEEEEELLLLllhhHLLLlLEELLlLLEEEEELL------LLEE
Query -HPSTILEVNXK-GEVLSKTEFETGIerphAQFRqINKNKkGNYLVPLFA------TSEV  146
ident       |                                  |              |  |
Sbjct aSLDSVLCYDPVaAKWSEVKNLPIKV----YGHN-VISHN-GMIYCLGGKtddkkcTNRV  170
DSSP  lEEEEEEEEELLlLEEEEELLLLLLE----ELLE-EEEEL-LEEEEELLEelllllLLLE


DSSP  EEELL-LLLEEEEEE--LLLLlLEEEELLlLLEEEELLL-----LLEEEEELLLLLLEEE
Query REIAP-NGQLLNSVK--LSGTpFSSAFLDnGDCLVACGD-----AHCFVQLNLESNRIVR  198
ident     |  |              |  |    |    | |              |  |    
Sbjct FIYNPkKGDWKDLAPmkTPRSmFGVAIHK-GKIVIAGGVtedglSASVEAFDLKTNKWEV  229
DSSP  EEEELlLLEEEEELLllLLLLlLEEEEEL-LEEEEEEEEelleeEEEEEEEELLLLLEEE


DSSP  EEEHhhlllLLLLEEEEEEELLLlLEEEEEELlLLLL-hhhllLLLEEEELL-LLLEEEE
Query RVNAndiegVQLFFVAQLFPLQNgGLYICNWQgHDRE-agkgkHPQLVEIDS-EGKVVWQ  256
ident           |      |  |    ||                                 
Sbjct MTEF-----PQERSSISLVSLAG-SLYAIGGF-AMIQefapteVNDIWKYEDdKKEWAGM  282
DSSP  LLLL-----LLLLLLLEEEEELL-EEEEELLL-LLLLllllllLLLEEEEELlLLEEEEE


DSSP  ELLLlLLLLLLEEEEELL--------
Query LNDKvKFGXISTICPIRE--------  274
ident |               |         
Sbjct LKEI-RYASGASCLATRLnlfklskl  307
DSSP  ELLL-HHHLLLEEEEEEEehhhllll


No 45: Query=mol1A Sbjct=3ii7A Z-score=15.8

back to top
DSSP  -LLLEEEEE-lllllEEEEEELLLLEEEEE-EELLllLLLLEEEELLlLLEEEELLL---
Query -SPQHLLVG-gsgwnKIAIINKDTKEIVWE-YPLEkgWECNSVAATKaGEILFSYSK---   54
ident                     |           | |                         
Sbjct kHDYRIALFggsqpqSCRYFNPKDYSWTDIrCPFE-kRRDAACVFWD-NVVYILGGSqlf   58
DSSP  lLLEEEEEEllllllLEEEEELLLLEEEELlLLLL-lLLLLEEEEEL-LEEEEELLLlll


DSSP  --eeEEELL----LLLEEEEEELlllLEEEEEEELlLLLEEEEEEL-----LLEEEEEEL
Query --gaKXITR----DGRELWNIAApagCEXQTARILpDGNALVAWCG-----HPSTILEVN  103
ident                                |     |                      
Sbjct pikrMDCYNvvkdSWYSKLGPPT--pRDSLAACAA-EGKIYTSGGSevgnsALYLFECYD  115
DSSP  llleEEEEEllllEEEEEELLLL--lLLLLEEEEE-LLEEEEELLLlllllLLLLEEEEE


DSSP  L-LLLEEEEEEELLllllhhhLLLLLEELLlLLEEEEEL---------LLLEEEEELL-L
Query X-KGEVLSKTEFETgierphaQFRQINKNKkGNYLVPLF---------ATSEVREIAP-N  152
ident         |    |                 |   |                     |  
Sbjct TrTESWHTKPSMLT-----qrCSHGMVEAN-GLIYVCGGslgnnvsgrVLNSCEVYDPaT  169
DSSP  LlLLEEEEELLLLL-----llLLLEEEEEL-LEEEEELLeelllllleELLLEEEEELlL


DSSP  LLEEEEEEL-LLLL-LEEEELLlLLEEEELLL-----LLEEEEELLLLLLEEEEEEHhhl
Query GQLLNSVKL-SGTP-FSSAFLDnGDCLVACGD-----AHCFVQLNLESNRIVRRVNAndi  205
ident                    |          |                 |           
Sbjct ETWTELCPMiEARKnHGLVFVK-DKIFAVGGQnglggLDNVEYYDIKLNEWKMVSPM---  225
DSSP  LEEEEELLLlLLLLlLEEEEEL-LEEEEELLEelleeLLLEEEEELLLLEEEELLLL---


DSSP  llLLLLEEEEEEELLlLLEEEEEELlLLLLHhhllLLLEEEEL--LLLLE--eEEELlll
Query egVQLFFVAQLFPLQnGGLYICNWQgHDREAgkgkHPQLVEID--SEGKV--vWQLNdkv  261
ident                    |                    |        |          
Sbjct --PWKGVTVKCAAVG-SIVYVLAGF-QGVGR----LGHILEYNteTDKWVansKVRA---  274
DSSP  --LLLLLLLEEEEEL-LEEEEEELL-LLLLL----LLEEEEEEllLLEEEeeeEEEL---


DSSP  lLLLLLEEEEELL-
Query kFGXISTICPIRE-  274
ident        ||     
Sbjct fPVTSCLICVVDTc  288
DSSP  lLLLLLEEEEEELl


No 46: Query=mol1A Sbjct=1vyhC Z-score=15.7

back to top
DSSP  ----------------------------lLLEEeeellllleeeEEEL-----LLLEEE-
Query ----------------------------sPQHLlvggsgwnkiaIINK-----DTKEIV-   26
ident                                             |        |      
Sbjct kewiprppekyalsghrspvtrvifhpvfSVMV----sasedatIKVWdyetgDFERTLk   56
DSSP  llllllllllleeellllleeeeeellllLEEE----eeellllEEEEellllLLLEEEl


DSSP  -----------------EEEELLL---------------------LLLLlEEEELLLL-L
Query -----------------WEYPLEK---------------------GWECnSVAATKAG-E   47
ident                                                   ||     |  
Sbjct ghtdsvqdisfdhsgklLASCSADmtiklwdfqgfecirtmhghdHNVS-SVSIMPNGdH  115
DSSP  llllleeeeeellllleEEEEELLlllleeellllleeellllllLLEE-EEEELLLLlE


DSSP  EEEELL-LEEEEELLL-LLEEEEEELLlLLEEEEEEELLLL-LEEEEEELllEEEEEELl
Query ILFSYS-KGAKXITRD-GRELWNIAAPaGCEXQTARILPDG-NALVAWCGhpSTILEVNx  104
ident |      |  |      |                 |   ||                |  
Sbjct IVSASRdKTIKMWEVQtGYCVKTFTGH-REWVRMVRPNQDGtLIASCSND-qTVRVWVV-  172
DSSP  EEEEELlLEEEEEELLlLLEEEEEELL-LLLEEEEEELLLLlEEEEEELL-lLEEEEEL-


DSSP  LLLEEEEEEELLLlllhhHLLLLLEELL--------------LLLEEEEELlLLEEEEEL
Query KGEVLSKTEFETGierphAQFRQINKNK--------------KGNYLVPLFaTSEVREIA  150
ident           |            |                      |             
Sbjct ATKECKAELREHR-----HVVECISWAPessyssiseatgseGPFLLSGSR-DKTIKMWD  226
DSSP  LLLLEEEEELLLL-----LLEEEEEELLllhhhhhhhlllllLLEEEEEEL-LLEEEEEE


DSSP  L-LLLEEEEEELL-LLLLEEEELLLL-LEEEELLlLLEEEEELLLLLLEEEEEEHhhlll
Query P-NGQLLNSVKLS-GTPFSSAFLDNG-DCLVACGdAHCFVQLNLESNRIVRRVNAndieg  207
ident    |  |              |   |   |                 |     ||     
Sbjct VsTGMCLMTLVGHdNWVRGVLFHSGGkFILSCAD-DKTLRVWDYKNKRCMKTLNA-----  280
DSSP  LlLLEEEEEEELLlLLEEEEEELLLLlLEEEEEL-LLEEEEELLLLLLLLEEEEL-----


DSSP  lLLLEEEEEEELL-LLLEEEEEELlllllhhhlllLLEEEELlllleeeeelllllllll
Query vQLFFVAQLFPLQ-NGGLYICNWQghdreagkgkhPQLVEIDsegkvvwqlndkvkfgxi  266
ident     ||  |                                                   
Sbjct -HEHFVTSLDFHKtAPYVVTGSVD-----------QTVKVWE------------------  310
DSSP  -LLLLEEEEEELLlLLLEEEEELL-----------LEEEEEL------------------


DSSP  leeeeell
Query sticpire  274
ident         
Sbjct --------  310
DSSP  --------


No 47: Query=mol1A Sbjct=3iiyA Z-score=15.6

back to top
DSSP  -------------------------------LLLEeeeELLLlLEEEEEELL---LLEEE
Query -------------------------------SPQHllvGGSGwNKIAIINKD---TKEIV   26
ident                                            |                
Sbjct kckysfkcvnslkedhnqplfgvqfnwhskeGDPLvfaTVGS-NRVTLYECHsqgEIRLL   59
DSSP  llllleeeeeeeelllllleeeeeellllllLLLLeeeEEEL-LEEEEEEELlllLEEEE


DSSP  EEEEL-LLLLLLLEEEELL-----LLLEEEELLL-EEEEELL-LLLEEEEEELLlLLEEE
Query WEYPL-EKGWECNSVAATK-----AGEILFSYSK-GAKXITR-DGRELWNIAAPaGCEXQ   78
ident   |            | |              |      |               |    
Sbjct QSYVDaDADENFYTCAWTYdsntsHPLLAVAGSRgIIRIINPiTMQCIKHYVGH-GNAIN  118
DSSP  EEEELlLLLLLEEEEEEEElllllLEEEEEEELLlEEEEELLlLLLEEEEEELL-LLLEE


DSSP  EEEEL-LLLL-EEEEEELllEEEEEELLL-LLEEEEEEE--LLLLllhhhLLLLLEELLL
Query TARIL-PDGN-ALVAWCGhpSTILEVNXK-GEVLSKTEF--ETGIerphaQFRQINKNKK  133
ident        | |  |             |                                 
Sbjct ELKFHpRDPNlLLSVSKD--HALRLWNIQtDTLVAIFGGveGHRD-----EVLSADYDLL  171
DSSP  EEEELlLLLLeEEEEELL--LLEEEEELLlLEEEEEELLllLLLL-----LEEEEEELLL


DSSP  -LLEEEEELlLLEEEEELL----------------------------LLLEEEEE-ELLL
Query -GNYLVPLFaTSEVREIAP----------------------------NGQLLNSV-KLSG  163
ident                                                      |      
Sbjct gEKIMSCGM-DHSLKLWRInskrmmnaikesydynpnktnrpfisqkIHFPDFSTrDIHR  230
DSSP  lLEEEEEEL-LLLEEEEELllhhhhhhhhhhhhllhhhllllllleeELLLLEEElLLLL


DSSP  -LLLEEEELlLLLEEEELlLLLEEEEELLLL--------------LLEEEEEEHhhllll
Query -TPFSSAFLdNGDCLVACgDAHCFVQLNLES--------------NRIVRRVNAndiegv  208
ident         |     |         |                      |  |         
Sbjct nYVDCVRWL-GDLILSKS-CENAIVCWKPGKmeddidkikpsesnVTILGRFDY------  282
DSSP  lLLLEEEEE-LLEEEEEL-LLLEEEEEEELLllllhhhlllllllEEEEEEEEL------


DSSP  LLLE--eEEEEELLL-LLEEEEEellllllhhhllLLLEEEELL--------LLLEE---
Query QLFF--vAQLFPLQN-GGLYICNwqghdreagkgkHPQLVEIDS--------EGKVV---  254
ident                   |   |               |   |                 
Sbjct SQCDiwyMRFSTDFWqKMLALGN-----------qVGKLYVWDLevedphkaKCTTLthh  331
DSSP  LLLLlllLLLEELLLlLEEEEEL-----------lLLLEEEEELllllhhhlEEEEElll


DSSP  ------------------eeellLLLLlllleeeeell
Query ------------------wqlndKVKFgxisticpire  274
ident                                       
Sbjct kcgaairqtsfsrdssiliavcdDASI-----wrwdrl  364
DSSP  llllleeeeeellllleeeeeelLLEE-----eeeeel


No 48: Query=mol1A Sbjct=3gfcA Z-score=15.6

back to top
DSSP  ---------------------------------LLLEEEEEllllLEEEEEELL---LLE
Query ---------------------------------SPQHLLVGgsgwNKIAIINKD---TKE   24
ident                                  |   |  |    |   |         |
Sbjct wkkntpflydlvmthalewpsltaqwlpdvtdfSIHRLVLGthtqNHLVIASVQlpnKIE   60
DSSP  llllhhhheeeeeeeellllllleeelllllleEEEEEEEEllllEEEEEEEEEeelLEE


DSSP  EEEEEELLllLLLLEEEEL--LLLLEEEELLL-EEEEELLLL-------LEEEE-EELLl
Query IVWEYPLEkgWECNSVAAT--KAGEILFSYSK-GAKXITRDG-------RELWN-IAAPa   73
ident |      |   | |           |                                  
Sbjct IEIKINHE--GEVNRARYMpqNPCIIATKTPSsDVLVFDYTKhpskpdcNPDLRlRGHQ-  117
DSSP  EEEEEEEL--LLLLEEEEEllEEEEEEEELLLlLEEEEEHHHlllllllLLLEEeELLL-


DSSP  lLEEEEEEELL--LLLEEEEEELllEEEEEELLL--------LLEEEEEEELLllllhhH
Query gCEXQTARILP--DGNALVAWCGhpSTILEVNXK--------GEVLSKTEFETgierphA  123
ident   |       |   |  | |      ||                        |      |
Sbjct -KEGYGLSWNPnlSGHLLSASDD--HTICLWDISavpkegkvVDAKTIFTGHT------A  168
DSSP  -LLLLLEEELLllLLEEEEELLL--LLEEEEEHHhlllllleEELLEEELLLL------L


DSSP  LLLLLEEL--LLLLEEEEELlLLEEEEELL----LLLEEEEEELL-LLLLEEEEL--LLL
Query QFRQINKN--KKGNYLVPLFaTSEVREIAP----NGQLLNSVKLS-GTPFSSAFL--DNG  174
ident                                         ||           |      
Sbjct VVEDVSWHllHESLFGSVAD-DQKLMIWDTrsnnTSKPSHSVDAHtAEVNCLSFNpySEF  227
DSSP  LEEEEEELllLLLEEEEEEL-LLEEEEEELllllLLLLLEEEELLlLLEEEEEELllLLL


DSSP  LEEEELlLLLEEEEELLLLL-LEEEEEEHhhlllllLLEEEEEEELLLL--LEEEEEELL
Query DCLVACgDAHCFVQLNLESN-RIVRRVNAndiegvqLFFVAQLFPLQNG--GLYICNWQG  231
ident                 |                        |          |       
Sbjct ILATGS-ADKTVALWDLRNLkLKLHSFES------hKDEIFQVQWSPHNetILASSGTDR  280
DSSP  EEEEEE-LLLLEEEEELLLLlLLLEEELL------lLLLEEEEEELLLLllEEEEEELLL


DSSP  ---------------llllhhhlllLLEEeelllllEEEEE-LLLLLLlllleeeeell
Query ---------------hdreagkgkhPQLVeidsegkVVWQL-NDKVKFgxisticpire  274
ident                                      |                     
Sbjct rlnvwdlskigppellfihgghtakISDFswnpnepWVICSvSEDNIMqvwqmaeniyn  339
DSSP  leeeeehhhllllleeeeellllllEEEEeelllllLEEEEeELLLEEeeeeelhhhhl


No 49: Query=mol1A Sbjct=2ojhA Z-score=15.5

back to top
DSSP  llleeeeellllLEEEEEELLLLEEEEEEELLLlLLLLeEEEL-LLLLEEEELLLEEEEE
Query spqhllvggsgwNKIAIINKDTKEIVWEYPLEKgWECNsVAAT-KAGEILFSYSKGAKXI   59
ident               | | |  |                           |          
Sbjct --------gsxrSSIEIFNIRTRKXRVVWQTPE-LFEA-PNWSpDGKYLLLNSEGLLYRL   50
DSSP  --------llllEEEEEEELLLLEEEEEEEELL-LLEE-EEELlLLLEEEEEELLEEEEE


DSSP  LLL--LLEEEE--EELLllLEEEEEEELLLL-LEEEEEE--LLLEEEEEELLLLLEEEEE
Query TRD--GRELWN--IAAPagCEXQTARILPDG-NALVAWC--GHPSTILEVNXKGEVLSKT  112
ident                |          | |||             | |      |      
Sbjct SLAgdPSPEKVdtGFAT--ICNNDHGISPDGaLYAISDKveFGKSAIYLLPSTGGTPRLX  108
DSSP  ELLllLLLEELllLLLL--LLLLLLEELLLLlEEEEEELllLLLLEEEEEELLLLLLEEL


DSSP  EELLllllhhhLLLLLEEL-LLLLEEEEEL--LLLEEEEELL-LLLEeEEEEL-LLLLLE
Query EFETgierphaQFRQINKN-KKGNYLVPLF--ATSEVREIAP-NGQLlNSVKL-SGTPFS  167
ident                                             |          |    
Sbjct TKNL-------PSYWHGWSpDGKSFTYCGIrdQVFDIYSXDIdSGVE-TRLTHgEGRNDG  160
DSSP  LLLL-------LEEEEEELlLLLEEEEEEEelLEEEEEEEELlLLLE-EELLLlLLLEEE


DSSP  EEEL-LLLLEEEEL--llLLEEEEELLlLLLEEEEEEHhhlllLLLLeEEEEEEL-LLLL
Query SAFL-DNGDCLVAC--gdAHCFVQLNLeSNRIVRRVNAndiegVQLFfVAQLFPL-QNGG  223
ident      |                          | |                  |      
Sbjct PDYSpDGRWIYFNSsrtgQXQIWRVRV-DGSSVERITD-----SAYG-DWFPHPSpSGDK  213
DSSP  EEELlLLLEEEEEEllllLLEEEEEEL-LLLLEEELLL-----LLEE-EEEEEELlLLLE


DSSP  EEEEEELLLLLlhhhlllLLEEEELLL-LLEEEEELLlllLLLLLEE---EEEL------
Query LYICNWQGHDReagkgkhPQLVEIDSE-GKVVWQLNDkvkFGXISTI---CPIR------  273
ident                         |   | |         ||   |              
Sbjct VVFVSYDADVFdhprdldVRVQLXDXDgGNVETLFDL---FGGQGTXnspNWSPdgdefa  270
DSSP  EEEEEEELLLLllllleeEEEEEEELLlLLLEEEEEE---EELLLLLlllLLLLllleee


DSSP  ------l
Query ------e  274
ident        
Sbjct yvryfpv  277
DSSP  eeeelll


No 50: Query=mol1A Sbjct=1kitA Z-score=15.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn   60
DSSP  leeeeellllllllllllllleelllllleeeeeeelleeeeeeeelllleeeeelllhh


DSSP  ------------------------------------------------------llleee
Query ------------------------------------------------------spqhll    6
ident                                                             
Sbjct qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl  120
DSSP  hhhhhhhhleeeeeeeeeeeelleeleeeelleeeleeeeellllleeeeelllllleee


DSSP  eellllleeeeeelLLLE------------------------------------------
Query vggsgwnkiaiinkDTKE------------------------------------------   24
ident                                                             
Sbjct atgtaateyhkfelVFLPgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva  180
DSSP  elllllllleeeeeEEELlllleeeeeelleeeeelllleelllleeeeeelllllleee


DSSP  --------EEEEEELLLLLLLLEEEELL--LLLEEEELLL---------------EEEEE
Query --------IVWEYPLEKGWECNSVAATK--AGEILFSYSK---------------GAKXI   59
ident         |             |  |     |       |                    
Sbjct ayrdikfeIQGDVIFRGPDRIPSIVASSvtPGVVTAFAEKrvgggdpgalsntndIITRT  240
DSSP  eeeeeeeeELLEEEELLLLEEEEEEELLllLLLEEEEEEEeelllllllllleeeEEEEE


DSSP  L---LLLLEEEEEELL-------LLLEEEEEEELL-LLLEEEEEEL--------------
Query T---RDGRELWNIAAP-------AGCEXQTARILP-DGNALVAWCG--------------   94
ident                                   |     ||                  
Sbjct SrdgGITWDTELNLTEqinvsdeFDFSDPRPIYDPsSNTVLVSYARwptdaaqngdrikp  300
DSSP  ElllLLLLLLLEELLLlllllllEEEEEEEEEEELlLLEEEEEEEEeelllllhhhllll


DSSP  ---LLEEEEEELL-LLLEEEEEEEL--LLLL-----------------------------
Query ---HPSTILEVNX-KGEVLSKTEFE--TGIE-----------------------------  119
ident                |                                            
Sbjct wmpNGIFYSVYDVaSGNWQAPIDVTdqVKERsfqiagwggselyrrntslnsqqdwqsna  360
DSSP  lllLEEEEEEEELlLLEEEEEEELHhhHLLLleeeellleeeeeeeelllllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  119
ident                                                             
Sbjct kirivdgaanqiqvadgsrkyvvtlsidesgglvanlngvsapiilqsehakvhsfhdye  420
DSSP  eeeeeeelleeeeeeellleeeeeeeellllleeeeelllllleeeellhhhhllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  119
ident                                                             
Sbjct lqysalnhtttlfvdgqqittwagevsqenniqfgnadaqidgrlhvqkivltqqghnlv  480
DSSP  eeeelllleeeeeelleeeeeellllllleeeeeeelllllleeeeeeeeeeeelleeee


DSSP  ------------------------------------lhhHLLL--LLEELL---------
Query ------------------------------------rphAQFR--QINKNK---------  132
ident                                                             
Sbjct efdafylaqqtpevekdleklgwtkiktgntmslygnasVNPGpgHGITLTrqqnisgsq  540
DSSP  eeehhhhhlllllllllhhhhlleeeeeelleeeellleEELLllLLEELLlllllllll


DSSP  LLLEEEEELL------LLEEEEELL-lLLEEEEEEL---------------LLLLLEEEE
Query KGNYLVPLFA------TSEVREIAP-nGQLLNSVKL---------------SGTPFSSAF  170
ident  |    |                            |                        
Sbjct NGRLIYPAIVldrfflNVMSIYSDDggSNWQTGSTLpipfrwksssiletlEPSEADMVE  600
DSSP  LLLEEEEEEEelllleEEEEEEELLllLLLEEEEELlllleeeelleeellLEEEEEEEE


DSSP  LLLLLEEEELLL------------LLEEEEELLLLLLEEEE--EEHHHLLLLL-lLEEEE
Query LDNGDCLVACGD------------AHCFVQLNLESNRIVRR--VNANDIEGVQ-lFFVAQ  215
ident | ||| |                                     |||           | 
Sbjct LQNGDLLLTARLdfnqivngvnysPRQQFLSKDGGITWSLLeaNNANVFSNIStgTVDAS  660
DSSP  LLLLLEEEEEEElllleelleellLEEEEEELLLLLLLEEEeeEEHHHLLLLLllLLLLE


DSSP  EEELL----LLLEEEEEellllllHHHL-----LLLLEEEELL--LLLEEEEELLLLlLL
Query LFPLQ----NGGLYICNwqghdreAGKG-----KHPQLVEIDS--EGKVVWQLNDKVkFG  264
ident             |   |                    |                      
Sbjct ITRFEqsdgSHFLLFTN-----pqGNPAgtngrQNLGLWFSFDegVTWKGPIQLVNG-AS  714
DSSP  EEEEEllllLEEEEEEE-----llLLLLlllllLLLEEEEELLllLLLEEEEELLLL-LL


DSSP  LLLEEEEEL---------------------------------l
Query XISTICPIR---------------------------------e  274
ident   | |                                      
Sbjct AYSDIYQLDsenaivivetdnsnmrilrmpitllkqkltlsqn  757
DSSP  LLEEEEEEElleeeeeeelhhhleeeeeeehhhhhhhhhllll


No 51: Query=mol1A Sbjct=1n7dA Z-score=15.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct svtcksgdfscggnrcipqfwrcdgqvdcngsdeqgcppktcsqdefrchdgrqfvcdsd   60
DSSP  llllllllllllllllllllllllllllllllllllllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct rdcldgsdeascpvltcgpasfqcnsstcipqlwacdndpdcedgsdewpqrcrglyvfq  120
DSSP  llllllllllllllllllllllllllllllllllllllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gdsspcsafefhclsgecihsswrcdggpdckdksdeencavatcrpdefqcsdgncihg  180
DSSP  lllllllllllllllllllllllllllllllllllllllllllllllleeellllleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct srqcdreydckdmsdevgcvnvtlcegpnkfkchsgecitldkvcnmardcrdwsdepik  240
DSSP  llllllllllllllllllllllllllllllllllllllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ecgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnl  300
DSSP  llllllllllllllllllllllllllllllllllllllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eggykcqceegfqldphtkackavgsiaylfftnrherkmtldrseytslipnlrnvval  360
DSSP  lllllllllllllllllllllllllllllllllllllleelllllleellllllllllll


DSSP  ----LLLEEEEELLLLLEEEEEELLL---lEEEEEEELLllllLLEEEELL-LLLEEEEL
Query ----SPQHLLVGGSGWNKIAIINKDT---kEIVWEYPLEkgweCNSVAATK-AGEILFSY   52
ident                   |     |                      |       |    
Sbjct dtevASNRIYWSDLSQRMICSTQLDRahgsSYDTVISRD---iPDGLAVDWiHSNIYWTD  417
DSSP  eeelLLLEEEELLLLLLLLEEEELLLllllLLLLLLLLL---lLLLEELLLlLLLLEELL


DSSP  LL--EEEEELL-LLLEEEEEElLLLLEEEEEEELL-LLLEEEEEELLLEEEEEELLLLLE
Query SK--GAKXITR-DGRELWNIAaPAGCEXQTARILP-DGNALVAWCGHPSTILEVNXKGEV  108
ident |                       |         |  |       | |  |      |  
Sbjct SVlgTVSVADTkGVKRKTLFR-EQGSKPRAIVVDPvHGFMYWTDWGTPAKIKKGGLNGVD  476
DSSP  LLllLEEEELLlLLLEEEELL-LLLLLLLLEELLLlLLLLEELLLLLLLLEELLLLLLLL


DSSP  EEEEEELLLLllhhhLLLLLEEL-LLLLEEEEELLLLEEEEELLLL-LEEEEEE---LLL
Query LSKTEFETGIerphaQFRQINKN-KKGNYLVPLFATSEVREIAPNG-QLLNSVK---LSG  163
ident       |            |      |              |  ||              
Sbjct IYSLVTENIQ-----WPNGITLDlLSGRLYWVDSKLHSISSIDVNGgNRKTILEdekRLA  531
DSSP  LLEELLLLLL-----LLLLEEELlLLLLEEEEELLLLEEEEELLLLlLLEEELLlllLLL


DSSP  LLLEEEELlLLLEEEELLLLLEEEEELLLLLLEEEEEEHhhllllLLLEEEEEEELLL--
Query TPFSSAFLdNGDCLVACGDAHCFVQLNLESNRIVRRVNAndiegvQLFFVAQLFPLQN--  221
ident  ||| |                    |      |            |             
Sbjct HPFSLAVF-EDKVFWTDIINEAIFSANRLTGSDVNLLAE------NLLSPEDMVLFHQlt  584
DSSP  LLLLLEEE-LLEEEEELLLLLLEEEEELLLEEEEELLLL------LLLLLLLLLLLLLll


DSSP  --lleeeeeellllllhhhllllleeeellllleeeeelllllllllleeeeell
Query --gglyicnwqghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                                        
Sbjct qprgvnwcerttlsnggcqylclpapqinphspkftcacpdgmllardmrsclte  639
DSSP  llllllllllllllllllllllllllllllllllllllllllleelllllleell


No 52: Query=mol1A Sbjct=3h71B Z-score=15.3

back to top
DSSP  llleeeeellllleeeeeelLLLEEeEEEELLL------------LLLLLEEEELLLLLE
Query spqhllvggsgwnkiaiinkDTKEIvWEYPLEK------------GWECNSVAATKAGEI   48
ident                                |                      |  |  
Sbjct ----------------lpegAALTE-KTDIFESgrngkpnkdgikSYRIPALLKTDKGTL   43
DSSP  ----------------llllLLLLL-LEEEELLllllllllllllEEEEEEEEELLLLLE


DSSP  EEELL------------LEEEEELLL---LLEEEEEELLL--------------LLEEEE
Query LFSYS------------KGAKXITRD---GRELWNIAAPA--------------GCEXQT   79
ident                          |                                  
Sbjct IAGADerrlhssdwgdiGXVIRRSEDngkTWGDRVTITNLrdnpkasdpsigspVNIDXV  103
DSSP  EEEEEeellllllllleEEEEEEELLlllLLLLLEEEELLllllllllhhhlllEEEEEE


DSSP  EEELL-LLLEEEEEELL-------------------------------------------
Query ARILP-DGNALVAWCGH-------------------------------------------   95
ident     |                                                       
Sbjct LVQDPeTKRIFSIYDXFpegkgifgxssqkeeaykkidgktyqilyregekgaytireng  163
DSSP  EEELLlLLLEEEEEEEEllllhhhllllllllleeeelleeeeeeeelllllleeelhhh


DSSP  -------------------------------------------------------LEEEE
Query -------------------------------------------------------PSTIL  100
ident                                                             
Sbjct tvytpdgkatdyrvvvdpvkpaysdkgdlykgnqllgniyfttnktspfriakdsYLWXS  223
DSSP  eeellllleeeeeellllllhhhlllleeeelleeeeelllllllllleelllllEEEEE


DSSP  EELL-lLLEEEEEEEL-----lLLLLhhHLLLL--lEELL----LLLEEEEELL------
Query EVNX-kGEVLSKTEFE-----tGIERphAQFRQ--iNKNK----KGNYLVPLFA------  142
ident                                             ||  | |         
Sbjct YSDDdgKTWSAPQDITpxvkadWXKF--LGVGPgtgIVLRngphKGRILIPVYTtnnvsh  281
DSSP  EELLllLLLLLLEELHhhhlllLLLL--EEELLeelEELLllllLLLEEEEEEElllllh


DSSP  -----LLEEEEEL--LLLLEeEEEEL---------------------LLLLLEEEELLLL
Query -----TSEVREIA--PNGQLlNSVKL---------------------SGTPFSSAFLDNG  174
ident       |                                          |      | ||
Sbjct lngsqSSRIIYSDdhGKTWH-AGEAVndnrqvdgqkihsstxnnrraQNTESTVVQLNNG  340
DSSP  hhhllEEEEEEELllLLLLE-ELLLLllleeelleeelllllllhhhLEEEEEEEELLLL


DSSP  LEEEELLLL---LEEEEELLllLLEE-EEEEHHhlllLLLL--EEEEEEELL---LLLEE
Query DCLVACGDA---HCFVQLNLesNRIV-RRVNANdiegVQLF--FVAQLFPLQ---NGGLY  225
ident |                                                           
Sbjct DVKLFXRGLtgdLQVATSKDggVTWEkDIKRYP----QVKDvyVQXSAIHTXhegKEYII  396
DSSP  LEEEEEEELlleEEEEEELLllLLLLlLLEEEE----EEELllLLLEEEEEEellEEEEE


DSSP  EEEELLLLllhhhllLLLEEEELLL----LLEEEEELLLLLLLLLLEEEEEL--------
Query ICNWQGHDreagkgkHPQLVEIDSE----GKVVWQLNDKVKFGXISTICPIR--------  273
ident   |  |                  |                                   
Sbjct LSNAGGPK-----reNGXVHLARVEengeLTWLKHNPIQKGEFAYNSLQELGngeygily  451
DSSP  EEEELLLL-----leEEEEEEEEELllllEEEEEEEEEEEEELLLEEEEEEElleeeeee


DSSP  -------------------------l
Query -------------------------e  274
ident                           
Sbjct ehtekgqnaytlsfrkfnwdflskdl  477
DSSP  eelllllllleeeeeeeehhhhhlll


No 53: Query=mol1A Sbjct=3cfvB Z-score=15.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct hxaxaskexfedtveervineeykiwkkntpflydlvxthalqwpsltvqwlpevtkpeg   60
DSSP  llllllllllllhhhhhhhhhhhhhhhhhhhhheeeeeeeellllllleeeeeeeellll


DSSP  ---------------------------------------------------------lLL
Query ---------------------------------------------------------sPQ    3
ident                                                           | 
Sbjct kdyalhwlvlgthtsdeqnhlvvarvhipnddvtgkieceikinhegevnraryxpqnPH  120
DSSP  lleeeeeeeeellllllleeeeeeeeeeelllllleeeeeeeeeellllleeeeelleEE


DSSP  EEEEEllLLLEEEEEELLL----------leeeEEEELLlLLLLLEEEEL--LLLLEEEE
Query HLLVGgsGWNKIAIINKDT----------keivWEYPLEkGWECNSVAAT--KAGEILFS   51
ident                                           |           |  |  
Sbjct IIATK-tPSSDVLVFDYTKhpakpdpsgecnpdLRLRGH-QKEGYGLSWNsnLSGHLLSA  178
DSSP  EEEEE-lLLLLEEEEEHHHllllllllllllllEEEELL-LLLLLLEEELllLLLEEEEE


DSSP  LL-LEEEEELLL--------LLEEEEEELLlLLEEEEEEELLL--LLEEEEEELllEEEE
Query YS-KGAKXITRD--------GRELWNIAAPaGCEXQTARILPD--GNALVAWCGhpSTIL  100
ident                                                             
Sbjct SDdHTVCLWDINagpkegkiVDAKAIFTGH-SAVVEDVAWHLLheSLFGSVADD--QKLX  235
DSSP  LLlLLEEEEELLllllllleEELLEEELLL-LLLEEEEEELLLllLEEEEEELL--LEEE


DSSP  EELLL----lLEEEEEeELLLlllhhHLLLLLEEL--LLLLEEEEELlLLEEEEELL--L
Query EVNXK----gEVLSKTeFETGierphAQFRQINKN--KKGNYLVPLFaTSEVREIAP--N  152
ident                           |       |                |        
Sbjct IWDTRsnttsKPSHLV-DAHT-----AEVNCLSFNpySEFILATGSA-DKTVALWDLrnL  288
DSSP  EEELLlllllLLLEEE-ELLL-----LLEEEEEELllLLLEEEEEEL-LLEEEEEELllL


DSSP  LLEEEEEELL-LLLLEEEEL-LLLL-EEEELlLLLEEEEELLLLL--------------L
Query GQLLNSVKLS-GTPFSSAFL-DNGD-CLVACgDAHCFVQLNLESN--------------R  195
ident    |          |       |                  |                  
Sbjct KLKLHTFESHkDEIFQVHWSpHNETiLASSG-TDRRLNVWDLSKIgeeqsaedaedgppE  347
DSSP  LLLLEEEELLlLLEEEEEELlLLLLeEEEEE-LLLLEEEEEHHHLlllllhhhhlllllL


DSSP  EEEEEEHhhllllLLLEEEEEEELLL--LLEEEEEELlllllhhhlllLLEEEELLLlle
Query IVRRVNAndiegvQLFFVAQLFPLQN--GGLYICNWQghdreagkgkhPQLVEIDSEgkv  253
ident                          |                                  
Sbjct LLFIHGG------HTAKISDFSWNPNepWVICSVSED-----------NIXQIWQXA---  387
DSSP  EEEEELL------LLLLEEEEEELLLllLEEEEEELL-----------LEEEEEEEL---


DSSP  eeeelllllllllleeeeell
Query vwqlndkvkfgxisticpire  274
ident                      
Sbjct ---------------eniynd  393
DSSP  ---------------hhhhll


No 54: Query=mol1A Sbjct=3c99A Z-score=15.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sfddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrl   60
DSSP  lhhhhhhhhhhhhhhhhhhhhhhhheeeeeeeellllllleeeeeeeelllllleeeeee


DSSP  ----------------------------------------------------lLLEEEEE
Query ----------------------------------------------------sPQHLLVG    8
ident                                                             
Sbjct ilgthtsdeqnhlliasvqlpsedfgsvcgkieieikinhegevnrarympqnACVIATK  120
DSSP  eeellllllleeeeeeeeeeelllllllllleeeeeeeeellllleeeellllLLEEEEE


DSSP  llLLLEEEEEELLL--lEEEEEEELLlLLLLLEEEELL--LLLEEEELL-LEEEEELLLL
Query gsGWNKIAIINKDT--kEIVWEYPLEkGWECNSVAATK--AGEILFSYS-KGAKXITRDG   63
ident                              |           |  |               
Sbjct -tPSSDVLVFDYTKhpcQPDLRLRGH-QKEGYGLSWNPnlNGYLLSASDdHTICLWDINA  178
DSSP  -lLLLLEEEEELLLlllLLLEEELLL-LLLLLLEEELLllLLEEEEELLlLLEEEEELLL


DSSP  --------LEEEEEELLlLLEEEEEEELLLL--LEEEEEELllEEEEEELLL----lLEE
Query --------RELWNIAAPaGCEXQTARILPDG--NALVAWCGhpSTILEVNXK----gEVL  109
ident                                                             
Sbjct tpkehrviDAKNIFTGH-TAVVEDVAWHLLHesLFGSVADD--QKLMIWDTRnnntsKPS  235
DSSP  lllllleeLLLEEELLL-LLLEEEEEELLLLllEEEEEELL--LEEEEEELLlllllLLL


DSSP  EEEeeLLLLllhhHLLLLLEEL--LLLLEEEEELLlLEEEEELL--LLLEEEEEELL-LL
Query SKTefETGIerphAQFRQINKN--KKGNYLVPLFAtSEVREIAP--NGQLLNSVKLS-GT  164
ident              |       |                |           | |       
Sbjct HTV--DAHT----AEVNCLSFNpySEFILATGSAD-KTVALWDLrnLKLKLHSFESHkDE  288
DSSP  EEE--ELLL----LLEEEEEELllLLLEEEEEELL-LEEEEEEHhhLLLLLEEEELLlLL


DSSP  LLEEEELLLL--LEEEELlLLLEEEEELLLLL--------------LEEEEEEHhhllll
Query PFSSAFLDNG--DCLVACgDAHCFVQLNLESN--------------RIVRRVNAndiegv  208
ident  |                          |                               
Sbjct IFQVQWSPHNetILASSG-TDRRLHVWDLSKIgeeqstedaedgppELLFIHGG------  341
DSSP  EEEEEELLLLllEEEEEE-LLLLEEEEEHHHLllllllllllllllLEEEEELL------


DSSP  lLLEEEEEEELLLL--LEEEEEEllllllhhhllLLLEEeellllleeeeelllllllll
Query qLFFVAQLFPLQNG--GLYICNWqghdreagkgkHPQLVeidsegkvvwqlndkvkfgxi  266
ident             |                                               
Sbjct hTAKISDFSWNPNEpwIICSVSE-----------DNIMQ------------------vwq  372
DSSP  lLLLEEEEEELLLLllEEEEEEL-----------LLEEE------------------eee


DSSP  leeeeell
Query sticpire  274
ident         
Sbjct maenvynd  380
DSSP  elhhhlll


No 55: Query=mol1A Sbjct=2z2oC Z-score=15.3

back to top
DSSP  -----------------------lLLEEEEELLLLLEEEEEELlLLEEeEEEEL-LLLLL
Query -----------------------sPQHLLVGGSGWNKIAIINKdTKEIvWEYPL-EKGWE   36
ident                                    | |  ||     |  ||||      
Sbjct mefklqelnltnqdtgpygitvsdKGKVWITQHKANMISCINL-DGKI-TEYPLpTPDAK   58
DSSP  leeeeeeeellllllleeeeeellLLLEEEEELLLLEEEEELL-LLLE-EEEELlLLLLL


DSSP  LLEEEELLLLLEEEELL--LEEEEELLLLLEeEEEEL-LLLLEEEEEEELLLLLEEEEEE
Query CNSVAATKAGEILFSYS--KGAKXITRDGRElWNIAA-PAGCEXQTARILPDGNALVAWC   93
ident          ||  |          ||  |                     | |       
Sbjct VMCLTISSDGEVWFTENaaNKIGRITKKGII-KEYTLpNPDSAPYGITEGPNGDIWFTEM  117
DSSP  EEEEEELLLLLEEEEELllLEEEEELLLLLE-EEEELlLLLLLEEEEEELLLLLEEEEEL


DSSP  LllEEEEEELLLLLEeEEEEELLLLllhhhLLLLLEELLLLLEEEEELLLLEEEEE-lLL
Query GhpSTILEVNXKGEVlSKTEFETGIerphaQFRQINKNKKGNYLVPLFATSEVREI-aPN  152
ident      |      |      |              |                    |    
Sbjct N-gNRIGRITDDGKI-REYELPNKG----sYPSFITLGSDNALWFTENQNNAIGRIteSG  171
DSSP  L-lLEEEEELLLLLE-EEEELLLLL----lLEEEEEELLLLLEEEEELLLLEEEEEllLL


DSSP  LLEeEEEE--llLLLLEEEELLLLLEEEELlllleeEEELL-LLLLEEEEE---------
Query GQLlNSVK--lsGTPFSSAFLDNGDCLVACgdahcfVQLNL-ESNRIVRRV---------  200
ident               |                                             
Sbjct DIT-EFKIptpaSGPVGITKGNDDALWFVE-iignkIGRITtSGEITEFKIptpnarpha  229
DSSP  LEE-EEELllllLLEEEEEELLLLLEEEEE-lllleEEEELlLLLEEEEELlllllleee


DSSP  --------------------------ehHHLLLLL-lLEEEEEEELLLlLEEEEEELlll
Query --------------------------naNDIEGVQ-lFFVAQLFPLQNgGLYICNWQghd  233
ident                                                             
Sbjct itagagidlwftewgankigrltsnniiEEYPIQIksAEPHGICFDGE-TIWFAMEC---  285
DSSP  eeellllleeeeelllleeeeeehhheeEEEELLLllLLEEEEEELLL-EEEEEELL---


DSSP  llhhhllllLEEEELLllleeeeelllllllllleeeeell
Query reagkgkhpQLVEIDSegkvvwqlndkvkfgxisticpire  274
ident                                          
Sbjct --------dKIGKLTL-------------------ikdnme  299
DSSP  --------lEEEEEEE-------------------elllll


No 56: Query=mol1A Sbjct=1w8nA Z-score=15.2

back to top
DSSP  llleeeeellllleeeeeellLLEEeEEEELLL------LLLLLEEEELLLLLEEEELL-
Query spqhllvggsgwnkiaiinkdTKEIvWEYPLEK------GWECNSVAATKAGEILFSYS-   53
ident                                                 |  |  | ||  
Sbjct -------------------gePLYT-EQDLAVNgregfpNYRIPALTVTPDGDLLASYDg   40
DSSP  -------------------llLLEE-EEEEEELllllllLEEEEEEEELLLLLEEEEEEe


DSSP  -----------LEEEEELLL---LLEEEEEELLL-------LLEEEEEEELL-LLLEEEE
Query -----------KGAKXITRD---GRELWNIAAPA-------GCEXQTARILP-DGNALVA   91
ident                    |                     |            |     
Sbjct rptgigapgpnSILQRRSTDggrTWGEQQVVSAGqttapikGFSDPSYLVDReTGTIFNF  100
DSSP  lllllllllllEEEEEEELLlllLLLLLEEEELLlllllllEEEEEEEEELLlLLLEEEE


DSSP  EEL--------------------LLEEEEEEL-LLLLEeEEEEEL------lLLLLhhHL
Query WCG--------------------HPSTILEVN-XKGEVlSKTEFE------tGIERphAQ  124
ident                                        |            |       
Sbjct HVYsqrqgfagsrpgtdpadpnvLHANVATSTdGGLTW-SHRTITaditpdpGWRS--RF  157
DSSP  EEEelllllllllllllllllllLEEEEEEELlLLLLL-EEEELHhhlllllLLLE--EE


DSSP  LLL--LEELL----LLLEEEEELL------LLEEEEEL---LLLLEeEEEELL--LLLLE
Query FRQ--INKNK----KGNYLVPLFA------TSEVREIA---PNGQLlNSVKLS--GTPFS  167
ident                |                 |                          
Sbjct AASgeGIQLRygphAGRLIQQYTIinaagaFQAVSVYSddhGRTWR-AGEAVGvgMDENK  216
DSSP  ELLeeLEELLllllLLLEEEEEEEelllllEEEEEEEElllLLLLE-ELLLLLllLLLEE


DSSP  EEELLLLLEEEELLLL-----LEEEEELLllLLEEEEEEHHhllllLLLE---eEEEEEL
Query SAFLDNGDCLVACGDA-----HCFVQLNLesNRIVRRVNANdiegvQLFF---vAQLFPL  219
ident    |  |  |    |                                |      |     
Sbjct TVELSDGRVLLNSRDSarsgyRKVAVSTDggHSYGPVTIDR-----DLPDptnnASIIRA  271
DSSP  EEELLLLLEEEEELLLlllleEEEEEELLllLLLLLLEEEE-----EEELllllLEEEEL


DSSP  ---------LLLLEEEEEELllLLLHhhllLLLEEEELL-lLLEEEEELLLLLLLLLLEE
Query ---------QNGGLYICNWQghDREAgkgkHPQLVEIDS-eGKVVWQLNDKVKFGXISTI  269
ident              |   |                                       || 
Sbjct fpdapagsaRAKVLLFSNAA-sQTSR---sQGTIRMSCDdgQTWPVSKVFQPGSMSYSTL  327
DSSP  llllllllhHHHLEEEEEEL-lLLLL---eEEEEEEELLllLLLLEEEEEEEEELLLEEE


DSSP  EEELL-------------------------------------------------------
Query CPIRE-------------------------------------------------------  274
ident                                                             
Sbjct TALPDgtygllyepgtgiryanfnlawlggicapftipdvalepgqqvtvpvavtnqsgi  387
DSSP  EELLLlleeeeelllleeeeeeelhhhhlllllleellleeelllleeeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct avpkpslqldaspdwqvqgsveplmpgrqakgqvtitvpagttpgryrvgatlrtsagna  447
DSSP  llllleeeeellllleeeeeellllllleeeeeeeeellllllleeeeeeeeeellllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct sttftvtvglldqarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphr  507
DSSP  eeeeeeeellllhhhleeeeelllllllllllhhhhhllllllleellllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct isldlggthtisglqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqrav  567
DSSP  eeeeeeeeeeeeeeeeeelllllllllleeeeeeelllllleeeeeeeellllllleeee


DSSP  ----------------------------------
Query ----------------------------------  274
ident                                   
Sbjct fpardaryirlvalseqtghkyaavaelevegqr  601
DSSP  eeeeeeeeeeeeelllllllllleeeeeeeeell


No 57: Query=mol1A Sbjct=3fcsA Z-score=15.0

back to top
DSSP  llleeeeellllleeeeeelLLLEEEE-----------------------EEELL-----
Query spqhllvggsgwnkiaiinkDTKEIVW-----------------------EYPLE-----   32
ident                                                             
Sbjct --------------lnldpvQLTFYAGpngsqfgfsldfhkdshgrvaivVGAPRtlgps   46
DSSP  --------------llllllLLEEEELlllllllleeeeeellllleeeeEEELLlllll


DSSP  ------------------------------------------LLLL-llEEEELLLlLEE
Query ------------------------------------------KGWE-cnSVAATKAgEIL   49
ident                                                  ||       | 
Sbjct qeetggvflcpwraeggqcpsllfdlrdetrnvgsqtlqtfkARQGlgaSVVSWSD-VIV  105
DSSP  llllleeeeeelllleeellllllllllleeeelleeeeeelLLLLlllEEEEELL-EEE


DSSP  EELLL------------------EEEEELL-LLLEeEEEELL------------------
Query FSYSK------------------GAKXITR-DGRElWNIAAP------------------   72
ident                                 ||                          
Sbjct ACAPWqhwnvlekteeaektpvgSCFLAQPeSGRR-AEYSPCrgntlsriyvendfswdk  164
DSSP  EEELLleeeeeelleelllllllEEEEEELlLLEE-EEELLLlllllhhhhhhlllllll


DSSP  LLLEE-EEEEELLLLLEEEEEELLL---EEEEEELLLLL--------------EEEEEEE
Query AGCEX-QTARILPDGNALVAWCGHP---STILEVNXKGE--------------VLSKTEF  114
ident   ||          |       |                                |    
Sbjct RYCEAgFSSVVTQAGELVLGAPGGYyflGLLAQAPVADIfssyrpgillwhvsSQSLSFD  224
DSSP  LLLLLlLEEEELLLLEEEEEELLHHhhlLEEEEEEHHHHhhhlllllllllllLLEELLL


DSSP  L--lLLLLhhHLLLLLEELLL------LLEEEEELLL----LEEEEELLLLLEEEEEEL-
Query E--tGIERphAQFRQINKNKK------GNYLVPLFAT----SEVREIAPNGQLLNSVKL-  161
ident                              | |           |       | |      
Sbjct SsnpEYFD-gYWGYSVAVGEFdgdlntTEYVVGAPTWswtlGAVEILDSYYQRLHRLRGe  283
DSSP  LllhHHLL-lLLLLEEEEELLllllllLEEEEEELLHhhhlLEEEEELLLLLEEEEEELl


DSSP  --LLLL-LEEEELL-----LLLEEEELLLL------------LEEEEELL----LLLL-E
Query --SGTP-FSSAFLD-----NGDCLVACGDA------------HCFVQLNL----ESNR-I  196
ident         | |  |       | ||                                   
Sbjct qmASYFgHSVAVTDvngdgRHDLLVGAPLYmesradrklaevGRVYLFLQprgpHALGaP  343
DSSP  llLLLLlLEEEEELlllllLLEEEEEELLLeeeelleeeeelLEEEEELLllllLLLLlL


DSSP  EEEEEHHhlllLLLLE-EEEEEELLL------LLEEEEEELlllllhhHLLLLLEEEELL
Query VRRVNANdiegVQLFF-VAQLFPLQN------GGLYICNWQghdreagKGKHPQLVEIDS  249
ident                       ||                             |      
Sbjct SLLLTGT----QLYGRfGSAIAPLGDldrdgyNDIAVAAPY-----ggPSGRGQVLVFLG  394
DSSP  LEEEELL----LLLLLlLLEEEEEELllllllLEEEEEELL-----llLLLLLEEEEELE


DSSP  -----LLLEEEEELLLLL--LLLLLEEEE-------------------------------
Query -----EGKVVWQLNDKVK--FGXISTICP-------------------------------  271
ident             |                                               
Sbjct qseglRSRPSQVLDSPFPtgSAFGFSLRGavdiddngypdlivgayganqvavyraqpvv  454
DSSP  elleeLLLLLEEEELLLLllLLLLLLEEEeelllllllleeeeeehhhleeeeellllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct kasvqllvqdslnpavkscvlpqtktpvscfniqmcvgatghnipqklslnaelqldrqk  514
DSSP  eeeeeeeelllllllllleelllllleeeeeeeeeeeeeelllllllleeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct prqgrrvlllgsqqagttlnldlggkhspichttmaflrdeadfrdklspivlslnvslp  574
DSSP  lhhhlleeelllllleeeeeeellllllleeeeeeeeellhhhllllllleeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct pteagmapavvlhgdthvqeqtrivldcgeddvcvpqlqltasvtgspllvgadnvlelq  634
DSSP  lllllllllleeeelleeeeeellllllllllllllleeeeeeeellleelllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct mdaanegegayeaelavhlpqgahymralsnvferlicnqkkenetrvvlcelgnpmkkn  694
DSSP  eeeeellllllleeeeeelllleeeeeeeellllllleeeelllllleeeeeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct aqigiamlvsvgnleeagesvsfqlqirsknsqnpnskivlldvpvraeaqvelrgnsfp  754
DSSP  eeeeeeeeeeelllllllleeeeeeeeellllllllllleeeeeeeelllleeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct aslvvaaswgpkvehtyelhnngpgtvnglhlsihlpgqsqpsdllyildiqpqgglqcf  814
DSSP  leeeelllllleeeeeeeeeellllleeeeeeeeeeelllllllleeeeeeeeellleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct pqppvnplkvddpvlvscdsapctvvqcdlqemargqramvtvlaflwlpslyqrpldqf  874
DSSP  eelllllllllleeeelllllleeeeeeeeeeelllleeeeeeeeeelhhhhllllllee


DSSP  ----------------------------------ell
Query ----------------------------------ire  274
ident                                      
Sbjct vlqshawfnvsslpyavpplslprgeaqvwtqllrac  911
DSSP  eeeeeeeeeeeellllllllllleeeeeeeeeeeell


No 58: Query=mol1A Sbjct=1sliA Z-score=15.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns   60
DSSP  lllleeeeeeeeeellllleellllllhhhhllllleeeeeeeeellllleeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa  120
DSSP  lllllleeeeeeeelllleeeeeeellllleeeeeelllllleelleelleeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn  180
DSSP  lleeeeeelleeeeeeellllllhhhllllleeeelleeelleeelllleeeeeeeeell


DSSP  ----------------------------------------llLEEEEEL-----------
Query ----------------------------------------spQHLLVGG-----------    9
ident                                                             
Sbjct alsdeeliqatgvttygenifyagdvtesnyfripslltlstGTVISAAdaryggthdsk  240
DSSP  lllhhhhhhhhllllllllllllllllllleeeeeeeeelllLLEEEEEeeellllllll


DSSP  lllLEEEEEELL--lLEEEEEEELL-------------------------LLLLLLEEEE
Query sgwNKIAIINKD--tKEIVWEYPLE-------------------------KGWECNSVAA   42
ident    |       |          ||                                    
Sbjct skiNIAFAKSTDggnTWSEPTLPLKfddyiaknidwprdsvgknvqiqgsASYIDPVLLE  300
DSSP  lleEEEEEEELLlllLLLLLEEEELllllllllllllllllhhhllllllLEEEEEEEEE


DSSP  LL-LLLEEEELL------------------------------------------------
Query TK-AGEILFSYS------------------------------------------------   53
ident  |    |                                                     
Sbjct DKlTKRIFLFADlmpagigssnasvgsgfkevngkkylklrwhkdagraydytirekgvi  360
DSSP  LLlLLLEEEEEEeelllllhhhlllllleeeelleeeeeeeellllllllleeelhhhee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   53
ident                                                             
Sbjct yndatnqptefrvdgeynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvf  420
DSSP  eelllleeeeeeellllleeelleeleeeeeeeeeelleeeeeeeeeeeellllllllle


DSSP  ------LEEEEELL----LLLEEEEEE-----lLLLLEEEE-EEELL-----LLLEEEEE
Query ------KGAKXITR----DGRELWNIA-----aPAGCEXQT-ARILP-----DGNALVAW   92
ident         |             |                              |  ||  
Sbjct kafptnYLAMRYSDdegaSWSDLDIVSsfkpevSKFLVVGPgIGKQIstgenAGRLLVPL  480
DSSP  eellllEEEEEEELllllLLLLLEELHhhllllLLEEEELLeELEELlllllLLLEEEEE


DSSP  EL---LLEEEEEEL-LLLLEeEEEEELLLLLLHhHLLLlLEELL--LLLEEEEELLL-LE
Query CG---HPSTILEVN-XKGEVlSKTEFETGIERPhAQFRqINKNK--KGNYLVPLFAT-SE  145
ident                         |                                   
Sbjct YSkssAELGFMYSDdHGDNW-TYVEADNLTGGA-TAEA-QIVEMpdGSLKTYLRTGSnCI  537
DSSP  EEellLLEEEEEELlLLLLL-EEEELLLLLLLL-LLLE-EEEELllLLEEEEELLLLlLL


DSSP  EEEEL----LLLLEEEEE-ELLL----LLLEEEELLL-----LLEEEELLLL------LE
Query VREIA----PNGQLLNSV-KLSG----TPFSSAFLDN-----GDCLVACGDA------HC  185
ident                      |     |  |                    |        
Sbjct AEVTSidggETWSDRVPLqGISTtsygTQLSVINYSQpidgkPAIILSSPNAtngrknGK  597
DSSP  EEEEEllllLLLLLLEELlLLLLllllLLLEEEEEEEeelleEEEEEEEELLllllllEE


DSSP  EEEELLL----------LLLEEEEEEHHhllllLLLEEEEEEELLLLLEEEEEEL--LLL
Query FVQLNLE----------SNRIVRRVNANdiegvQLFFVAQLFPLQNGGLYICNWQ--GHD  233
ident                  |                      |  |  |             
Sbjct IWIGLVNdtgntgidkySVEWKYSYAVD--tpqMGYSYSCLAELPDGQVGLLYEKydSWS  655
DSSP  EEEEEEEellllhhhleEEEEEEEEELL--lllLLLLLEEEEELLLLLEEEEEELllLLL


DSSP  L-LHHHLLLLLEEEELLLLleeeeelllllllllleeeeell
Query R-EAGKGKHPQLVEIDSEGkvvwqlndkvkfgxisticpire  274
ident | |                                       
Sbjct RnELHLKDILKFEKYSISE------------------ltgqa  679
DSSP  LlLLLLLLLEEEEEELHHH------------------hllll


No 59: Query=mol1A Sbjct=3hfqA Z-score=15.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct xqerilfgtytkktsqgiyqgtldttaktltndgllaatqnptylalsakdclysvdked   60
DSSP  leeeeeeeellllllleeeeeeeelllleeeeeeeeeelllllleeelllleeeeeeeel


DSSP  -----------------------------------LLLEEEEELLLLLEEEEEEL---LL
Query -----------------------------------SPQHLLVGGSGWNKIAIINK---DT   22
ident                                      |                      
Sbjct deggiaawqidgqtahklntvvapgtppayvavdeARQLVYSANYHKGTAEVXKIaadGA  120
DSSP  leeeeeeeeeelleeeeeeeeeeellllleeeeelLLLEEEEEELLLLEEEEEEElllLL


DSSP  LEEEEEEELLL--------LLLLLEEEELLLLLEEEELL--LEEEEELLL----LLEEEE
Query KEIVWEYPLEK--------GWECNSVAATKAGEILFSYS--KGAKXITRD----GRELWN   68
ident                    |        |                           |   
Sbjct LTLTDTVQHSGhgprpeqdGSHIHYTDLTPDNRLAVIDLgsDKVYVYNVSdagqLSEQSV  180
DSSP  EEEEEEEELLLllllllllLLLEEEEEELLLLLEEEEELllLEEEEEEELllllEEEEEE


DSSP  EELLLLLEEEEEEELLLL-LEEEEEELLlEEEEEELL---LLLEEEEEEE---llLLLLh
Query IAAPAGCEXQTARILPDG-NALVAWCGHpSTILEVNX---KGEVLSKTEF---etGIERp  121
ident     ||         |||  |  |                                    
Sbjct LTXEAGFGPRHLVFSPDGqYAFLAGELSsQIASLKYDtqtGAFTQLGIVKtipadYTAH-  239
DSSP  EELLLLLLEEEEEELLLLlEEEEEELLLlEEEEEEEElllLEEEEEEEEElllllLLLL-


DSSP  hHLLLLLEELLL-LLEEEEELLLLEEEEELL----LLLEEEEEEL-LLLLLEEEELLLL-
Query hAQFRQINKNKK-GNYLVPLFATSEVREIAP----NGQLLNSVKL-SGTPFSSAFLDNG-  174
ident       |          |           |        |          |          
Sbjct -NGAAAIRLSHDgHFLYVSNRGYNTLAVFAVtadgHLTLIQQISTeGDFPRDFDLDPTEa  298
DSSP  -LEEEEEEELLLlLEEEEEEELLLEEEEEEElhhhLEEEEEEEELlLLLLLEEEELLLLl


DSSP  LEEEELLLLLEEEEELLL----LLLEEEEEEHhhlllllLLEEEEEEELLllleeeeeel
Query DCLVACGDAHCFVQLNLE----SNRIVRRVNAndiegvqLFFVAQLFPLQngglyicnwq  230
ident    |                                            |           
Sbjct FVVVVNQNTDNATLYARDltsgKLSLLQKDVT-------VPEGVCVRFLE----------  341
DSSP  EEEEEELLLLEEEEEEELllllLEEEEEEEEE-------LLLEEEEEELL----------


DSSP  lllllhhhllllleeeellllleeeeelllllllllleeeeell
Query ghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                             
Sbjct --------------------------------------------  341
DSSP  --------------------------------------------


No 60: Query=mol1A Sbjct=3h6jA Z-score=15.0

back to top
DSSP  -------LLLEeeeellllleeeeeelllleEEEEEELLLLLLLLEEEEL-LLLLEEEEL
Query -------SPQHllvggsgwnkiaiinkdtkeIVWEYPLEKGWECNSVAAT-KAGEILFSY   52
ident                                                         |   
Sbjct mntyfdiPHRL--------------------VGKALYESYYDHFGQMDILsDGSLYLIYR   40
DSSP  lllllllLLLL--------------------LLLEELLLLEEEEEEEEELlLLLEEEEEE


DSSP  ----------LLEEEEELL--LLLEEEEEELL--LLLEEEEEEELLLLLEEEEEEL---L
Query ----------SKGAKXITR--DGRELWNIAAP--AGCEXQTARILPDGNALVAWCG---H   95
ident                              |               | |    |       
Sbjct ratehvggsdGRVVFSKLEggIWSAPTIVAQAggQDFRDVAGGTMPSGRIVAASTVyetG  100
DSSP  eellllllllLEEEEEEEEllEELLLEEEELLllLLEEEEEEEELLLLLEEEEEEElllL


DSSP  LEEEEEEL-LLLLEEEEEEELL-LLLLhhhLLLLLEELLL-LLEEEEELL----LLEEEE
Query PSTILEVN-XKGEVLSKTEFET-GIERphaQFRQINKNKK-GNYLVPLFA----TSEVRE  148
ident                 |      |                         |          
Sbjct EVKVYVSDdSGVTWVHKFTLARgGADY--nFAHGKSFQVGaRYVIPLYAAtgvnYELKWL  158
DSSP  EEEEEEELlLLLLLEEEEEELLlLLLE--eEELLLLEEELlEEEEEEEEEelleEEEEEE


DSSP  ELL----LLLEEEEEEL--LLLLLEEEELLL--LLEEEELLLLL----EEEEELLL--LL
Query IAP----NGQLLNSVKL--SGTPFSSAFLDN--GDCLVACGDAH----CFVQLNLE--SN  194
ident                          |           ||               |     
Sbjct ESSdggeTWGEGSTIYSgnTPYNETSYLPVGdgVILAVARVGSGaggaLRQFISLDdgGT  218
DSSP  EELllllLLEEEEEEEEelLLEEEEEEEEEEllEEEEEEEELLLllllEEEEEELLllLL


DSSP  LEEEEEEhhHLLLLL--lLEEEEEEELLL------LLEEEEEELlllllhhhlLLLLEEE
Query RIVRRVNanDIEGVQ--lFFVAQLFPLQN------GGLYICNWQghdreagkgKHPQLVE  246
ident                     ||                                |     
Sbjct WTDQGNV--TAQNGDstdILVAPSLSYIYseggtpHVVLLYTNR--------tTHFCYYR  268
DSSP  LEEEEEL--EELLLLlllLEEEEEEEEEEllllleEEEEEEEEL--------lLLEEEEE


DSSP  ELL---------LLLEEEEELLLLllLLLLEEEEEL------------------------
Query IDS---------EGKVVWQLNDKVkfGXISTICPIR------------------------  273
ident                               |                             
Sbjct TILlaravagssGWTERVPAYSAP-aASGYTSQVVLggrrilgnlfretssttsgayqfe  327
DSSP  EEEhhhhhhlleEELLLEEEEELL-lLLEEEEEEEEllleeeeeeeeeeelleeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct vylggvpdfesdwfsvssnslytlshglqrsprrvvvefarssspstwnivmpsyfndgg  387
DSSP  ellllllleellleeeellleeeeelllllllleeeeeeelllllllleellleeeelll


DSSP  --------------------------------------------------l
Query --------------------------------------------------e  274
ident                                                    
Sbjct hkgsgaqvevgslnirlgtgaavwgtgyfggidnsattrlatgyyrvrawi  438
DSSP  eeeeleeeeellleeeeeellllllllllllllllhhhllleeeeeeeeel


No 61: Query=mol1A Sbjct=2eceA Z-score=14.9

back to top
DSSP  ----------------lLLEEEEELLLL-------LEEEEEELL-----LLEEEEEEEL-
Query ----------------sPQHLLVGGSGW-------NKIAIINKD-----TKEIVWEYPL-   31
ident                       |              ||             ||    | 
Sbjct rdptfypspkmamkappEDLAYVACLYTgtginraDFIAVVDVNpksetYSKIVHKVELp   60
DSSP  llllllllhhhhhllllLLEEEEEEELLlllllllLEEEEEELLlllllLLLEEEEEELl


DSSP  LLLLLLLEEEEL--------------LLLLEEEELL--LEEEEELLL------LLEEEEE
Query EKGWECNSVAAT--------------KAGEILFSYS--KGAKXITRD------GRELWNI   69
ident     |                                      |                
Sbjct YINDELHHFGWNacssalcpngkpniERRFLIVPGLrsSRIYIIDTKpnprepKIIKVIE  120
DSSP  LLLLLLLLLEELllhhhhllllllllLLLEEEEELLllLLEEEEELLllllllEEEEEEL


DSSP  --ELLL---lLEEEEEEELLLlLEEEEEEL-----LLEEEEEELL-LLLEEEEEE--ELL
Query --AAPA---gCEXQTARILPDgNALVAWCG-----HPSTILEVNX-KGEVLSKTE--FET  116
ident               |    ||        |      |  ||       | | | |     
Sbjct peEVKKvsgySRLHTVHCGPD-AIYISALGneegeGPGGILMLDHySFEPLGKWEidRGD  179
DSSP  hhHHHHhhleEEEEEEEELLL-LEEEEEEEellllLLLEEEEELLlLLLEEEELLllLLL


DSSP  LLllhhhLLLLLEELL-LLLEEEEEL------------------LLLEEEEELL-LLLEE
Query GIerphaQFRQINKNK-KGNYLVPLF------------------ATSEVREIAP-NGQLL  156
ident               |                                             
Sbjct QY-----LAYDFWWNLpNEVLVSSEWavpntiedglklehlkdrYGNRIHFWDLrKRKRI  234
DSSP  LL-----LLLLEEEELlLLEEEELLLllhhhhllllllllhhhhLLLEEEEEELlLLEEE


DSSP  EEEEL---LLLLLEEEELLL---LLEEEEL---------lllleeeeellLLLLEEEE--
Query NSVKL---SGTPFSSAFLDN---GDCLVAC---------gdahcfvqlnlESNRIVRR--  199
ident  |  |            |                                     |    
Sbjct HSLTLgeeNRMALELRPLHDptkLMGFINMvvslkdlsssiwlwfyedgkWNAEKVIEip  294
DSSP  EEEELlllEEEEEEEEELLLlllLEEEEEEeeellllleeeeeeeeelleEEEEEEEEel


DSSP  -----------------------------------------eEHHH-------------L
Query -----------------------------------------vNAND-------------I  205
ident                                                             
Sbjct aeplegnlpeilkpfkavpplvtdidislddkflylslwgigEVRQydisnpfkpvltgK  354
DSSP  leellllllhhhhhhleelllllleeellllleeeeeellllEEEEeellllllleeeeE


DSSP  LLLL---------------lLEEEeEEELL-LLLEEEEEELL--LLLL-HHHLlllLEEE
Query EGVQ---------------lFFVAqLFPLQ-NGGLYICNWQG--HDRE-AGKGkhpQLVE  246
ident                          |         |  |      |      |     | 
Sbjct VKLGgifhradhpaghkltgAPQM-LEISRdGRRVYVTNSLYstWDNQfYPEGlkgWMVK  413
DSSP  EELLllllllllllllllllLLLL-EEELLlLLEEEEELLLLhhHHHHhLLLLlllEEEE


DSSP  ELL----LLLEE--EEELLLLllLLLLEEEEEL----------l
Query IDS----EGKVV--WQLNDKVkfGXISTICPIR----------e  274
ident                                             
Sbjct LNAnpsgGLEIDkeFFVDFGE--ARSHQVRLSGgdassdsycyp  455
DSSP  EEEllllLEEEEeeEEEELLL--LEEEEEEELLlllllllllll


No 62: Query=mol1A Sbjct=3jroA Z-score=14.9

back to top
DSSP  ----------------------------------------------------------lL
Query ----------------------------------------------------------sP    2
ident                                                             
Sbjct hnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvdwahpkfG   60
DSSP  lllleeeelllllllleeeeellleeeeeeeelleeeeeeeelllllleeeeeelllllL


DSSP  LEEEEELlLLLEEEEEELL--LLEEEEEEELLlLLLLLEEEEL---LLLLEEEELL-LEE
Query QHLLVGGsGWNKIAIINKD--TKEIVWEYPLEkGWECNSVAAT---KAGEILFSYS-KGA   56
ident   |        |  |                      |||           |   |    
Sbjct TILASCS-YDGKVLIWKEEngRWSQIAVHAVH-SASVNSVQWApheYGPLLLVASSdGKV  118
DSSP  LEEEEEE-LLLLEEEEEEEllEEEEEEEELLL-LLLEEEEEELlhhHLLEEEEEELlLEE


DSSP  EEELLL----LLEEEEEELLllLEEEEEEELLL-----LLEEEEEELllEEEEEELL---
Query KXITRD----GRELWNIAAPagCEXQTARILPD-----GNALVAWCGhpSTILEVNX---  104
ident                  |         |   |                            
Sbjct SVVEFKengtTSPIIIDAHA--IGVNSASWAPAttkesRKFVTGGAD--NLVKIWKYnsd  174
DSSP  EEEELLllllLLLEEEELLL--LLEEEEEELLLllhhhLLEEEEELL--LLEEEEEEell


DSSP  --LLLEEEEEEELLllllhhHLLLLLEELL----LLLEEEEELLlLEEEEELL-----LL
Query --KGEVLSKTEFETgierphAQFRQINKNK----KGNYLVPLFAtSEVREIAP-----NG  153
ident        |  |            |                                    
Sbjct aqTYVLESTLEGHS------DWVRDVAWSPtvllRSYLASVSQD-RTCIIWTQdneqgPW  227
DSSP  llEEEEEEEELLLL------LLEEEEEELLllllLEEEEEEELL-LLEEEEEElllllLL


DSSP  LEEEEE--ELLLLLLEEEEL-LLLLEEEELlLLLEEEEELLL---LLLEEEEEE------
Query QLLNSV--KLSGTPFSSAFL-DNGDCLVACgDAHCFVQLNLE---SNRIVRRVN------  201
ident         |                                           |       
Sbjct KKTLLKeeKFPDVLWRASWSlSGNVLALSG-GDNKVTLWKENlegKWEPAGEVHidnakl  286
DSSP  LLLLLLllLLLLLLLLEEELlLLLLEEEEL-LLLLEELLLLLlllLLLLLLLLLlllhhh


DSSP  hhhllllllLEEEeEEELLLLLEEEEeellllllhhhLLLLlEEEELLL-----------
Query andiegvqlFFVAqLFPLQNGGLYICnwqghdreagkGKHPqLVEIDSE-----------  250
ident                       |              ||                     
Sbjct ixkerrftaSYTF-AKFSTGSXLLTK--------divGKSG-VSIKRLPtelqrkflfdd  336
DSSP  hhhllllllLLLL-LLLLLLLLLLEE--------lllLLLL-EELLLLLllllllhhhlh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  250
ident                                                             
Sbjct vyldkeiekvtiearksnpypqisessllfkdaldyxektssdynlwklssilfdpvsyp  396
DSSP  hhhhhhhlleeeeelllllleeeeeelllhhhhhlllllllhhhhhhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  250
ident                                                             
Sbjct yktdndqvkxallkkerhcrltswivsqigpeieekirnssneieqiflylllndvvras  456
DSSP  lllllllhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllllhhhhhhlllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  250
ident                                                             
Sbjct klaiesknghlsvlisylgsndprirdlaelqlqkwstggcsidkniskiykllsgspfe  516
DSSP  hhhhhllllhhhhhhhhlllllhhhhhhhhhhhhhhhlllllllhhhhhhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  250
ident                                                             
Sbjct glfslkelesefswlcllnltlcygqideysleslvqshldkfslpyddpigvifqlyaa  576
DSSP  lllllhhhhllllhhhhhhhhhhllllllllhhhhhhhhhlllllllllhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  250
ident                                                             
Sbjct nenteklykevrqrtnaldvqfcwyliqtlrfngtrvfsketsdeatfafaaqlefaqlh  636
DSSP  lllhhhhhhhhhlllllllhhhhhhhhhhllllllllllhhhhhhhhhhhhhhhhhlllh


DSSP  -----------------------------------------lleeeeellllllllllee
Query -----------------------------------------gkvvwqlndkvkfgxisti  269
ident                                                             
Sbjct ghslfvscflnddkaaedtikrlvxreitllrastndhilnrlkipsqlifnaqalkdry  696
DSSP  hhhhhhhhllllhhhhhhhhhhhhhhllllllllllllllllllllhhhhhhhhhhhhhh


DSSP  eeell
Query cpire  274
ident      
Sbjct egnyl  701
DSSP  hhhhl


No 63: Query=mol1A Sbjct=3elqB Z-score=14.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct agfkpappagqlgavivdpygnapltalvdldshvisdvkvtvhgkgekgveisypvgqe   60
DSSP  lllllllllllllleeelllllllleeeeelllllleeeeeeellllllllleeeeelhh


DSSP  --------------------------llleeeeellllleeeeeelllleeeeeeELLLl
Query --------------------------spqhllvggsgwnkiaiinkdtkeivweyPLEKg   34
ident                                                             
Sbjct slktydgvpifglyqkfankvtvewkengkvmkddyvvhtsaivnnymdnrsisdLQQTk  120
DSSP  hhhhhleeeeelllllleeeeeeeeeelleeeeeeeeeellllllllllllllllLLEEe


DSSP  lllleeeellLLLEEEEL----------------------------------lLEEEEEL
Query wecnsvaatkAGEILFSY----------------------------------sKGAKXIT   60
ident                                                           | 
Sbjct vikvapgfedRLYLVNTHtftaqgsdlhwhgekdknagildagpatgalpfdiAPFTFIV  180
DSSP  eeeellllllLEEEEEEEellllllllleelllllllllllllleelllllllEEEEEEE


DSSP  L--LLLEEEEE--ELLL--------LLEEEEEEELLLLLEEEEEElllEEEEEELLLLLE
Query R--DGRELWNI--AAPA--------GCEXQTARILPDGNALVAWCghpSTILEVNXKGEV  108
ident         |                       |  | |              |    | |
Sbjct DteGEYRWWLDqdTFYDgrdrdinkRGYLMGIRETPRGTFTAVQG---QHWYEFDMMGQV  237
DSSP  LllLLEEEELLhhHLLLlllllhhhLLLLEEEEELLLLLEEEEEL---LEEEEELLLLLE


DSSP  EEEEEELLLLllhhHLLLLLEELLLLLEEEEEL--------------LLLEEEEELLLLL
Query LSKTEFETGIerphAQFRQINKNKKGNYLVPLF--------------ATSEVREIAPNGQ  154
ident |       |                |  |                        |    | 
Sbjct LEDHKLPRGF---aDATHESIETPNGTVLLRVGksnyrrddgvhvttIRDHILEVDKSGR  294
DSSP  EEEEELLLLE---eLLLLLEEELLLLLEEEEEEelleellllleellLLLEEEEELLLLL


DSSP  EEEEEEL-----------------------------------------------LLLLLE
Query LLNSVKL-----------------------------------------------SGTPFS  167
ident       |                                                    |
Sbjct VVDVWDLtkildpkrdallgaldagavlahagqqaklepdtpfgdalgvgpgrnWAHVNS  354
DSSP  EEEEEELlllllllllllhhhlllllllllllllllllllllllllllllllllLLLEEE


DSSP  EEEL-LLLLEEEELLLLlEEEEELLlLLLEEEEEEH-----------HHLL---------
Query SAFL-DNGDCLVACGDAhCFVQLNLeSNRIVRRVNA-----------NDIE---------  206
ident  |                  |                                       
Sbjct IAYDaKDDSIILSSRHQ-GVVKIGR-DKQVKWILAPskgwekplaskLLKPvdangkpit  412
DSSP  EEEElLLLEEEEEELLL-EEEEEEL-LLLEEEEELLlllllllhhhhLLEElllllllll


DSSP  -----------LLLLLEEEEEEELLLLLEEEEEELLL--LLLH--hHLLLLLEEEELLL-
Query -----------GVQLFFVAQLFPLQNGGLYICNWQGH--DREA--gKGKHPQLVEIDSE-  250
ident                           | | |                 |    ||     
Sbjct cnenglcensdFDFTYTQHTAWISSKGTLTIFDNGDGrhLEQPalpTMKYSRFVEYKIDe  472
DSSP  lllllllllllLLLLLLLEEEEELLLLLEEEEELLLLhhHLLLlllLLLLLEEEEEEEEl


DSSP  ----LLEEEEE-LLLL-LLLL--LLEEEEELL----------------------------
Query ----GKVVWQL-NDKV-KFGX--ISTICPIRE----------------------------  274
ident        ||         |     | |                                 
Sbjct kkgtVQQVWEYgKERGyDFYSpiTSIIEYQADrntmfgfggsihlfdvgqptvgklneid  532
DSSP  llleEEEEEEElHHHHhHHLLllLLEEEEELLlleeeeeeeeellllllleeeeeeeeee


DSSP  ----------------------------------
Query ----------------------------------  274
ident                                   
Sbjct yktkevkveidvlsdkpnqthyrallvrpqqmfk  566
DSSP  llllleeeeeeeeeeeellleeeeeeelhhhhll


No 64: Query=mol1A Sbjct=3dw8B Z-score=14.8

back to top
DSSP  -------------------------------llLEEEEELlLLLEEEEEELL------LL
Query -------------------------------spQHLLVGGsGWNKIAIINKD------TK   23
ident                                    |  |        |            
Sbjct ndiqwcfsqvkgavdddvaeadiistvefnhsgELLATGD-KGGRVVIFQQEqshsrgEY   59
DSSP  llllleeeellllllllllhhhleeeeeellllLEEEEEE-LLLEEEEEEELllllllLE


DSSP  EEEEEE-ELLL----------LLLLLEEEELLL----LLEEEELLLEEEEELL-------
Query EIVWEY-PLEK----------GWECNSVAATKA----GEILFSYSKGAKXITR-------   61
ident          |               |              |    |  |           
Sbjct NVYSTFqSHEPefdylksleiEEKINKIRWLPQknaaQFLLSTNDKTIKLWKIserdkrp  119
DSSP  EEEEEEeLLLLeeehhhleeeLLLLLEEEELLLllllEEEEEELLLLEEEEEEeeeeeee


DSSP  -------------------------LLLEEEEEELLLLLEEEEEEELLLL-LEEEEEEll
Query -------------------------DGRELWNIAAPAGCEXQTARILPDG-NALVAWCgh   95
ident                                  |           |  |    | |    
Sbjct egynlkpttvttlrvpvfrpmdlmvEASPRRIFANAHTYHINSISINSDYeTYLSADD--  177
DSSP  ellllllllllllllleeeeeeeeeEEEEEEEELLLLLLLLLEEEELLLLlEEEEELL--


DSSP  lEEEEEELLLLL-EEEEEEELLL--lllhhHLLLLLEELL--lLLEEEEELlLLEEEEEL
Query pSTILEVNXKGE-VLSKTEFETG--ierphAQFRQINKNK--kGNYLVPLFaTSEVREIA  150
ident    |                                                    |   
Sbjct -LRINLWHLEITdRSFNIVDIKPanmeeltEVITAAEFHPnscNTFVYSSS-KGTIRLCD  235
DSSP  -LEEEEEELLEEeEEEEEEELLLllhhhllLLEEEEEELLlllLEEEEEEL-LLLEEEEE


DSSP  L----LLLE-EEEEE--------lLLLLLEEEEL-LLLLEEEELllLLEEEEELLLLL-L
Query P----NGQL-LNSVK--------lSGTPFSSAFL-DNGDCLVACgdAHCFVQLNLESN-R  195
ident                                 |                     |    |
Sbjct MrasaLCDRhSKLFEeprsffseiISSISDVKFShSGRYMMTRD--YLSVKVWDLNMEnR  293
DSSP  LllllLLLLlLEEELllllhhhhhLLLEEEEEELlLLLEEEEEE--LLEEEEEELLLLlL


DSSP  EEEEEEHHH----------llllllLEEEeEEELLL-LLEEE------------------
Query IVRRVNAND----------iegvqlFFVAqLFPLQN-GGLYI------------------  226
ident  |                                                          
Sbjct PVETYQVHEylrsklcslyendcifDKFE-CCWNGSdSVVMTgsynnffrmfdrntkrdi  352
DSSP  LLLLEELLHhhlllhhhhhhllhhhLLLL-EEELLLlLEEEEelllleeeeeelllllee


DSSP  -----------------------------eeellllLLHHhllllLEEEelllllEEEEE
Query -----------------------------cnwqghdREAGkgkhpQLVEidsegkVVWQL  257
ident                                                             
Sbjct tleasrennkprtvlkprkvcasgkrkkdeisvdslDFNK--kilHTAW--hpkeNIIAV  408
DSSP  eeelllllllllllllllleellllllllleehhhlLLLL--lllEEEE--llllLEEEE


DSSP  LLLLLLlllleeeeell
Query NDKVKFgxisticpire  274
ident                  
Sbjct ATTNNL----yifqdkv  421
DSSP  ELLLLE----eeeelll


No 65: Query=mol1A Sbjct=3f3fA Z-score=14.8

back to top
DSSP  llleeeeellllleeeeeelllleeEEEEELLLLLLLlEEEEL-LLLLEEEELL-LEEEE
Query spqhllvggsgwnkiaiinkdtkeiVWEYPLEKGWECnSVAAT-KAGEILFSYS-KGAKX   58
ident                                        |             |    | 
Sbjct -----------------------hmQPFDSGHDDLVH-DVVYDfYGRHVATCSSdQHIKV   36
DSSP  -----------------------llLLEELLLLLLEE-EEEELlLLLEEEEEELlLEEEE


DSSP  ELL-----LLLEEEEEELLlLLEEEEEEELLL---LLEEEEEELllEEEEEEL-------
Query ITR-----DGRELWNIAAPaGCEXQTARILPD---GNALVAWCGhpSTILEVN-------  103
ident                  |                      |        |          
Sbjct FKLdkdtsNWELSDSWRAH-DSSIVAIDWASPeygRIIASASYD-kTVKLWEEdpdqeec   94
DSSP  EEElllllLEEEEEEEELL-LLLEEEEEELLHhhlLEEEEEELL-lLEEEEEElllllll


DSSP  -lLLLEEEEEEELLLlllhhHLLLLLEEL---LLLLEEEEELlLLEEEEELL-------L
Query -xKGEVLSKTEFETGierphAQFRQINKN---KKGNYLVPLFaTSEVREIAP-------N  152
ident          |                                     |            
Sbjct sgRRWNKLCTLNDSK-----GSLYSVKFApahLGLKLACLGN-DGILRLYDAlepsdlrS  148
DSSP  llLLEEEEEEELLLL-----LLEEEEEELlhhHLLEEEEEEL-LLEEEEEELlllllllL


DSSP  LLEEEEEELL--------llLLEEEELL----LLLEEEELLllLEEEEELLL---LLLEE
Query GQLLNSVKLS--------gtPFSSAFLD----NGDCLVACGdaHCFVQLNLE---SNRIV  197
ident   |    |             |               |                      
Sbjct WTLTSEMKVLsippanhlqsDFCLSWCPsrfsPEKLAVSAL--EQAIIYQRGkdgKLHVA  206
DSSP  LEEEEEEELLllllllllllLEEEEELLllllLLEEEEEEL--LEEEEEEELlllLEEEE


DSSP  EEEEHhhllllLLLEEEEEEELLL-----LLEEEEEELlllllhhhlllLLEEEELL---
Query RRVNAndiegvQLFFVAQLFPLQN-----GGLYICNWQghdreagkgkhPQLVEIDS---  249
ident                                                             
Sbjct AKLPG------HKSLIRSISWAPSigrwyQLIATGCKD-----------GRIRIFKItek  249
DSSP  EELLL------LLLLEEEEEELLLlllllEEEEEEELL-----------LLEEEEEEeel


DSSP  -------LLLEeEEELL--------------------LLLLL--------llleeeeell
Query -------EGKVvWQLND--------------------KVKFG--------xisticpire  274
ident        |                                                    
Sbjct lqsnlqvELLS-EHDDHngevwsvswnltgtilssagDDGKVrlwkatysnefkcmsvit  308
DSSP  lllleeeEEEE-EELLLllleeeeeelllllleeeeeLLLLEeeeeellllleeeeeeel


No 66: Query=mol1A Sbjct=3ijeA Z-score=14.6

back to top
DSSP  -------------------------------LLLEEEEELLLL----------lEEEEEE
Query -------------------------------SPQHLLVGGSGW----------nKIAIIN   19
ident                                |   ||||                     
Sbjct fnldvdspaeysgpegsyfgfavdffvpsasSRMFLLVGAPKAnttqpgiveggQVLKCD   60
DSSP  lllllllleeeellllllllleeeeelllllLLLEEEEEELLLlllllllllllEEEEEE


DSSP  LL-LLEEeEEEE----------------lLLLLL-LLEEEELLlLLEEEELLL-------
Query KD-TKEIvWEYP----------------lEKGWE-CNSVAATKaGEILFSYSK-------   54
ident    |                                 ||       ||            
Sbjct WSsTRRC-QPIEfdatgnrdyakddplefKSHQWfGASVRSKQ-DKILACAPLyhwrtem  118
DSSP  LLlLLLE-EELLllllllleeelleeleeLLLLLlLLEEEEEL-LEEEEEELLleellll


DSSP  --------EEEEELlLLLEEEEEEL---------LLLLEE-EEEEELLLLLEEEEEELLL
Query --------GAKXITrDGRELWNIAA---------PAGCEX-QTARILPDGNALVAWCGHP   96
ident                                      |              |    |  
Sbjct kqerepvgTCFLQD-GTKTVEYAPCrsqdidadgQGFCQGgFSIDFTKADRVLLGGPGSF  177
DSSP  llllllllEEEEEE-LLEEEEELLLlllllllllLLLLLLlLEEEELLLLEEEEEELLHH


DSSP  ---EEEEEELLLLL--------------EEEEEEEL-lLLLLhhHLLLLLEELLL-----
Query ---STILEVNXKGE--------------VLSKTEFE-tGIERphAQFRQINKNKK-----  133
ident                                 |                           
Sbjct ywqGQLISDQVAEIvskydpnvysikynNQLATRTAqaIFDD-sYLGYSVAVGDFngdgi  236
DSSP  hhlLEEEEEEHHHHhhhlllllllllllLLEELLLLlhHHLL-lLLLLEEEEELLlllll


DSSP  LLEEEEELLL----LEEEEELL-LLLEEEEEEL---LLLL-LEEEELL-----LLLEEEE
Query GNYLVPLFAT----SEVREIAP-NGQLLNSVKL---SGTP-FSSAFLD-----NGDCLVA  179
ident                 |      |   |             || |  |       |    
Sbjct DDFVSGVPRAartlGMVYIYDGkNMSSLYNFTGeqmAAYFgFSVAATDingddYADVFIG  296
DSSP  LEEEEEELLHhhhlLEEEEELLlLLLEEEEEELlllLLLLlLEEEEELlllllLLEEEEE


DSSP  LLLL------------LEEEEELLL---LLLEeEEEEHHhllllLLLEEEEEEELLL---
Query CGDA------------HCFVQLNLE---SNRIvRRVNANdiegvQLFFVAQLFPLQN---  221
ident                                     |          |     ||     
Sbjct APLFmdrgsdgklqevGQVSVSLQRasgDFQT-TKLNGF---evFARFGSAIAPLGDldq  352
DSSP  ELLLeeellllleeelLEEEEEELLlllLLEE-EEEELL---llLLLLLLEEEEEELlll


DSSP  ---LLEEEEEELlllllHHHLLLLlEEEELL-------LLLE------------------
Query ---GGLYICNWQghdreAGKGKHPqLVEIDS-------EGKV------------------  253
ident        |             |                                      
Sbjct dgfNDIAIAAPY----gGEDKKGI-VYIFNGrstglnaVPSQilegqwaarsmppsfgys  407
DSSP  lllLEEEEEELL----lLLLLLLE-EEEEEEelleellLLLEeeellllllllllleeee


DSSP  ---------------eeeelLLLLL-----------------------------------
Query ---------------vwqlnDKVKF-----------------------------------  263
ident                                                             
Sbjct mkgatdidkngypdlivgafGVDRAilyrarpvitvnaglevypsilnqdnktcslpgta  467
DSSP  eeeeelllllllleeeeeehHHLEEeeelllleeeeeeeeeellleelllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct lkvscfnvrfclkadgkgvlprklnfqvellldklkqkgairralflysrspshsknmti  527
DSSP  llleeeeeeeeeeeellllllleeeeeeeeeelhhhhlllllleeelllllleeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct srgglmqceeliaylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanis  587
DSSP  ellllleeeeeeeeelllllllllllleeeeeeeeellllllllllllleelllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct rqahilldcgednvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsi  647
DSSP  eeeeellllllllllllleeeeeelllleeelllleeeeeeeeeeelllleelleeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct plqadfigvvrnnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsem  707
DSSP  llleeeeeelllllllllleeeeelllllleeeeellleelllleeeeeeeeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct dtsvkfdlqiqssnlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpe  767
DSSP  lleeeeeeeeellllllllllleeeeeeeelllleeeeeeellleeelllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct teedvgpvvqhiyelrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdme  827
DSSP  llllllleeeeeeeeeellllllleeeeeeeeeeelllllleeeeeeeeelleeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct inplrikissldihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnh  887
DSSP  lllllllllllllleellllleeeeeeeeelllllleeeeeeeeeeelhhhhllllllll


DSSP  ----------------------------------------lllleeeeell
Query ----------------------------------------gxisticpire  274
ident                                                    
Sbjct syslkssasfnviefpyknlpieditnstlvttnvtwgiqpapmpvpvwvi  938
DSSP  leeeeeeeeeeeeelllllllllleeeeeeeeeeeelllllllllllllll


No 67: Query=mol1A Sbjct=1dilA Z-score=14.5

back to top
DSSP  llleeeeellllleeeeeelllleeEEEEELLL-----------------------LLLL
Query spqhllvggsgwnkiaiinkdtkeiVWEYPLEK-----------------------GWEC   37
ident                                                             
Sbjct -----------------------tvEKSVVFKAegehftdqkgntivgsgsggttkYFRI   37
DSSP  -----------------------llLEEEEELLlllleellllleellllhhhlllEEEE


DSSP  LEEEELLLLLEEEELLL-------------EEEEELLLL-LEEEE-EELL-------LLL
Query NSVAATKAGEILFSYSK-------------GAKXITRDG-RELWN-IAAP-------AGC   75
ident      |  | |                    |   |  |                     
Sbjct PAMCTTSKGTIVVFADArhntasdqsfidtAAARSTDGGkTWNKKiAIYNdrvnsklSRV   97
DSSP  EEEEELLLLLEEEEEEEellllllllleeeEEEEELLLLlLLEEEeEELLlllllllLEE


DSSP  EEEEEEELL---LLLEEEEEEL-------------------LLEEEEEELL-lLLEEEE-
Query EXQTARILP---DGNALVAWCG-------------------HPSTILEVNX-kGEVLSK-  111
ident    |            ||                                          
Sbjct MDPTCIVANiqgRETILVMVGKwnnndktwgayrdkapdtdWDLVLYKSTDdgVTFSKVe  157
DSSP  EEEEEEEEEellEEEEEEEEEEellllllhhhlllllllllLEEEEEEELLllLLLEELl


DSSP  EEEL------lLLLLhhHLLLL--LEEL-LLLLEEEEELL--------LLEEEEEL--LL
Query TEFE------tGIERphAQFRQ--INKN-KKGNYLVPLFA--------TSEVREIA--PN  152
ident |           |                                               
Sbjct TNIHdivtkngTISA--MLGGVgsGLQLnDGKLVFPVQMVrtknittvLNTSFIYStdGI  215
DSSP  LLHHhhhhhhlLEEE--EEELLeeLEELlLLLEEEEEEEEelllllllEEEEEEEEllLL


DSSP  LLEEE-EEEL-LLLLLEEEELlLLLEEEELLLL-LEEEEELLLLL-LEEE---EEEHhhl
Query GQLLN-SVKL-SGTPFSSAFLdNGDCLVACGDA-HCFVQLNLESN-RIVR---RVNAndi  205
ident    |        |         |                                     
Sbjct TWSLPsGYCEgFGSENNIIEF-NASLVNNIRNSgLRRSFETKDFGkTWTEfppMDKK---  271
DSSP  LLLLLlLLEElLLLLEEEEEE-LLEEEEEELLLlLLLLEEELLLLlLLEElllLLLL---


DSSP  llLLLL---EEEEEEELLL---LLEEEEEELLlLLLHhhllLLLEEEELL-LLLEEEEEL
Query egVQLF---FVAQLFPLQN---GGLYICNWQGhDREAgkgkHPQLVEIDS-EGKVVWQLN  258
ident   |                           |             |       | |     
Sbjct --VDNRnhgVQGSTITIPSgnkLVAAHSSAQN-KNNDytrsDISLYAHNLySGEVKLIDD  328
DSSP  --LLLLlllLLLEEEEEEElleEEEEEEEELL-LLLLllllLEEEEEELLlLLLEEEEEE


DSSP  -LLLL----lLLLLEEEEELL--------------------------------
Query -DKVK----fGXISTICPIRE--------------------------------  274
ident              |                                       
Sbjct fYPKVgnasgAGYSCLSYRKNvdketlyvvyeangsiefqdlsrhlpviksyn  381
DSSP  eELLLlllllLLLEEEEEEEElleeeeeeeeeelleeeeeelhhhhhhhhlll


No 68: Query=mol1A Sbjct=2hesX Z-score=14.5

back to top
DSSP  --------------------llLEEEEELlLLLEEEEEELL--LLEEEEEEELL-lLLLL
Query --------------------spQHLLVGGsGWNKIAIINKD--TKEIVWEYPLE-kGWEC   37
ident                         |  |     ||                         
Sbjct sinlikslklykekiwsfdfsqGILATGS-TDRKIKLVSVKydDFTLIDVLDETahKKAI   59
DSSP  lleeeeeeellllleeeeeeelLEEEEEE-LLLLEEEEELLllLLEEEEEELLLllLLLE


DSSP  LEEEEL-LLLLEEEELL-LEEEEELL-LLLEEEEEElllllEEEEEEELLLL-LEEEEEE
Query NSVAAT-KAGEILFSYS-KGAKXITR-DGRELWNIAapagcEXQTARILPDG-NALVAWC   93
ident  |||                           |  |      |        ||        
Sbjct RSVAWRpHTSLLAAGSFdSTVSIWAKfEMDLLAIIE-----EVKGVAWSNDGyYLATCSR  114
DSSP  EEEEELlLLLEEEEEELlLLEEEEELlLLEEEEEEL-----LEEEEEELLLLlEEEEEEL


DSSP  LllEEEEEELL-----LLLEEEEEEELLllllhhHLLLLLEELL-LLLEEEEELLlLEEE
Query GhpSTILEVNX-----KGEVLSKTEFETgierphAQFRQINKNK-KGNYLVPLFAtSEVR  147
ident                   |  |                                    ||
Sbjct D--KSVWIWETdesgeEYECISVLQEHS------QDVKHVIWHPsEALLASSSYD-DTVR  165
DSSP  L--LLEEEEELlllllLLEEEEEELLLL------LLEEEEEELLlLLEEEEEELL-LLEE


DSSP  EE----llLLLEEEEEELLLLLLEEEELLL---LLEEEELlllleeEEELLL--------
Query EI----apNGQLLNSVKLSGTPFSSAFLDN---GDCLVACgdahcfVQLNLE--------  192
ident                    ||  || |                   |             
Sbjct IWkdydddWECVAVLNGHEGTVWSSDFDKTegvFRLCSGS--ddstVRVWKYmgddeddq  223
DSSP  EEeeelleEEEEEEELLLLLLEEEEEELLLlllLEEEEEE--llllEEEEEEeeelllll


DSSP  ---LLLEEE------------------------eeEHHH------------LLLLLL--L
Query ---SNRIVR------------------------rvNAND------------IEGVQL--F  211
ident                                                             
Sbjct qewVCEAILpdvhkrqvynvawgfngliasvgadgVLAVyeevdgewkvfaKRALCHgvY  283
DSSP  eeeEEEEELllllllleeeeeellllleeeeelllLEEEeeeelleeeeeeEELLLLllL


DSSP  EEEEEEELLllLEEEEEELlllllhhhllllLEEEELLllleeeeelllllllllleeee
Query FVAQLFPLQngGLYICNWQghdreagkgkhpQLVEIDSegkvvwqlndkvkfgxisticp  271
ident        |    |                                               
Sbjct EINVVKWLT--ILATGGDD-----------gIVNFWSL----------------------  308
DSSP  LEEEEEELL--LEEEEELL-----------lEEEEEEL----------------------


DSSP  ell
Query ire  274
ident    
Sbjct ---  308
DSSP  ---


No 69: Query=mol1A Sbjct=3k6sA Z-score=14.4

back to top
DSSP  llleeeeellllleeeeeellLLEE----------------EEEE--ELLL---------
Query spqhllvggsgwnkiaiinkdTKEI----------------VWEY--PLEK---------   33
ident                                           |       |         
Sbjct --------------fnldteeLTAFrvdsagfgdsvvqyanSWVVvgAPQKitaanqtgg   46
DSSP  --------------lllllllLEEEllllllllleeeelllLEEEeeLLLLlllllllll


DSSP  -------------------------LLLLlEEEELL-LLLEEEELLL-------------
Query -------------------------GWECnSVAATK-AGEILFSYSK-------------   54
ident                               | | |      |                  
Sbjct lyqcgystgacepiglqvppeavnmSLGL-SLASTTsPSQLLACGPTvhhecgrnmyltg  105
DSSP  eeeeelllleeeellllllllllllLLLL-EEEEELlLLEEEEEELLleelllllleell


DSSP  EEEEELlLLLEEEEE---------------------------------------------
Query GAKXITrDGRELWNI---------------------------------------------   69
ident                                                             
Sbjct LCFLLG-PTQLTQRLpvsrqecprqeqdivflidgsgsissrnfatmmnfvravisqfqr  164
DSSP  EEEEEL-LLLLLLLLllllllllllleeeeeeeelllllllhhhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   69
ident                                                             
Sbjct pstqfslmqfsnkfqthftfeefrrssnplsllasvhqlqgftytataiqnvvhrlfhas  224
DSSP  lleeeeeeeellleeeeellhhhhllllhhhhllllllllllllhhhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   69
ident                                                             
Sbjct ygarrdaakilivitdgkkegdsldykdvipmadaagiiryaigvglafqnrnswkelnd  284
DSSP  llllllleeeeeeeellllllllllhhhhhhhhhhhleeelleelllhhhlllllhhhhl


DSSP  -------------------------------------------elLLLLEE-EEEEELlL
Query -------------------------------------------aaPAGCEX-QTARILpD   85
ident                                                       |     
Sbjct iaskpsqehifkvedfdalkdiqnqlkekifaiegtettssssfeLEMAQEgFSAVFT-P  343
DSSP  llllllllllllllllhhhhlllllhhhhhhllllllllllllllLLLLLLlLLEELL-L


DSSP  LLEEEEEELLL---EEEEEELLLlLEEEEEEEL---lLLLLhhHLLLLLEELLL---LLE
Query GNALVAWCGHP---STILEVNXKgEVLSKTEFE---tGIERphAQFRQINKNKK---GNY  136
ident         |                                                   
Sbjct DGPVLGAVGSFtwsGGAFLYPPN-MSPTFINMSqenvDMRD-sYLGYSTELALWkgvQSL  401
DSSP  LLLEEEELLLLlllLEEEELLLL-LLLEEELLLllllLLLL-lLLLLLEELLLLlllLEE


DSSP  EEEELLL---LEEEEELL---LLLEEEEEEL----LLLLLEEEELLL------LLEEEEL
Query LVPLFAT---SEVREIAP---NGQLLNSVKL----SGTPFSSAFLDN------GDCLVAC  180
ident                             |      |    |    |          |   
Sbjct VLGAPRYqhtGKAVIFTQvsrQWRMKAEVTGtqigSYFGASLCSVDVdsdgstDLVLIGA  461
DSSP  EEEELLHhhlLEEEEEELlllLLLEEEEELLllllLLLLLLEEEELLllllllLEEEEEL


DSSP  LLL------LEEEEELLL----LLLEE--EEEEHHhllllLLLEEEEEEELLL------L
Query GDA------HCFVQLNLE----SNRIV--RRVNANdiegvQLFFVAQLFPLQN------G  222
ident                 |                          | | |  |         
Sbjct PHYyeqtrgGQVSVCPLPrgwrRWWCDavLYGEQG---hpWGRFGAALTVLGDvngdklT  518
DSSP  LLLllllllLLEEEEELLllllLLLLLllLLLLLL---llLLLLLLLEEEEELllllllL


DSSP  LEEEEEELlllLLHHhlllLLEEEELL------LLLEEEEEL-LLLL---llLLLEEEE-
Query GLYICNWQghdREAGkgkhPQLVEIDS------EGKVVWQLN-DKVK---fgXISTICP-  271
ident    |        |                                               
Sbjct DVVIGAPG--eEENR----GAVYLFHGvlgpsiSPSHSQRIAgSQLSsrlqyFGQALSGg  572
DSSP  EEEEELLL--lLLLL----LLEEEEELllllllLLLLLLLLLlLLLLlllllEEEEEEEl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct qdltqdglvdlavgargqvlllrtrpvlwvgvsmqfipaeiprsafecreqvvseqtlvq  632
DSSP  llllllllleeeeeellleeeeelllllleeeeeeelllllllllllllllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct sniclyidkrsknllgsrdlqssvtldlaldpgrlspratfqetknrslsrvrvlglkah  692
DSSP  eeeeeeelllllllllllllleeeeeeeeellllllllleelllllleeeeeeeelllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct cenfnlllpscvedsvtpitlrlnftlvgkpllafrnlrpmlaadaqryftaslpfeknc  752
DSSP  eeeeeeeelllllllllleeeeeeelllllllllllllllllllllllleeeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct gadhicqdnlgisfsfpglksllvgsnlelnaevmvwndgedsygttitfshpaglsyry  812
DSSP  llllllllllleeeellllllleelllleeeeeeeelllllllllleeeeeellleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct vaegqkqgqlrslhltcdsapvgsqgtwstscrinhlifrggaqitflatfdvspkavlg  872
DSSP  llllllllllllllleeeeeelllllleeeeeellllllllllleeeeeeeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct drllltanvssenntprtskttfqlelpvkyavytvvssheqftkylnfseseekeshva  932
DSSP  leeeeeeeeellllllllllllleeeeeleeeelleeeelllllllllllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct mhryqvnnlgqrdlpvsinfwvpvelnqeavwmdvevshpqnpslrcssekiappasdfl  992
DSSP  eeeeeeelllllleeeeeeeelllllllllllllleeelllllllleeeeeellllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct ahiqknpvldcsiagclrfrcdvpsfsvqeeldftlkgnlsfgwvrqilqkkvsvvsvae 1052
DSSP  hhhhhlleelllllleeeeeeeeeeelllllleeeeeellllhhhhlllllleeeeeeee


DSSP  ---------------------------ell
Query ---------------------------ire  274
ident                               
Sbjct itfdtsvysqlpgqeafmraqtttvlekyk 1082
DSSP  eellllleeelllllllleeeeeeeellll


No 70: Query=mol1A Sbjct=3k6sC Z-score=14.4

back to top
DSSP  llleeeeellllleeeeeellLLEE----------------EEEE--ELLL---------
Query spqhllvggsgwnkiaiinkdTKEI----------------VWEY--PLEK---------   33
ident                                           |       |         
Sbjct --------------fnldteeLTAFrvdsagfgdsvvqyanSWVVvgAPQKitaanqtgg   46
DSSP  --------------lllllllLEEEllllllllleeeelllLEEEeeLLLLlllllllll


DSSP  -------------------------LLLLlEEEELL-LLLEEEELLL-------------
Query -------------------------GWECnSVAATK-AGEILFSYSK-------------   54
ident                               | | |      |                  
Sbjct lyqcgystgacepiglqvppeavnmSLGL-SLASTTsPSQLLACGPTvhhecgrnmyltg  105
DSSP  eeeeelllleeeellllllllllllLLLL-EEEEELlLLEEEEEELLleelllllleell


DSSP  EEEEELlLLLEEEEE-----------elLLLLEE-EEEEELlLLLEEEEEELLL---EEE
Query GAKXITrDGRELWNI-----------aaPAGCEX-QTARILpDGNALVAWCGHP---STI   99
ident                                      |             |        
Sbjct LCFLLG-PTQLTQRLpvsrqecprssfeLEMAQEgFSAVFT-PDGPVLGAVGSFtwsGGA  163
DSSP  EEEEEL-LLLLLLLLlllllllllllllLLLLLLlLLEELL-LLLLEEEELLLLlllLEE


DSSP  EEELLLlLEEEEEEE---llLLLLhhHLLLLLEELLL---LLEEEEELLL---LEEEEEL
Query LEVNXKgEVLSKTEF---etGIERphAQFRQINKNKK---GNYLVPLFAT---SEVREIA  150
ident                                                             
Sbjct FLYPPN-MSPTFINMsqenvDMRD-sYLGYSTELALWkgvQSLVLGAPRYqhtGKAVIFT  221
DSSP  EELLLL-LLLEEELLlllllLLLL-lLLLLLEELLLLlllLEEEEEELLHhhlLEEEEEE


DSSP  L---LLLEEEEEEL----LLLLLEEEELLL------LLEEEELLLL------LEEEEELL
Query P---NGQLLNSVKL----SGTPFSSAFLDN------GDCLVACGDA------HCFVQLNL  191
ident            |      |    |    |          |                   |
Sbjct QvsrQWRMKAEVTGtqigSYFGASLCSVDVdsdgstDLVLIGAPHYyeqtrgGQVSVCPL  281
DSSP  LlllLLLEEEEELLllllLLLLLLEEEELLllllllLEEEEELLLLllllllLLEEEEEL


DSSP  L----LLLEE--EEEEHHhllllLLLEEEEEEELLL------LLEEEEEELlllLLHHhl
Query E----SNRIV--RRVNANdiegvQLFFVAQLFPLQN------GGLYICNWQghdREAGkg  239
ident                           | | |  |            |        |    
Sbjct PrgwrRWWCDavLYGEQG---hpWGRFGAALTVLGDvngdklTDVVIGAPG--eEENR--  334
DSSP  LllllLLLLLllLLLLLL---llLLLLLLLEEEEELllllllLEEEEELLL--lLLLL--


DSSP  llLLEEEELL------LLLEEEEEL-LLLL---llLLLEEEE------------------
Query khPQLVEIDS------EGKVVWQLN-DKVK---fgXISTICP------------------  271
ident                                                             
Sbjct --GAVYLFHGvlgpsiSPSHSQRIAgSQLSsrlqyFGQALSGgqdltqdglvdlavgarg  392
DSSP  --LLEEEEELllllllLLLLLLLLLlLLLLlllllEEEEEEElllllllllleeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct qvlllrtrpvlwvgvsmqfipaeiprsafecreqvvseqtlvqsniclyidkrsknllgs  452
DSSP  leeeeelllllleeeeeeelllllllllllllllllllleeeeeeeeeeellllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct rdlqssvtldlaldpgrlspratfqetknrslsrvrvlglkahcenfnlllpscvedsvt  512
DSSP  lllleeeeeeeeellllllllleelllllleeeeeeeelllleeeeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct pitlrlnftlvgkpllafrnlrpmlaadaqryftaslpfekncgadhicqdnlgisfsfp  572
DSSP  leeeeeeelllllllllllllllllllllllleeeeellllllllllllllllleeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct glksllvgsnlelnaevmvwndgedsygttitfshpaglsyryvaegqkqgqlrslhltc  632
DSSP  llllleelllleeeeeeeelllllllllleeeeeellleeeellllllllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct dsapvgsqgtwstscrinhlifrggaqitflatfdvspkavlgdrllltanvssenntpr  692
DSSP  eeeelllllleeeeeellllllllllleeeeeeeeelllllllleeeeeeeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct tskttfqlelpvkyavytvvssheqftkylnfseseekeshvamhryqvnnlgqrdlpvs  752
DSSP  lllllleeeeeleeeelleeeelllllllllllllllllllleeeeeeeelllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct infwvpvelnqeavwmdvevshpqnpslrcssekiappasdflahiqknpvldcsiagcl  812
DSSP  eeeelllllllllllllleeelllllllleeeeeellllllhhhhhhhlleellllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct rfrcdvpsfsvqeeldftlkgnlsfgwvrqilqkkvsvvsvaeitfdtsvysqlpgqeaf  872
DSSP  eeeeeeeeelllllleeeeeellllhhhhlllllleeeeeeeeeellllleeelllllll


DSSP  ----------ell
Query ----------ire  274
ident              
Sbjct mraqtttvlekyk  885
DSSP  leeeeeeeellll


No 71: Query=mol1A Sbjct=2agsA Z-score=14.4

back to top
DSSP  llleeeeellllleeeeeelLLLEEEEEEEL-------------------LLLLLLLEEE
Query spqhllvggsgwnkiaiinkDTKEIVWEYPL-------------------EKGWECNSVA   41
ident                            |                                
Sbjct ----------------maslAPGSSRVELFKrknstvpfeesngtirervVHSFRIPTIV   44
DSSP  ----------------llllLLLLEEEEEELlllleeeeellllleeeeeLLEEEEEEEE


DSSP  ELLLLLEEEEL-----------lLEEEEEL---LLLLEEEEEELL------LLLEEEEEE
Query ATKAGEILFSY-----------sKGAKXIT---RDGRELWNIAAP------AGCEXQTAR   81
ident                          |                               |  
Sbjct NVDGVMVAIADaryetsfdnsfiETAVKYSvddGATWNTQIAIKNsrassvSRVMDATVI  104
DSSP  EELLEEEEEEEeellllllllleEEEEEEElllLLLLEEEEEELLllllllLEEEEEEEE


DSSP  ELlLLLEEEEEEL----------------LLEEEEEELL-----------LLLEEEEEEE
Query ILpDGNALVAWCG----------------HPSTILEVNX-----------KGEVLSKTEF  114
ident                                                             
Sbjct VK-GNKLYILVGSfnktrnswtqhrdgsdWEPLLVVGEVtksaangkttaTISWGKPVSL  163
DSSP  EE-LLEEEEEEEEellllllhhhllllllEEEEEEEEEEeeeeelleeeeEEEELLLEEL


DSSP  L---------lLLLLhhHLLLL--LEEL-LLLLEEEEELL-----LLEEEEEL---LLLL
Query E---------tGIERphAQFRQ--INKN-KKGNYLVPLFA-----TSEVREIA---PNGQ  154
ident                                        |                 |  
Sbjct KplfpaefdgiLTKE--FIGGVgaAIVAsNGNLVYPVQIAdmggrVFTKIMYSeddGNTW  221
DSSP  HhhllleelleEEEE--EEELLeeLEELlLLLEEEEEEEEellllEEEEEEEElllLLLL


DSSP  EEEEEEL--LLLLLEEEELlLLLEEEELLLL--LEEEEELLL--LLLEEE----EEEH-h
Query LLNSVKL--SGTPFSSAFLdNGDCLVACGDA--HCFVQLNLE--SNRIVR----RVNA-n  203
ident                      |              |                       
Sbjct KFAEGRSkfGCSEPAVLEW-EGKLIINNRVDgnRRLVYESSDmgKTWVEAlgtlSHVWtn  280
DSSP  EELLLLLllLEEEEEEEEE-LLEEEEEEEELllLLLEEEELLllLLLEELllllLLLLll


DSSP  hllllllLEEEEEEELL---LLLEEEEEELLlLLLHhhllLLLEEEELLLLLEEEEELLL
Query diegvqlFFVAQLFPLQ---NGGLYICNWQGhDREAgkgkHPQLVEIDSEGKVVWQLNDK  260
ident                                            |   |            
Sbjct sptsnqqDCQSSFVAVTiegKRVMLFTHPLN-LKGRwmrdRLHLWMTDNQRIFDVGQISI  339
DSSP  lllllllLLLLLEEEEEellEEEEEEEEELL-LLLLllllLEEEEEELLLLEEEEEELLL


DSSP  L-LLLLLLEEEEEL----------------------------------------------
Query V-KFGXISTICPIR----------------------------------------------  273
ident        |                                                    
Sbjct GdENSGYSSVLYKDdklyslheintndvyslvfvrligelqlmksvvrtwkeednhlasi  399
DSSP  LlLLLLLEEEEEELleeeeeeeeeelleeeeeeeelhhhhhhhhhhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct ctpvvpatppskggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkf  459
DSSP  llllllllllllllllllllllleeeeeeeeellleeeelllllleeeeleeeelleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct ngvgggavwpvarqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllg  519
DSSP  llllleeeeelhhhllllllhhhhleeeeeeeeeelllllleeeeeeeeelllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct lsydknrqwrplygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrg  579
DSSP  eeeelllleeeeelllllllllllllllleeeeeeeelleeeeeelleellllleellll


DSSP  ------------------------------------------------------l
Query ------------------------------------------------------e  274
ident                                                        
Sbjct atlpdishfyiggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd  634
DSSP  llllleeeeeeelllllllllllleeeeeeeeelllllhhhhhhhhhllllllll


No 72: Query=mol1A Sbjct=2bf6A Z-score=14.4

back to top
DSSP  -------------------------------llLEEEEELLLL------------lEEEE
Query -------------------------------spQHLLVGGSGW------------nKIAI   17
ident                                    |                        
Sbjct vegavktepvdlfhpgflnssnyripalfktkeGTLIASIDARrhggadapnndidTAVR   60
DSSP  llllllllleeeelllhhhlleeeeeeeeelllLLEEEEEEEEllllllllllleeEEEE


DSSP  EELL--lLEEEEEEELL----LLLLLLEEEELL-LLLEEEELL-----------------
Query INKD--tKEIVWEYPLE----KGWECNSVAATK-AGEILFSYS-----------------   53
ident    |                               | |                      
Sbjct RSEDggkTWDEGQIIMDypdkSSVIDTTLIQDDeTGRIFLLVThfpskygfwnaglgsgf  120
DSSP  EELLlllLLLLLEEEELllllLEEEEEEEEELLlLLLEEEEEEeelllllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   53
ident                                                             
Sbjct knidgkeylclydssgkeftvrenvvydkdsnkteyttnalgdlfkngtkidninsstap  180
DSSP  eeelleeeeeeellllleeeeelleeellllleeeeeelllleeeelleeeeelllllll


DSSP  -------LEEEEELL----LLLEeEEEE------lLLLLEEEE-eEELL-----LLLEEE
Query -------KGAKXITR----DGRElWNIA------aPAGCEXQT-aRILP-----DGNALV   90
ident                       |  ||                   |        |   |
Sbjct lkakgtsYINLVYSDddgkTWSEpQNINfqvkkdwMKFLGIAPgrGIQIkngehKGRIVV  240
DSSP  leellllEEEEEEELllllLLLLlEELHhhhllllLLLEEELLeeLEELlllllLLLEEE


DSSP  EEEL------LLEEEEEEL-LLLLEEEEEEEL-----------------lLLLLhhHLLL
Query AWCG------HPSTILEVN-XKGEVLSKTEFE-----------------tGIERphAQFR  126
ident             |                                               
Sbjct PVYYtnekgkQSSAVIYSDdSGKNWTIGESPNdnrklengkiinsktlsdDAPQ--LTEC  298
DSSP  EEEEelllllEEEEEEEELlLLLLLEELLLLLlleellllleelllllllLLLL--EEEE


DSSP  lLEELL--LLLEEEEELL-LLEEEEEL----LLLL-EEEEE-ELLL--LLLEEEELLL--
Query qINKNK--KGNYLVPLFA-TSEVREIA----PNGQ-LLNSV-KLSG--TPFSSAFLDN--  173
ident             |                                      |        
Sbjct -QVVEMpnGQLKLFMRNLsGYLNIATSfdggATWDeTVEKDtNVLEpyCQLSVINYSQkv  357
DSSP  -EEEELllLLEEEEEEELlLEEEEEEEllllLLLLlLLEEEeEEELllLLLEEEELLLll


DSSP  ---LLEEEELL-----LLLEEEEELLL------------LLLEEEEEEHhhllllLLLEE
Query ---GDCLVACG-----DAHCFVQLNLE------------SNRIVRRVNAndiegvQLFFV  213
ident                                                             
Sbjct dgkDAVIFSNPnarsrSNGTVRIGLINqvgtyengepkyEFDWKYNKLV----kpGYYAY  413
DSSP  lllLEEEEEEElllllEEEEEEEEEEEeeeellllleeeEEEEEEEEEE----eeEELLL


DSSP  EEEEELLLLLEEEEEELLLLllhhhllLLLEEEELLLLleeeeelllllllllleeeeel
Query AQLFPLQNGGLYICNWQGHDreagkgkHPQLVEIDSEGkvvwqlndkvkfgxisticpir  273
ident   |  | ||                       |                           
Sbjct SCLTELSNGNIGLLYEGTPS------eEMSYIEMNLKY--------------------le  447
DSSP  EEEEELLLLLEEEEELLLLL------lLEEEEEELHHH--------------------hl


DSSP  l
Query e  274
ident  
Sbjct s  448
DSSP  l


No 73: Query=mol1A Sbjct=2f10A Z-score=14.4

back to top
DSSP  ---------------------------lLLEEEEELL---LLLEEEEEEL-------LLL
Query ---------------------------sPQHLLVGGS---GWNKIAIINK-------DTK   23
ident                              | ||                           
Sbjct slpvlqkesvfqsgahayripallylpgQQSLLAFAEqraAELIVLRRGDydapthqVQW   60
DSSP  llllleeeeeeelllleeeeeeeeeehhHLEEEEEEEeelLLEEEEEEEEeelllleEEE


DSSP  EEEEEE-ELLL---LLLLLEEEELL-LLLEEEELL---------LEEEEELL----LLLE
Query EIVWEY-PLEK---GWECNSVAATK-AGEILFSYS---------KGAKXITR----DGRE   65
ident                            |                                
Sbjct QAQEVVaQARLdghRSMNPCPLYDAqTGTLFLFFIaipgranvtRLCQVTSTdhgrTWSS  120
DSSP  EEEEELlLLLLlleEEEEEEEEEELlLLEEEEEEEeeellllllEEEEEEELllllLLLL


DSSP  EEEEE---------lLLLLEEEE--EEELLL--LLEEEEEELL----------LEEEEEE
Query LWNIA---------aPAGCEXQT--ARILPD--GNALVAWCGH----------PSTILEV  102
ident                             | |      |                      
Sbjct PRDLTdaaigpayreWSTFAVGPghCLQLNDraRSLVVPAYAYrklhiqrpipSAFCFLS  180
DSSP  LEELHhhhhhhhhhhEEEEEELLllLEELLLllLLEEEEEEEEellllllleeEEEEEEE


DSSP  L-LLLLEeEEEEELLLLllhhhLLLLlEELL--LLLEEEEELLL-LEEEEEL----LLLL
Query N-XKGEVlSKTEFETGIerphaQFRQiNKNK--KGNYLVPLFAT-SEVREIA----PNGQ  154
ident             |            |           |         |           |
Sbjct HdHGRTW-ARGHFVAQD----tLECQ-VAEVeqRVVTLNARSHLrARVQAQStndgLDFQ  234
DSSP  LlLLLLL-EELLLLLLL----lLLEE-EEEEllLEEEEEELLLLlEEEEEEEllllLLLL


DSSP  EEEEE-ELLL-----LLLEEEELLL---LLEEEELLLL------LEEEEEL-LLLL-LEE
Query LLNSV-KLSG-----TPFSSAFLDN---GDCLVACGDA------HCFVQLN-LESN-RIV  197
ident     | ||          |            |                            
Sbjct ESQLVkKLVEpppqgCQGSVISFPSpraQWLLYTHPTHswqradLGAYLNPrPPAPeAWS  294
DSSP  LEEEEeEEELlllllLLLEEEEEELlllEEEEEEEELLlllleeEEEEEELlLLLLlLLL


DSSP  EEEEHhhlllLLLLEEEEEEELLL-----LLEEEEEELLLLLlhhhllLLLEEEELLLLl
Query RRVNAndiegVQLFFVAQLFPLQN-----GGLYICNWQGHDReagkgkHPQLVEIDSEGk  252
ident   |               |                                         
Sbjct EPVLL----aKGSCAYSDLQSMGTgpdgsPLFGCLYEANDYE------EIVFLMFTLKQ-  343
DSSP  LLEEE----eEEEEEEEEEEEEEElllllEEEEEEEEELLLL------EEEEEEEEHHH-


DSSP  eeeeelllllllllleeeeell
Query vvwqlndkvkfgxisticpire  274
ident                       
Sbjct ----------------afpaey  349
DSSP  ----------------hlllll


No 74: Query=mol1A Sbjct=1erjC Z-score=14.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld   60
DSSP  lllllhhhlllllllllhhhlllllllllhhheeelllleeeellllllleeeeeeeeee


DSSP  ------------llLEEEEELllLLEEEEEELLLLEEEEEEELLLLLLLLEEEELLL-LL
Query ------------spQHLLVGGsgWNKIAIINKDTKEIVWEYPLEKGWECNSVAATKA-GE   47
ident                 |  |                 |            ||        
Sbjct htsvvccvkfsndgEYLATGC--NKTTQVYRVSDGSLVARLSDDSDLYIRSVCFSPDgKF  118
DSSP  lllllleeeellllLEEEEEL--LLLEEEEELLLLLEEEEELLLLLLLEEEEEELLLlLE


DSSP  EEEELL-LEEEEELL-LLLEEEE-EELLllLEEEEEEELLLL-LEEEEEELllEEEEEEL
Query ILFSYS-KGAKXITR-DGRELWN-IAAPagCEXQTARILPDG-NALVAWCGhpSTILEVN  103
ident                                        | |            |     
Sbjct LATGAEdRLIRIWDIeNRKIVMIlQGHE--QDIYSLDYFPSGdKLVSGSGD--RTVRIWD  174
DSSP  EEEEELlLLEEEEELlLLEEEEEeLLLL--LLEEEEEELLLLlEEEEEELL--LEEEEEE


DSSP  LL-LLEEEEEEELLllllhhhLLLLLEELL--LLLEEEEELlLLEEEEELL-LLLEEEEE
Query XK-GEVLSKTEFETgierphaQFRQINKNK--KGNYLVPLFaTSEVREIAP-NGQLLNSV  159
ident    |        |                                ||      | |    
Sbjct LRtGQCSLTLSIED-------GVTTVAVSPgdGKYIAAGSL-DRAVRVWDSeTGFLVERL  226
DSSP  LLlLEEEEEEELLL-------LEEEEEELLllLLEEEEEEL-LLLEEEEELlLLLEEEEE


DSSP  E--------LLLLLLEEEELLL-LLEEEELlLLLEEEEELLLllLEEEEEEH--------
Query K--------LSGTPFSSAFLDN-GDCLVACgDAHCFVQLNLEsnRIVRRVNA--------  202
ident                |  |                    ||                   
Sbjct DsenesgtgHKDSVYSVVFTRDgQSVVSGS-LDRSVKLWNLQ--TCEVTYIGhkdfvlsv  283
DSSP  LllllllllLLLLEEEEEELLLlLEEEEEE-LLLEEEEEELL--LEEEEEELlllleeee


DSSP  --------------------------HHLLLLL--lleeEEEEELLL-----lleeeeee
Query --------------------------NDIEGVQ--lffvAQLFPLQN-----gglyicnw  229
ident                           |     |                           
Sbjct attqndeyilsgskdrgvlfwdkksgNPLLMLQghrnsvISVAVANGsslgpeynvfatg  343
DSSP  eelhhhleeeeeellleeeeeellllLEEEEEEllllleEEEEELLLllllllleeeeee


DSSP  LLLLllhhhllllLEEEELlllleeeeelllllllllleeeeell
Query QGHDreagkgkhpQLVEIDsegkvvwqlndkvkfgxisticpire  274
ident  |                                           
Sbjct SGDC--------kARIWKY-----------------------kki  357
DSSP  ELLL--------eEEEEEE-----------------------eel


No 75: Query=mol1A Sbjct=3dwlH Z-score=14.3

back to top
DSSP  llleeeeellllleeeeeelllLEEEEEEELLllLLLLEEEELLLL-LEEEELLL-EEEE
Query spqhllvggsgwnkiaiinkdtKEIVWEYPLEkgWECNSVAATKAG-EILFSYSK-GAKX   58
ident                               |         |      |            
Sbjct ----------------------ATSQVLHILP--KPSYEHAFNSQRtEFVTTTATnQVEL   36
DSSP  ----------------------LLEEEEEELL--LLLLLLEELLLLlEEELLLLLlLLLE


DSSP  ELLL---LLEEEEEELLlLLEEEEEEELL-LLLEEEEEELllEEEEEEllLLLEeEEEEE
Query ITRD---GRELWNIAAPaGCEXQTARILP-DGNALVAWCGhpSTILEVnxKGEVlSKTEF  114
ident    |                        |                               
Sbjct YEQDgngWKHARTFSDH-DKIVTCVDWAPkSNRIVTCSQD--RNAYVY--TWKQ-TLVLL   90
DSSP  EEEElleEEELLLLLLL-LLLEEEEEELLlLLLEEEEELL--LLEEEL--LLLL-EEELL


DSSP  LLLlllhhHLLLLLEEL-LLLLEEEEELlLLEEEEELL-LLLEEEEEE-LLLLLLEEEEL
Query ETGierphAQFRQINKN-KKGNYLVPLFaTSEVREIAP-NGQLLNSVK-LSGTPFSSAFL  171
ident                         |                        |  |  |    
Sbjct RLN-----RAATFVRWSpNEDKFAVGSG-ARVISVCYFeWWVSKHLKRpLRSTILSLDWH  144
DSSP  LLL-----LLEEEEELLlLLLLLEEEEL-LLLEEELLLlLLLLEEELLlLLLLEEEEEEL


DSSP  LL-LLEEEELlLLLEEEEELL-----------------LLLLEEEEEEHhhlllllLLEE
Query DN-GDCLVACgDAHCFVQLNL-----------------ESNRIVRRVNAndiegvqLFFV  213
ident  |       |        |                     |                  |
Sbjct PNnVLLAAGC-ADRKAYVLSAyvrdvdkpeasvwgsrlPFNTVCAEYPS-------GGWV  196
DSSP  LLlLEEEEEE-LLLLEEEEEElllllllllllllllllLEEEEEELLLL-------LLLE


DSSP  EEEEELLL-LLEEEEEEL---------------lllllhhHLLLLLEeeellllleEEEE
Query AQLFPLQN-GGLYICNWQ---------------ghdreagKGKHPQLveidsegkvVWQL  257
ident            |                                |               
Sbjct HAVGFSPSgNALAYAGHDssvtiaypsapeqppralitvkLSQLPLR-sllwanesAIVA  255
DSSP  EEEEELLLlLLEEEEELLleeeeeeelllllleeeeeeeeLLLLLEE-eeeeeellEEEE


DSSP  -llLLLL------------------------------------------LLLLEEEEEL-
Query -ndKVKF------------------------------------------GXISTICPIR-  273
ident                                                    | |  |   
Sbjct agyNYSPillqgneahtrdldagtsktsfthtgntgegreesslptvhqNMIATLRPYAg  315
DSSP  eelLLLEeeelllllllllllllllllllllllllllllllllllllllLLEEEEEEEEe


DSSP  ---------------------l
Query ---------------------e  274
ident                       
Sbjct tpgnitaftssgtdgrvvlwtl  337
DSSP  elleeeeeeeeellleeeeell


No 76: Query=mol1A Sbjct=2jkbA Z-score=14.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lsispifqggsyqlnnksidissllldklsgesqtvvmkfkadkpnslqalfglsnskag   60
DSSP  lllllleeeeeeeeellleelhhhhhhhllllleeeeeeeelllllleeeeeeeelllll


DSSP  -------------------llleeeeellllleeeeeelLLLE-----------------
Query -------------------spqhllvggsgwnkiaiinkDTKE-----------------   24
ident                                          |                  
Sbjct fknnyfsifmrdsgeigveirdaqkginylfsrpaslwgKHKGqaventlvfvsdskdkt  120
DSSP  lllleeeeeeelllleeeeeeelllleeeeeeellllllEELLeelleeeeeeeelllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   24
ident                                                             
Sbjct ytmyvngievfsetvdtflpisningidkatlgavnregkehylakgsideislfnkais  180
DSSP  eeeeelleeeeeeellllllhhhllllleeeelleeelleeellleeeeeeeeeelllll


DSSP  ----------eEEEEELL-------LLLLLLEEEELLLLLEEEELL-------------L
Query ----------iVWEYPLE-------KGWECNSVAATKAGEILFSYS-------------K   54
ident                                       |  | |                
Sbjct dqevstiplsnPFQLIFQsgdstqaNYFRIPTLYTLSSGRVLSSIDaryggthdskskiN  240
DSSP  hhhhhllllllLLLLLLLlllllllLEEELLLLEELLLLLEEEEEEeelllllllllleE


DSSP  EEEEELL---LLLE-eEEEELL------------------------LLLEEEEEEELL-L
Query GAKXITR---DGRE-lWNIAAP------------------------AGCEXQTARILP-D   85
ident  |                                            |             
Sbjct IATSYSDdngKTWSepIFAMKFndyeeqlvywprdnklknsqisgsASFIDSSIVEDKkS  300
DSSP  EEEEEELlllLLLLllEEEELLllllllllllllllllllllllllLEEEEEEEEELLlL


DSSP  LLEEEEEEL---------------------------------------------------
Query GNALVAWCG---------------------------------------------------   94
ident |                                                           
Sbjct GKTILLADVmpagignnnankadsgfkeinghyylklkkngdndfrytvrengvvynett  360
DSSP  LLEEEEEEEellllllllllllllleeelllleeeeeeellllllleeelhhheeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   94
ident                                                             
Sbjct nkptnytindkyevleggksltveqysvdfdsgslrerhngkqvpmnvfykdslfkvtpt  420
DSSP  leeeeeeellllleeelleeleeeeeeeelllllleeeeeeeeeellllllllleellll


DSSP  LLEEEEEELL--LLLEeEEEEELLLL--llhhHLLLL--LEELL-LLLEEEEELLL-LEE
Query HPSTILEVNX--KGEVlSKTEFETGI--erphAQFRQ--INKNK-KGNYLVPLFAT-SEV  146
ident                                            |                
Sbjct NYIAMTTSQNrgESWE-QFKLLPPFLgekhngTYLCPgqGLALKsSNRLIFATYTSgELT  479
DSSP  LEEEEEEELLllLLLL-LLEELLLLLllllllLEELLeeLEELLlLLLEEEEEEELlEEE


DSSP  EEEL---LLLLEEEEEEL----LLLLLEEEELLLLLEEEELLLL--LEEEEELLL--LLL
Query REIA---PNGQLLNSVKL----SGTPFSSAFLDNGDCLVACGDA--HCFVQLNLE--SNR  195
ident   |           |                |  |                         
Sbjct YLISddsGQTWKKSSASIpfknATAEAQMVELRDGVIRTFFRTTtgKIAYMTSRDsgETW  539
DSSP  EEEElllLLLLEEEEEELllllLLLLEEEEEEELLEEEEEELLLllLLEEEEELLllLLL


DSSP  EEEEEEHhhlllLLLL----EEEEEEELL-----LLLEEEEEELllLLLHhhllLLLEEE
Query IVRRVNAndiegVQLF----FVAQLFPLQ-----NGGLYICNWQghDREAgkgkHPQLVE  246
ident                                                |        ||| 
Sbjct SKVSYID-----GIQQtsygTQVSAIKYSqlidgKEAVILSTPN--SRSG--rkGGQLVV  590
DSSP  LLLEELL-----LLLLllllLLLEEEEEEeeellEEEEEEEEEL--LLLL--llLEEEEE


DSSP  ELLL-----LLEEEEEL--LLLLLLLLLEEEEELL-------------------------
Query IDSE-----GKVVWQLN--DKVKFGXISTICPIRE-------------------------  274
ident                            | |                              
Sbjct GLVNkeddsIDWKYHYDidLPSYGYAYSAITELPNhhigvlfekydswsrnelhlsnvvq  650
DSSP  EEELlllllEEEEEEEEllLLLLLLLLEEEEELLLlleeeeeelllllllllllllllee


DSSP  -----------
Query -----------  274
ident            
Sbjct yidleindltk  661
DSSP  eeeelhhhhll


No 77: Query=mol1A Sbjct=1nr0A Z-score=14.1

back to top
DSSP  ---------------------------llLEEEEEllLLLEEEEEELLLLEEEEEEELLL
Query ---------------------------spQHLLVGgsGWNKIAIINKDTKEIVWEYPLEK   33
ident                                                        |    
Sbjct sefsqtalfpslprtargtavvlgntpagDKIQYC--NGTSVYTVPVGSLTDTEIYTEHS   58
DSSP  llleeeeeelllllllllllllleellllLEEEEE--ELLEEEEEELLLLLLLEEELLLL


DSSP  LLLLlEEEEL-LLLLEEEELLL-EEEEELLL---LLEEEEEELLlLLEEEEEEELLLL-L
Query GWECnSVAAT-KAGEILFSYSK-GAKXITRD---GRELWNIAAPaGCEXQTARILPDG-N   87
ident                                         |                   
Sbjct HQTT-VAKTSpSGYYCASGDVHgNVRIWDTTqttHILKTTIPVF-SGPVKDISWDSESkR  116
DSSP  LLEE-EEEELlLLLEEEEEELLlEEEEEELLlllLLEEEEEELL-LLLEEEEEELLLLlE


DSSP  EEEEEELLLEEEEEEL-LLLLEEEEEEELLllllhhHLLLLLEELL--LLLEEEEELlLL
Query ALVAWCGHPSTILEVN-XKGEVLSKTEFETgierphAQFRQINKNK--KGNYLVPLFaTS  144
ident       |            |                                        
Sbjct IAAVGEGRERFGHVFLfDTGTSNGNLTGQA------RAMNSVDFKPsrPFRIISGSD-DN  169
DSSP  EEEEELLLLLLEEEEElLLLLLLLLLLLLL------LLEEEEEELLllLLEEEEEEL-LL


DSSP  EEEEEL---LLLLEeEEEELLLLLLEEEELL-lLLEEEellllleeEEELL------LLL
Query EVREIA---PNGQLlNSVKLSGTPFSSAFLD-nGDCLVacgdahcfVQLNL------ESN  194
ident  |                       |                                  
Sbjct TVAIFEgppFKFKS-TFGEHTKFVHSVRYNPdgSLFAS---tggdgTIVLYngvdgtKTG  225
DSSP  LEEEEElllLEEEE-EELLLLLLEEEEEELLllLEEEE---eelllLEEEEelllllEEE


DSSP  LEE------EEEE---------------------------------hhHLLLLL----LL
Query RIV------RRVN---------------------------------anDIEGVQ----LF  211
ident                                                     |       
Sbjct VFEddslknVAHSgsvfgltwspdgtkiasasadktikiwnvatlkveKTIPVGtrieDQ  285
DSSP  ELLllllllLLLLlleeeeeellllleeeeeellleeeeeelllleeeEEEELLllhhHL


DSSP  EEEeEEELLLllEEEEEELlllllhhhllllLEEEELLL-LLEEEEELLLLL--------
Query FVAqLFPLQNggLYICNWQghdreagkgkhpQLVEIDSE-GKVVWQLNDKVK--------  262
ident             |                         | |          |        
Sbjct QLG-IIWTKQ-aLVSISAN-----------gFINFVNPElGSIDQVRYGHNKaitalsss  332
DSSP  EEE-EEELLL-lEEEEELL-----------lLEEEEELLlLEEEEEELLLLLleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct adgktlfsadaeghinswdistgisnrvfpdvhatmitgikttskgdlftvswddhlkvv  392
DSSP  lllleeeeeelllleeeeellllleeellllllllleeeeeellllleeeeellleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct paggsgvdsskavanklssqplglavsadgdiavaacykhiaiyshgkltevpisynssc  452
DSSP  llllllllllllleeelllleeeeeelllllleeeeelleeeeeelleeeeeelllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct valsndkqfvavggqdskvhvyklsgasvsevktivhpaeitsvafsnngaflvatdqsr  512
DSSP  eeellllleeeeeellleeeeeeeelleeeeeeeeelllleeeeeellllleeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct kvipysvannfelahtnswtfhtakvacvswspdnvrlatgsldnsvivwnmnkpsdhpi  572
DSSP  leeeeehhhlleelllllllllllleeeeeellllleeeeeelllleeeeelllllllle


DSSP  --------------------------llllleeeeell
Query --------------------------fgxisticpire  274
ident                                       
Sbjct iikgahamssvnsviwlnettivsagqdsnikfwnvpf  610
DSSP  eelllllllleeeeeeeelleeeeeelllleeeeelll


No 78: Query=mol1A Sbjct=3ho5B Z-score=14.0

back to top
DSSP  ------------------------LLLEEEEELLlLLEEEEEELLLLEE-EEEEEL--LL
Query ------------------------SPQHLLVGGSgWNKIAIINKDTKEI-VWEYPL--EK   33
ident                           | |           |                   
Sbjct hncfciqevvsglrqpvgalhsgdGSQRLFILEK-EGYVKILTPEGEIFkEPYLDIhkLV   59
DSSP  lllleeeeeeeeelleeeeellllLLLLEEEEEL-LLEEEEELLLLLLLlLLLEELllLL


DSSP  LL--------LLLEEEELLLL----LEEEELL--------------lEEEEEL-------
Query GW--------ECNSVAATKAG----EILFSYS--------------kGAKXIT-------   60
ident              | |             ||                     |       
Sbjct QSgikggderGLLSLAFHPNYkkngKLYVSYTtnqerwaigphdhilRVVEYTvsrknph  119
DSSP  LLllllllllLEEEEEELLLHhhhlEEEEEEEellllllllllleeeEEEEEEellllll


DSSP  -LLLL-EEEEEELLLL---lEEEEEEELLLLLEEEEEELL----------------LEEE
Query -RDGR-ELWNIAAPAG---cEXQTARILPDGNALVAWCGH----------------PSTI   99
ident   | |                       |||                             
Sbjct qVDLRtARVFLEVAELhrkhLGGQLLFGPDGFLYIILGDGmitlddmeemdglsdfTGSV  179
DSSP  lEEEEeEEEEEEEEELllllLEEEEEELLLLLEEEEELLLlllhhhhhllllllllLLEE


DSSP  EEELL-------LLLE--------------EEEEEELLllllhhhLLLLLEELL-LLLEE
Query LEVNX-------KGEV--------------LSKTEFETgierphaQFRQINKNK-KGNYL  137
ident |                                                          |
Sbjct LRLDVdtdmcnvPYSIprsnphfnstnqppEVFAHGLH-------DPGRCAVDRhNLTIL  232
DSSP  EEELLlllllllLLLLllllllllllllllLEEEELLL-------LLLLLEEELlLLEEE


DSSP  EEELL---LLEEEEELL--------LLLEEEEEEL-LLLLLEEEELL-------LLLEEE
Query VPLFA---TSEVREIAP--------NGQLLNSVKL-SGTPFSSAFLD-------NGDCLV  178
ident          |  |               ||       |                 |    
Sbjct CSDSNgknRSSARILQIikgkdyesEPSLLEFKPFsNGPLVGGFVYRgcqserlYGSYVF  292
DSSP  EEELLlllLLEEEEEELllllllllLLLLEEELLLlLLLLLEEEELLlllllllLLLEEE


DSSP  ELLLlLEEEEELLL----LLLEEEEeEHHH----LLLLLlLEEEEEEELlLLLEEEEEEL
Query ACGDaHCFVQLNLE----SNRIVRRvNAND----IEGVQlFFVAQLFPLqNGGLYICNWQ  230
ident        |  |                                        |  ||    
Sbjct GDRN-GNFLTLQQSpvtkQWQEKPL-CLGTsgscRGYFS-GHILGFGEDeLGEVYILSSS  349
DSSP  ELLL-LLEEEEEELllllLEEEEEE-LLLLllllLLLLL-LEEEEEEELlLLLEEEEEEL


DSSP  lllLLHHHLLLLLEEEELLL----------------------------------------
Query ghdREAGKGKHPQLVEIDSE----------------------------------------  250
ident              |  |                                           
Sbjct ---KSMTQTHNGKLYKIVDPkrplmpeecratvqpaqtltsecsrlcrngyctptgkccc  406
DSSP  ---HHHHHHLLEEEEEEELLllllllhhhllllllllllllhhhhhllleeellllleee


DSSP  ---------------------lleeeeelllllllllleeeeell
Query ---------------------gkvvwqlndkvkfgxisticpire  274
ident                                              
Sbjct spgwegdfcrtakcepacrhggvcvrpnkclckkgylgpqcehhh  451
DSSP  llleellllleelllllllllleeeelleeellllllllllllll


No 79: Query=mol1A Sbjct=3i2nA Z-score=13.7

back to top
DSSP  ------------------------lLLEEEEEL-lllLEEEEEELL--LLEEEEEEELLl
Query ------------------------sPQHLLVGG-sgwNKIAIINKD--TKEIVWEYPLEk   33
ident                                 |      |              |     
Sbjct ekpqiiahiqkgfnytvfdckwvpcSAKFVTMGnrgtGVIQLYEIQhgDLKLLREIEKA-   59
DSSP  lllleeeeeeeelllleeeeeelllLLEEEEEEllllEEEEEEEELllLEEEEEEEEEL-


DSSP  lLLLLEEEEL----lLLLEEEELLL-EEEEEL-LLLL-EEEE-EELLllLEEEEEEELLL
Query gWECNSVAAT----kAGEILFSYSK-GAKXIT-RDGR-ELWN-IAAPagCEXQTARILPD   85
ident                                                             
Sbjct -KPIKCGTFGatslqQRYLATGDFGgNLHIWNlEAPEmPVYSvKGHK--EIINAIDGIGG  116
DSSP  -LLEEEEELLlllllLLLEEEEELLlLEEEELlLLLLlLLEEeLLLL--LLEEEEEEELH


DSSP  ------LLEEEEEELllEEEEEELLL--lLEEEEEE------------------------
Query ------GNALVAWCGhpSTILEVNXK--gEVLSKTE------------------------  113
ident                   |                |                        
Sbjct lgiggaPEIVTGSRD--GTVKVWDPRqkdDPVANMEpvqgenkrdcwtvafgnayneerv  174
DSSP  hhllllLEEEEEELL--LLEEEELLLlllLLLEEELllllllllleeeeeeellllllle


DSSP  ---eLLLLL----------------lhhHLLLlLEELL----LLLEEEEELlLLEEEEE-
Query ---fETGIE----------------rphAQFRqINKNK----KGNYLVPLFaTSEVREI-  149
ident                                                             
Sbjct vcagYDNGDiklfdlrnmalrwetniknGVCS-LEFDRkdisMNKLVATSL-EGKFHVFd  232
DSSP  eeeeELLLEeeeeelllleeeeeeelllLEEE-EEELLllllLLEEEEEEL-LLEEEEEe


DSSP  -----llllleeeeEELL-LLLLEEEE-LLLL-LEEEELlLLLEEEEELLL---------
Query -----apngqllnsVKLS-GTPFSSAF-LDNG-DCLVACgDAHCFVQLNLE---------  192
ident                |    |         |    | |   |        |         
Sbjct mrtqhptkgfasvsEKAHkSTVWQVRHlPQNReLFLTAG-GAGGLHLWKYEypiqrkdse  291
DSSP  eeeeellleeeeeeEELLlLLEEEEEEeLLEEeEEEEEE-LLLEEEEEEEElllllllll


DSSP  --------LLLEEEEEEHhhllllLLLEEEEEEEL--LLLLEEEEEELlllllhhhlllL
Query --------SNRIVRRVNAndiegvQLFFVAQLFPL--QNGGLYICNWQghdreagkgkhP  242
ident         |      |               |       |                    
Sbjct giemgvagSVSLLQNVTL------STQPISSLDWSpdKRGLCVCSSFD-----------Q  334
DSSP  llllllllEEEEEEEEEL------LLLLEEEEEELllLLLEEEEEELL-----------L


DSSP  LEEEELLLlleeeeelllllllllleeeeell
Query QLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident                                 
Sbjct TVRVLIVT-----------------------k  343
DSSP  EEEEEEEL-----------------------l


No 80: Query=mol1A Sbjct=3b69A Z-score=13.6

back to top
DSSP  llleeeeellllleeeeeeLLLLEEeEEEELL-----------------LLLLLLEEEEL
Query spqhllvggsgwnkiaiinKDTKEIvWEYPLE-----------------KGWECNSVAAT   43
ident                            |                                
Sbjct ----------------aslAPGSSR-VELFKRqsskvpfekdgkvtervVHSFRLPALVN   43
DSSP  ----------------lllLLLLEE-EEEELLllleeeeeelleeeeeeLLEEEEEEEEE


DSSP  -LLLLEEEEL-----------lLEEEEEL---LLLLEEEEEELLL-----LLEEEEEEEL
Query -KAGEILFSY-----------sKGAKXIT---RDGRELWNIAAPA-----GCEXQTARIL   83
ident                                     |                     | 
Sbjct vDGVMVAIADaryetsfdnsliDTVAKYSvddGETWETQIAIKNSrassvSRVVDPTVIV  103
DSSP  eLLEEEEEEEeellllllllleEEEEEEElllLLLLEEEEEELLLlllllLEEEEEEEEE


DSSP  LLLLEEEEEEL----------------LLEEEEEELL-----------LLLEEEEEEEL-
Query PDGNALVAWCG----------------HPSTILEVNX-----------KGEVLSKTEFE-  115
ident       |                                              |      
Sbjct KGNKLYVLVGSynssrsywtshgdardWDILLAVGEVtkstaggkitaSIKWGSPVSLKe  163
DSSP  ELLEEEEEEEEellllllhhhllllllEEEEEEEEEEeeeelllleeeEEEELLLEELHh


DSSP  --------lLLLLhhHLLLL-lEELL--LLLEEEEELL-----LLEEEEEL---LLLLEE
Query --------tGIERphAQFRQ-iNKNK--KGNYLVPLFA-----TSEVREIA---PNGQLL  156
ident                                                             
Sbjct ffpaemegmHTNQ--FLGGAgvAIVAsnGNLVYPVQVTnkkkqVFSKIFYSedeGKTWKF  221
DSSP  hllleelleEEEE--EEELLeeLEELllLLEEEEEEEEellllEEEEEEEElllLLLLEE


DSSP  EEEELL-LLLLEEEELLL-LLEEEELLL-LLEEEEELLL--LLLEEE----EEEHhhlll
Query NSVKLS-GTPFSSAFLDN-GDCLVACGD-AHCFVQLNLE--SNRIVR----RVNAndieg  207
ident        |     |             |     |                          
Sbjct GKGRSAfGCSEPVALEWEgKLIINTRVDyRRRLVYESSDmgNTWLEAvgtlSRVWgpspk  281
DSSP  LLLLLLlLLEEEEEEEELlEEEEEEELLlLLLLEEEELLllLLLEELllllLLLLlllll


DSSP  lllLEEEEEEELL-----LLLEEEEEELllLLLHhhllLLLEEEELL--LLLEEEEELLL
Query vqlFFVAQLFPLQ-----NGGLYICNWQghDREAgkgkHPQLVEIDS--EGKVVWQLNDK  260
ident          |           |         |                     | |    
Sbjct snqPGSQSSFTAVtiegmRVMLFTHPLNfkGRWL---rDRLNLWLTDnqRIYNVGQVSIG  338
DSSP  lllLLLLLLEEEEeelleEEEEEEEELLllLLLL---lLLEEEEEELllLEEEEEELLLL


DSSP  LlLLLLLEEEEELL----------------------------------------------
Query VkFGXISTICPIRE----------------------------------------------  274
ident                                                             
Sbjct D-ENSAYSSVLYKDdklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssi  397
DSSP  L-LLLLLEEEEELLlleeeeeeeeelleeeeeeeelhhhhhhhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct ctpagcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalw  457
DSSP  lllllllllllllleeeeeeeeellleeeelllllleeeeleeeelleeeellllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct pvsqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqw  517
DSSP  elhhhllllllhhhhleeeeeeeeeelllllleeeeeeeellllllleeeeeeeelllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct qpiygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishf  577
DSSP  eeeellllllllllllllleeeeeeeeelleeeeeelleellllleelllllllllllee


DSSP  -------------------------------------------------
Query -------------------------------------------------  274
ident                                                  
Sbjct yvggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahm  626
DSSP  eellllllllllllleeeeeeeeelllllhhhhhhhhhlllllllhhhl


No 81: Query=mol1A Sbjct=3ei1A Z-score=13.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk   60
DSSP  lleeeeeeeelllllleeeeelllllllleeeeeelleeeeeelllllleeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi  120
DSSP  eeeeeeelllllllleeeeeellleeeeeeeeeelleeeeeeeeeeelllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf  180
DSSP  eeeellllleeeeelllleeeeeelllllllllleeeellllleeeeeellllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh  240
DSSP  eeeelleeeeeeeeeelllleeeellllleeellllleeeellllllleeeelllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqvtlkdlrvel  300
DSSP  elleeeeellhhhhllleeeeeelllllleeeeeellleeeeeeeeeellleeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpivdmcv  360
DSSP  eeellllleeeeeelleeeeellllleeeeeelllllllllleeeeeeellllleeeeee


DSSP  -------------------------------------------------------LLLEe
Query -------------------------------------------------------SPQHl    5
ident                                                             
Sbjct vdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnrETDDt  420
DSSP  elllllllleeeeeellhhhleeeeeeellleeeeeeeellleeeeeeellllllLLLLe


DSSP  eeELLLLLEEEEEEllllEEEE--eeELLLlLLLLEEEELLLLLEEEELLLEEEEELLL-
Query lvGGSGWNKIAIINkdtkEIVW--eyPLEKgWECNSVAATKAGEILFSYSKGAKXITRD-   62
ident                                                  |          
Sbjct lvLSFVGQTRVLMLngeeVEETelmgFVDD-QQTFFCGNVAHQQLIQITSASVRLVSQEp  479
DSSP  eeEEELLEEEEEEEelleEEEEllllLLLL-LLEEEEEEELLLEEEEEELLLEEEEELLl


DSSP  LLEEEEEELL-LLLEEEEEEElllLLEEEEEELlLEEEEEELL--LLLEeEEEEeLLLLl
Query GRELWNIAAP-AGCEXQTARIlpdGNALVAWCGhPSTILEVNX--KGEVlSKTEfETGIe  119
ident          | |                |   |                      |    
Sbjct KALVSEWKEPqAKNISVASCN---SSQVVVAVG-RALYYLQIHpqELRQ-ISHT-EMEH-  532
DSSP  LLEEEEELLLlLLLLLEEEEL---LLEEEEEEL-LEEEEEEELllLEEE-EEEE-ELLL-


DSSP  lhhHLLLlLEELL----LLLEEEEELLLLEEEEELL-LLLEEEEEELL--LLLLEEEELL
Query rphAQFRqINKNK----KGNYLVPLFATSEVREIAP-NGQLLNSVKLS--GTPFSSAFLD  172
ident                         |      |        ||    |     | |     
Sbjct ---EVAC-LDITPlgglSPLCAIGLWTDISARILKLpSFELLHKEMLGgeIIPRSILMTT  588
DSSP  ---LEEE-EELLLllllLLEEEEEELLLLEEEEEELlLLLEEEEEELLllLLEEEEEEEE


DSSP  ---LLLEEEELLlLLEEEEELLL----LLLEEEEEEHhhllllLLLEEeEEEELLL---L
Query ---NGDCLVACGdAHCFVQLNLE----SNRIVRRVNAndiegvQLFFVaQLFPLQN---G  222
ident        | | |         |            |               |         
Sbjct fesSHYLLCALG-DGALFYFGLNietgLLSDRKKVTL------GTQPT-VLRTFRSlstT  640
DSSP  ellEEEEEEEEL-LLEEEEEEELllllLEEEEEEEEL------LLLLL-EEEEEEElleE


DSSP  LEEEEE---------ellllllhhHLLLLLEEE---ellllleEEEELLLLL--------
Query GLYICN---------wqghdreagKGKHPQLVE---idsegkvVWQLNDKVK--------  262
ident     |                     |                    |            
Sbjct NVFACSdrptviyssnhklvfsnvNLKEVNYMCplnsdgypdsLALANNSTLtigtidei  700
DSSP  EEEEELllleeeeelllleeeeelLLLLLLEEEeellllllleEEEELLLEEeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct qklhirtvplyesprkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvss  760
DSSP  lleeeeeeellleeeeeeeehhhleeeeeeeeeeeellllleeelllllllllleeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct sklfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvyp  820
DSSP  lllllleeeeeeeeeeellllleeeeeelllleeeeeeeeelllllllleeeeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct eeaepkqgrivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewtteke  880
DSSP  llllllleeeeeeeelllleeeeeeeeelllllleeeelleeeeeelleeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct lrtecnhynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsave  940
DSSP  eeeeeeellllleeeeeeelleeeeeelllleeeeeeelllleeeeeeelllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct ildddnflgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqptq 1000
DSSP  eeelleeeeeellleeeeeelllllllhhhhllleeeeeeelllleeeeeelllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gsvlfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhterktepa 1060
DSSP  eeeeeeelllleeeeeeelhhhhhhhhhhhhhhhhhlllhhhllhhhhhleelllleell


DSSP  ---------------------------------llllleeeeell
Query ---------------------------------fgxisticpire  274
ident                                              
Sbjct tgfidgdliesfldisrpkmqevvanlqataddlikvveeltrih 1105
DSSP  lleeehhhhhhhhhllhhhhhhhlllllllhhhhhhhhhhhhhhl


No 82: Query=mol1A Sbjct=3e0cA Z-score=13.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct synyvvtaqkptavngcvtghftedlnlliakntrleiyvvtlrpvkevgmygkiavmel   60
DSSP  lleeeeeeelllllleeeeelllllleeeeeelleeeeeellleeeeeeelllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct frpkgkdllfiltakynacileyksidiitrahgnvqdrgiigiidpecrmiglrlydgl  120
DSSP  elllllleeeeeellleeeeeeelllleeeeeeeelllllleeeellllleeeeeeelle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct fkvipldnkelkafnirleelhvidvkflygcqapticfvyqdprhvktyevslrekefn  180
DSSP  eeeeelllllllleeeellllleeeeeellllllleeeeeelllleeeeeeeelllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kgwkqnveaeasmviavpepfggaiiigqesityhngylaiappiikqstivchnrvdpn  240
DSSP  ellllllllllleeeellllllleeeelllleeeelllleellhhhlllleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gsryllgdmegrlfmlllekdgtvtlkdlrvellgetsiaecltyldgvvfvgsrlgdsq  300
DSSP  lleeeeeellleeeeeeeelllllllleeeeeeeeellleeeeeellleeeeeellllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lvklnvyvvametftnlgpivdmcvvdqgqlvtcsgafkegslriirngigihehasidl  360
DSSP  eeeellleeeeeeellllleeeeeeellleeeeeellhhhleeeeeeellleeeeeeeel


DSSP  -------------LLLEEEeELLLLLEEEEEElllleEEEE--EELLllLLLLEEEELLL
Query -------------SPQHLLvGGSGWNKIAIINkdtkeIVWE--YPLEkgWECNSVAATKA   45
ident                   |                                         
Sbjct pgikglwplrsdpETDDTLvLSFVGQTRVLML-----ETELmgFVDD--QQTFFCGNVAH  413
DSSP  lllleeeeellllLLLLEEeEEELLEEEEEEL-----LLLLllLLLL--LLEEEEEEELL


DSSP  LLEEEELLLEEEEELL-LLLEEEEEELL-LLLEEEEEEElllLLEEEEEELlLEEEEEEL
Query GEILFSYSKGAKXITR-DGRELWNIAAP-AGCEXQTARIlpdGNALVAWCGhPSTILEVN  103
ident        |                   | |                |   |         
Sbjct QQLIQITSASVRLVSQePKALVSEWKEPqAKNISVASCN---SSQVVVAVG-RALYYLQI  469
DSSP  LEEEEEELLLEEEEELlLLLEEEEELLLlLLLLLEEEEL---LLEEEEEEL-LEEEEEEE


DSSP  L--LLLEeEEEEeLLLLllhhHLLLlLEELL---LLLEEEEELLLLEEEEELL-LLLEEE
Query X--KGEVlSKTEfETGIerphAQFRqINKNK---KGNYLVPLFATSEVREIAP-NGQLLN  157
ident              |                           |      |        || 
Sbjct HpqELRQ-ISHT-EMEH----EVAC-LDITPlglSPLCAIGLWTDISARILKLpSFELLH  522
DSSP  EllEEEE-EEEE-ELLL----LEEE-EELLLlllLLEEEEEELLLLEEEEEELlLLLEEE


DSSP  EEELL--LLLLEEEELL---LLLEEEELlLLLEEEEELLL----LLLEeEEEEHhhllll
Query SVKLS--GTPFSSAFLD---NGDCLVACgDAHCFVQLNLE----SNRIvRRVNAndiegv  208
ident    |     | |            | |           |            |        
Sbjct KEMLGgeIIPRSILMTTfesSHYLLCAL-GDGALFYFGLNietgLLSD-KKVTL------  574
DSSP  EEELLllLLEEEEEEEEellEEEEEEEE-LLLEEEEEEELllllLEEL-LEEEL------


DSSP  LLLEEeEEEELLL--LLEEEEE--------ellllllhhhLLLLLEEE--ellllleEEE
Query QLFFVaQLFPLQN--GGLYICN--------wqghdreagkGKHPQLVE--idsegkvVWQ  256
ident        |            |                    |                  
Sbjct GTQPT-VLRTFRSstTNVFACSdrptviysnhklvfsnvnLKEVNYMCplnsdgypsLAL  633
DSSP  LLLLL-EEEEEELllEEEEEELllleeeellllleeeellLLLLLEEEellllllllEEE


DSSP  ELLLLL------------------------------------------------------
Query LNDKVK------------------------------------------------------  262
ident  |                                                          
Sbjct ANNSTLtigtideiqklhirtvplyesprkicyqevsqcfgvlssrievalrpsastqal  693
DSSP  ELLLEEeeeeellllleeeeeeellleeeeeeeehhhleeeeeeeeelllllllhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct sssvsvevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypep  753
DSSP  eeeelleeeeeeeeellllleeeeeelllleeeeeeeeelllllllleeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct kqgrivvfqygklqtvaekevkgavysmvefngkllasinstvrlyewttekelrtecnh  813
DSSP  lleeeeeeelllleeeeeeeellleeeeeeelleeeeeelleeeeeeellllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct ynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveildddnf  873
DSSP  llllleeeeeeelleeeeeelllleeeeeeelllleeeeeeelllllleeeeeeeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct lgaenafnlfvcqqhlqevglfhlgefvnvfchgslvtqgsvlfgtvngmiglvtslses  933
DSSP  eeeellleeeeellllleeeeeelllleeeeeellllleeeeeeeelllleeeeeellhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct wynllldmqnrlnkviksvgkiehsfwrsfhtetepatgfidgdliesfldisrpkmqev  993
DSSP  hhhhhhhhhhhhhhhllllllllhhhhlllllllllllleeehhhhhhhhlllhhhhhhh


DSSP  ------llllleeeeell
Query ------fgxisticpire  274
ident                   
Sbjct vataddlikvveeltrih 1011
DSSP  hllhhhhhhhhhhhhlll


No 83: Query=mol1A Sbjct=2cn3A Z-score=13.4

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelLLLLLLlEEEEL--LLLLEEEELL-LEEE
Query spqhllvggsgwnkiaiinkdtkeivweyplEKGWECnSVAAT--KAGEILFSYS-KGAK   57
ident                                  |               |       || 
Sbjct ----------------vtsvpykwdnvviggGGGFMP-GIVFNetEKDLIYARAAiGGAY   43
DSSP  ----------------leelleeeeeellllLLLLLL-EEEELllLLLLEEEELLlLLEE


DSSP  EELL-LLLEEEEEE----lLLLL-EEEEEEEL-LLLL-EEEEEEL-------LLEEEEEE
Query XITR-DGRELWNIA----aPAGC-EXQTARIL-PDGN-ALVAWCG-------HPSTILEV  102
ident                                   | |                   ||  
Sbjct RWDPsTETWIPLLDhfqmdEYSYyGVESIATDpVDPNrVYIVAGMytndwlpNMGAILRS  103
DSSP  EEELlLLEEEELLLlllhhHHHHhLEEEEEELlLLLLlEEEEELLlllllllLLLEEEEE


DSSP  LLLLLEEEEEEELLllllHHHL-------lLLLEEL--LLLLEEEEELLLLEEEEE--LL
Query NXKGEVLSKTEFETgierPHAQ-------fRQINKN--KKGNYLVPLFATSEVREI--AP  151
ident    ||   ||                                                  
Sbjct TDRGETWEKTILPF----KMGGnmpgrsmgERLAIDpnDNRILYLGTRCGNGLWRStdYG  159
DSSP  LLLLLLLEEEELLL----LLLLllllllllLLEEELllLLLLEEEELLLLLLEEEEllLL


DSSP  LLlEEEE--EELLL---------------LLLEEEELLL--------LLEEEELLL-lLE
Query NGqLLNS--VKLSG---------------TPFSSAFLDN--------GDCLVACGD-aHC  185
ident              |                     |               |   |    
Sbjct VT-WSKVesFPNPGtyiydpnfdytkdiiGVVWVVFDKSsstpgnptKTIYVGVADknES  218
DSSP  LL-LEELllLLLLLlllllllllllllllLEEEEEELHHhlllllllLLEEEEELLllLL


DSSP  EEEELLLlLLEEEEEehHHLLllLLLEEEEEEELLLLLEEEEEELLL---LLLHhhllLL
Query FVQLNLEsNRIVRRVnaNDIEgvQLFFVAQLFPLQNGGLYICNWQGH---DREAgkgkHP  242
ident               |                    || |||         |         
Sbjct IYRSTDG-GVTWKAV--PGQP--KGLLPHHGVLASNGMLYITYGDTCgpyDGNG----KG  269
DSSP  EEEELLL-LLLLEEL--LLLL--LLLEEEEEEELLLLEEEEEEELLLlllLLLL----LE


DSSP  LEEEELL--LLLEeEEELL-----------------------------------LLLL--
Query QLVEIDS--EGKVvWQLND-----------------------------------KVKF--  263
ident |                                                        |  
Sbjct QVWKFNTrtGEWI-DITPIpysssdnrfcfaglavdrqnpdiimvtsmnawwpdEYIFrs  328
DSSP  EEEEEELllLLEE-ELLLLllllllllleeeeeeellllllleeeeeellllllLLEEee


DSSP  --------------------------------------------------LLLLeEEEEL
Query --------------------------------------------------GXIStICPIR  273
ident                                                        |    
Sbjct tdggatwkniwewgmyperilhyeidisaapwldwgtekqlpeinpklgwMIGD-IEIDP  387
DSSP  llllllleeleeellllleeeleeeellllhhhhllllllllllllllllLLLL-EEELL


DSSP  L-----------------------------------------------------------
Query E-----------------------------------------------------------  274
ident                                                             
Sbjct Fnsdrmmyvtgatiygcdnltdwdrggkvkievkatgieecavldlvsppegaplvsavg  447
DSSP  Llllleeeelllleeeellhhhhhhllleeeeellllllllleeeeellllllleeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct dlvgfvhddlkvgpkkmhvpsyssgtgidyaelvpnfmalvakadlydvkkisfsydggr  507
DSSP  llllleelllllllllllllllleeeeeeeelleeeeeeeeeelllllllleeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct nwfqppneapnsvgggsvavaadaksviwtpenaspavttdngnswkvctnlgmgavvas  567
DSSP  lllllllllllllllleeeelllllleeeelllllleeellllllleelllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct drvngkkfyafyngkfyistdggltftdtkapqlpksvnkikavpgkeghvwlaareggl  627
DSSP  llllllleeeeelleeeeellllllleellllllllllleeeeelleeeeeeeellllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct wrstdggytfeklsnvdtahvvgfgkaapgqdymaiyitgkidnvlgffrsddagktwvr  687
DSSP  eeellllllleellllleeeeeeeellllllllleeeeeeeelleeeeeeelllllllee


DSSP  -----------------------------------------
Query -----------------------------------------  274
ident                                          
Sbjct inddehgygavdtaitgdprvygrvyiatngrgivygepas  728
DSSP  lllllllllllllleeeelleeeeeeeellllleeeeeell


No 84: Query=mol1A Sbjct=1iubA Z-score=13.4

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeELLLLLLLLEEEELLL---LLEEEELL----
Query spqhllvggsgwnkiaiinkdtkeivweyPLEKGWECNSVAATKA---GEILFSYS----   53
ident                                             |               
Sbjct ----------------------------pTEFLYTSKIAAISWAAtggRQQRVYFQdlng   32
DSSP  ----------------------------lLLLLLLLLEEEEEELLlllLEEEEEEEllll


DSSP  LEEEEELL---LLLE---eEEEELLLLLEEEEEEELLL---LLEEEEEEL--LLEEEEEE
Query KGAKXITR---DGRE---lWNIAAPAGCEXQTARILPD---GNALVAWCG--HPSTILEV  102
ident |                    |          |            |              
Sbjct KIREAQRGgdnPWTGgssqNVIGEAKLFSPLAAVTWKSaqgIQIRVYCVNkdNILSEFVY   92
DSSP  EEEEEEEElllLLEEllhhHEEEELLLLLLLEEEEEEElleEEEEEEEELllLLEEEEEE


DSSP  LLLlLEEEEEE--ELLLLLLhhHLLLLLEELL-----LLLEEEEELL-----LLEEEEEL
Query NXKgEVLSKTE--FETGIERphAQFRQINKNK-----KGNYLVPLFA-----TSEVREIA  150
ident                                        |  |          |      
Sbjct DGS-KWITGQLgsVGVKVGS--NSKLAALQWGgsesaPPNIRVYYQKsngsgSSIHEYVW  149
DSSP  LLL-LEEELLHhhHLLLLLL--LLLLEEEEELlllllLLEEEEEELLlllllLLEEEEEE


DSSP  LLLLEEEEEELLL---LLLEEEELLLLLEEEELLL---lLEEEEELLLLlLEEEEEEhhh
Query PNGQLLNSVKLSG---TPFSSAFLDNGDCLVACGD---aHCFVQLNLESnRIVRRVNand  204
ident            |    |         |                     |   |       
Sbjct SGKWTAGASFGSTvpgTGIGATAIGPGRLRIYYQAtdnkIREHCWDSNS-WYVGGFS---  205
DSSP  LLLEEEEEEELLLlllLLEEEEEEELLEEEEEEELllleEEEEEELLLL-EEEEEEE---


DSSP  lllLLLL--eeEEEEELL-LLLEEEEEELLllllhhhlllLLEEEELL-LLLEEEEELL-
Query iegVQLF--fvAQLFPLQ-NGGLYICNWQGhdreagkgkhPQLVEIDS-EGKVVWQLND-  259
ident                              |                         |  | 
Sbjct ---ASASagvsIAAISWGsTPNIRVYWQKG--------reELYEAAYGgSWNTPGQIKDa  254
DSSP  ---EELLllleEEEEEELlLLEEEEEEELL--------llLEEEEEELlLLLLLEEELLl


DSSP  -LLLLL---llLEEEEEL---------------------------------------l
Query -KVKFG---xiSTICPIR---------------------------------------e  274
ident                                                           
Sbjct sRPTPSlpdtfIAANSSGnidisvffqasgvslqqwqwisgkgwsigavvptgtpagw  312
DSSP  lLLLLLlllllLEEEEELlleeeeeeeellleeeeeeeellleeeellllllllllll


No 85: Query=mol1A Sbjct=2cn2A Z-score=13.2

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelLLLLLLlEEEEL--LLLLEEEELL-LEEE
Query spqhllvggsgwnkiaiinkdtkeivweyplEKGWECnSVAAT--KAGEILFSYS-KGAK   57
ident                                  |               |       || 
Sbjct ----------------vtsvpykwdnvviggGGGFXP-GIVFNetEKDLIYARADiGGAY   43
DSSP  ----------------leelleeeeeellllLLLLLL-EEEELllLLLLEEEELLlLLEE


DSSP  EELLL-LLEEEEEE----lLLLL-EEEEEEELLL--LLEEEEEEL-------LLEEEEEE
Query XITRD-GRELWNIA----aPAGC-EXQTARILPD--GNALVAWCG-------HPSTILEV  102
ident                                 |                       ||  
Sbjct RWDPStETWIPLLDhfqxdEYSYyGVESIATDPVdpNRVYIVAGXytndwlpNXGAILRS  103
DSSP  EEELLlLEEEELLLlllhhHHHHhLEEEEEELLLllLLEEEEELLlllllllLLLEEEEE


DSSP  LLLLLEEEEEEELLllllHHHL-------lLLLEEL--LLLLEEEEELLLLEEEEE--LL
Query NXKGEVLSKTEFETgierPHAQ-------fRQINKN--KKGNYLVPLFATSEVREI--AP  151
ident    ||   ||                                                  
Sbjct TDRGETWEKTILPF----KXGGnxpgrsxgERLAIDpnDNRILYLGTRCGNGLWRStdYG  159
DSSP  LLLLLLLEEEELLL----LLLLllllllllLLEEELllLLLLEEEELLLLLLEEEEllLL


DSSP  LLlEEEE--EELLL---LLLEEEELLL--------LLEEEELLL-lLEEEEELLLlLLEE
Query NGqLLNS--VKLSG---TPFSSAFLDN--------GDCLVACGD-aHCFVQLNLEsNRIV  197
ident              |         |               |   |                
Sbjct VT-WSKVesFPNPGtiiGVVWVVFDKSsstpgnptKTIYVGVADknESIYRSTDG-GVTW  217
DSSP  LL-LEELllLLLLLlllLEEEEEELHHhlllllllLLEEEEELLllLLEEEELLL-LLLL


DSSP  EEEehHHLLllLLLEEEEEEELLLLLEEEEEELlllllhhhlLLLLEEEELL-LLLEEEE
Query RRVnaNDIEgvQLFFVAQLFPLQNGGLYICNWQghdreagkgKHPQLVEIDS-EGKVVWQ  256
ident   |                    || |||                |        |     
Sbjct KAV--PGQP--KGLLPHHGVLASNGXLYITYGD---------GKGQVWKFNTrTGEWIDI  264
DSSP  EEL--LLLL--LLLEEEEEEELLLLEEEEEEEL---------LLEEEEEEELlLLLEEEL


DSSP  ELL----------------------------------lLLLL------------------
Query LND----------------------------------kVKFG------------------  264
ident                                                             
Sbjct TPIpysssdnrfcfaglavdrqnpdiixvtsxnawwpdEYIFrstdggatwkniwewgxy  324
DSSP  LLLllllllllleeeeeeellllllleeeeeellllllLLEEeellllllleeleeelll


DSSP  ----------------------------------llLEEEEELL----------------
Query ----------------------------------xiSTICPIRE----------------  274
ident                                       |                     
Sbjct perilhyeidisaapwldwgtekqlpeinpklgwxiGDIEIDPFnsdrxxyvtgatiygc  384
DSSP  lleeeleeeellllhhhhllllllllllllllllllLLEEELLLlllleeeelllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct dnltdwdrggkvkievkatgieecavldlvsppegaplvsavgdlvgfvhddlkvgpkkx  444
DSSP  llhhhhhhllleeeeellllllllleeeeellllllleeeeelllllleellllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct hvpsyssgtgidyaelvpnfxalvakavkkisfsydggrnwfqppneapnsvgggsvava  504
DSSP  lllllleeeeeeellllllleeeeeelllleeeellllllllllllllllllllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct adaksviwtpenaspavttdngnswkvctnlgxgavvasdrvngkkfyafyngkfyistd  564
DSSP  llllleeeelllllleeellllllleelllllllleeeellllllleeeeelleeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct ggltftdtkapqlpksvnkikavpgkeghvwlaaregglwrstdggytfeklsnvdtahv  624
DSSP  llllleellllllllllleeeellllllleeeellllleeeellllllleellllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct vgfgkaapgqdyxaiyitgkidnvlgffrsddagktwvrinddehgygavdtaitgdprv  684
DSSP  eeeellllllllleeeeeeeelleeeeeeellllllleelllllllllllllleeeelle


DSSP  --------------------
Query --------------------  274
ident                     
Sbjct ygrvyiatngrgivygepas  704
DSSP  eeeeeeellllleeeeeell


No 86: Query=mol1A Sbjct=1vcuB Z-score=13.2

back to top
DSSP  -----------------------------lLLEEEEELLLL---------lEEEEEEL--
Query -----------------------------sPQHLLVGGSGW---------nKIAIINK--   20
ident                                | ||                         
Sbjct maslpvlqkesvfqsgahayripallylpgQQSLLAFAEQRaskkdehaelIVLRRGDyd   60
DSSP  llllllleeeeeeelllleeeeeeeeeellLLEEEEEEEEEllllhhheeeEEEEEEEee


DSSP  -----LLLEEEEEEE----llLLLLLLEEEELL--LLLEEEEL-----------------
Query -----DTKEIVWEYP----leKGWECNSVAATK--AGEILFSY-----------------   52
ident                                        ||                   
Sbjct apthqVQWQAQEVVAqarldgHRSMNPCPLYDAqtGTLFLFFIaipgqvteqqqlqtran  120
DSSP  lllleEEELLLEELLllllllEEEEEEEEEELLllLLEEEEEEeeellllhhhhhhllll


DSSP  -lLEEEEELL----LLLEEEEEE--------llLLLEEEE--eEELLL---LLEEEEEEL
Query -sKGAKXITR----DGRELWNIA--------apAGCEXQT--aRILPD---GNALVAWCG   94
ident                                                        |    
Sbjct vtRLCQVTSTdhgrTWSSPRDLTdaaigpayreWSTFAVGpghCLQLNdraRSLVVPAYA  180
DSSP  llEEEEEEELllllLLLLLEELHhhhlhhhhllEEEEEELlllLEELLlllLLEEEEEEE


DSSP  L-----------LEEEEEEL--LLLLEeEEEEELLLlllhhhLLLLLEELL-----LLLE
Query H-----------PSTILEVN--XKGEVlSKTEFETGierphaQFRQINKNK-----KGNY  136
ident                                                             
Sbjct YrklhpiqrpipSAFCFLSHdhGRTWA-RGHFVAQD------TLECQVAEVetgeqRVVT  233
DSSP  EelllllllleeEEEEEEELllLLLLE-ELLLLLLL------LLLEEEEEEeelleEEEE


DSSP  EEEELLL-LEEEEEL----LLLLEEEEE-ELLL-----LLLEEEELLL-----LLEEEEL
Query LVPLFAT-SEVREIA----PNGQLLNSV-KLSG-----TPFSSAFLDN-----GDCLVAC  180
ident |         |           |    | ||          |              |   
Sbjct LNARSHLrARVQAQStndgLDFQESQLVkKLVEpppqgCQGSVISFPSprspaQWLLYTH  293
DSSP  EEELLLLlEEEEEEEllllLLLLLLEEEeEEELlllllLLLEEEEEELlllllEEEEEEE


DSSP  L------LLLEEEEEL-LLLL-LEEEEEEHhhllllLLLEEEEEEELLL-----LLEEEE
Query G------DAHCFVQLN-LESN-RIVRRVNAndiegvQLFFVAQLFPLQN-----GGLYIC  227
ident                            |               |                
Sbjct PthswqrADLGAYLNPrPPAPeAWSEPVLL----akGSCAYSDLQSMGTgpdgsPLFGCL  349
DSSP  EllllllEEEEEEEELlLLLHhHLLLLEEE----eeEEEEEEEEEEEEElllllEEEEEE


DSSP  EELLLLLlhhhllLLLEEEELLLLleeeeelllllllllleeeeell
Query NWQGHDReagkgkHPQLVEIDSEGkvvwqlndkvkfgxisticpire  274
ident                                                
Sbjct YEANDYE------EIVFLMFTLKQ-----------------afpaey  373
DSSP  EEELLLL------EEEEEEEEHHH-----------------hlllll


No 87: Query=mol1A Sbjct=2aq5A Z-score=13.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sskfrhvfgqpakadqcyedvrvsqttwdsgfcavnpkfmalixeasgggaflvlplgkt   60
DSSP  llllllleeeellhhhleellllllllllllleeellleeeeelllllllleeeeellll


DSSP  -------------------------lLLEEEEEllLLLEEEEEELLL-------leEEEE
Query -------------------------sPQHLLVGgsGWNKIAIINKDT-------keIVWE   28
ident                                 |                        |  
Sbjct grvdknvplvxghtapvldiawxphnDNVIASG-sEDCTVMVWEIPDgglvlplrePVIT  119
DSSP  eelllllllllllllleeeeeellllLLEEEEE-eLLLEEEEEELLLlllllllllLLEE


DSSP  EELLLLLLLlEEEEL--LLLLEEEELL-LEEEEELL-LLLEEEEE---ELLLllEEEEEE
Query YPLEKGWECnSVAAT--KAGEILFSYS-KGAKXITR-DGRELWNI---AAPAgcEXQTAR   81
ident            ||         |               |           |         
Sbjct LEGHTKRVG-IVAWHptAQNVLLSAGXdNVILVWDVgTGAAVLTLgpdVHPD--TIYSVD  176
DSSP  EELLLLLEE-EEEELllLLLEEEEEELlLLEEEEELlLLEEEEEElllLLLL--LEEEEE


DSSP  ELLLL-LEEEEEELlLEEEEEELlLLLEEEEEEEL-LLLLlhhHLLLlLEELLLLLEEEE
Query ILPDG-NALVAWCGhPSTILEVNxKGEVLSKTEFE-TGIErphAQFRqINKNKKGNYLVP  139
ident    ||                                                 |  |  
Sbjct WSRDGaLICTSCRD-KRVRVIEP-RKGTVVAEKDRpHEGT---RPVH-AVFVSEGKILTT  230
DSSP  ELLLLlLEEEEELL-LEEEEEEL-LLLEEEEEEELlLLLL---LLLE-EEELLLLEEEEE


DSSP  EL---LLLEEEEELL-LLLEE-EEEEL---LLLLlEEEEL-LLLLEEEELLLLLEEEEEL
Query LF---ATSEVREIAP-NGQLL-NSVKL---SGTPfSSAFL-DNGDCLVACGDAHCFVQLN  190
ident  |       |                |   ||      |  |                  
Sbjct GFsrmSERQVALWDTkHLEEPlSLQELdtsSGVL-LPFFDpDTNIVYLCGKGDSSIRYFE  289
DSSP  EElllLLEEEEEEELlLLLLLlEEEELlllLLLE-EEEEElLLLEEEEEELLLLLEEEEE


DSSP  LL----LLLEEEEEEHHhllllLLLEEEeEEELLL--------LLEEEEEELlllllhhh
Query LE----SNRIVRRVNANdiegvQLFFVAqLFPLQN--------GGLYICNWQghdreagk  238
ident                                                             
Sbjct ITseapFLHYLSMFSSK-----ESQRGM-GYMPKRglevnkxeIARFYKLHE--------  335
DSSP  ELllllLEEEEEEELLL-----LLLLEE-EELLHHhllhhhleEEEEEEEEL--------


DSSP  llLLLEEEELLL--------------------------lleeeeelllllllllleeeee
Query gkHPQLVEIDSE--------------------------gkvvwqlndkvkfgxisticpi  272
ident                                                             
Sbjct --RKCEPIAMTVprksdlfqedlypptagpdpaltaeewlggrdagpllislkdgyvppk  393
DSSP  --LEEEEEEEELlllllllllllllleelllllllhhhhhlllllllleellllllllll


DSSP  ll
Query re  274
ident   
Sbjct sr  395
DSSP  ll


No 88: Query=mol1A Sbjct=3a0fA Z-score=13.1

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelLLLLLLlEEEEL--LLLLEEEELL-LEEE
Query spqhllvggsgwnkiaiinkdtkeivweyplEKGWECnSVAAT--KAGEILFSYS-KGAK   57
ident                                  |       |       |       |  
Sbjct ----------------------aelkpvtisGGGFIS-GLVAHptEKDLIYARTDiGGTY   37
DSSP  ----------------------leeeellllLLLLEE-EEEELllLLLLEEEEELlLLEE


DSSP  EELLL-LLEEEEEE---------lLLLL-EEEEEEELLLL--LEEEEEE-----lLLEEE
Query XITRD-GRELWNIA---------aPAGC-EXQTARILPDG--NALVAWC-----gHPSTI   99
ident                          |           |        |             
Sbjct RWNAAkWEWEPITDfiinnalagnGANLlGTESIALDPHNpdRLYLAQGdyvqwdPWAAF   97
DSSP  EEELLlLEEEELLLllllllllllLLLLlLEEEEELLLLLllLEEEEELllllllLLLEE


DSSP  EEELLLLLEEEEEEELL---llllhhhllLLLEEL--LLLLEEEEELLLlEEEEELL-lL
Query LEVNXKGEVLSKTEFET---gierphaqfRQINKN--KKGNYLVPLFATsEVREIAP-nG  153
ident |     |                           |                         
Sbjct LVSDDRGKTFKQYRSPVpmgandmgrnggERLAVNphWTDELWFGSRTQ-GLWRSTDraQ  156
DSSP  EEELLLLLLLEEEELLLllllllllllllLLEEELllLLLLEEEELLLL-LEEEELLllL


DSSP  LEEEEE--ELLL----LLLEEEEL--LLLLEEEELLLLLEEEEELLllLLEEEEEehhhl
Query QLLNSV--KLSG----TPFSSAFL--DNGDCLVACGDAHCFVQLNLesNRIVRRVnandi  205
ident           |        |  |     |   ||                    |     
Sbjct TWSRMNqlPDSStygiGIISVIFDpkNVGTAYVASHAVGGLWVTWD-gGANWSQV----g  211
DSSP  LLEELLllLLLLllllLEEEEEELllLLLLEEEEELLLLLEEEELL-lLLLLEEL----l


DSSP  LLLL--------------------LLEEEEEEELLLLLEEEEEELLL---LLLHhhllll
Query EGVQ--------------------LFFVAQLFPLQNGGLYICNWQGH---DREAgkgkhp  242
ident                                    || |||                   
Sbjct GQPTqwsdwtksivaasgtaiqssGPLPIKIALGKNGRLYITYSDAPgpwGVLY-----g  266
DSSP  LLLLlllhhhhhhhhhhlllllllLLEEEEEEELLLLLEEEEEELLLlllLLLL-----e


DSSP  LEEEELL-LLLEEEEELLLL--------------lllLLLEEEE----------------
Query QLVEIDS-EGKVVWQLNDKV--------------kfgXISTICP----------------  271
ident      |   |                               |                  
Sbjct EVWSYDPtNGNWKHITPSREgantypaptgnkkvvpgGWNGISVgngdtvvvstldange  326
DSSP  EEEEEELlLLEEEELLLLLLllleellllllllllllEEEEEEEllllleeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct dsvylsrdagnswkdlgklttpagaggnsqkesdaklrngtplpwlsfqnrgsgivgfgw  386
DSSP  lleeeelllllleeehhhhhlllllllleeehhhlllllllllhhhhllllllleeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct wlaailldpfsdrllygtgaviwatdavsradsnqapswyintegieetailvlksppag  446
DSSP  lllleeelllllleeeelllleeeellhhhhhhllllleeellllllllleeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct pahlfsgmydlggmrhddfsvpqpmyskptfsstdgldfagraanvlarvgrndhpdagv  506
DSSP  lllleeeelllllllllllllllllllllllleeeeeeeelleeeeeeeeeellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct agctqgayttnsgdswtlfqtcvpslevgnggtiavgadgktfvwspskadgkgpytssd  566
DSSP  llllleeeellllllleelllllllllllllleeeelllllleeeellllllllleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct ygktwtapsglskqttgiaadrvqantfyvyvegdffvstdggksytkkgnglpccwtyt  626
DSSP  llllllllllllllllleeellllllleeeeelleeeeellllllleeelllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct gtpvtsnlragelwvsvkgvgiyhstdfgntftalagsgsslnpavfsigapqtpnatet  686
DSSP  eeeeellllllleeeeellleeeeellllllleelllllllleeeeeeeellllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  271
ident                                                             
Sbjct lflwgipsasqpeglymstdngglwtrlnddahnyggatvisgdpriygrvyigmngrgi  746
DSSP  eeeeeellllllleeeeellllllleelllllllllleeeeeelllllleeeeeelllle


DSSP  ----ell
Query ----ire  274
ident        
Sbjct icaqalg  753
DSSP  eeeelll


No 89: Query=mol1A Sbjct=1aomB Z-score=13.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc   60
DSSP  lhhhhhhhllllhhhllllllllhhhllllllllllllllllhhhhhhhhhhhhhhlhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll  120
DSSP  hlllllllllllllhhhhhhhlhhhhhhhhhlllllllllllllllllhhhhhhhhhhhh


DSSP  ------------------------------------llLEEEEELLLLLEEEEEELLLLE
Query ------------------------------------spQHLLVGGSGWNKIAIINKDTKE   24
ident                                           |       || |   | |
Sbjct ldpaappefgmkemreswkvhvapedrptqqmndwdleNLFSVTLRDAGQIALIDGSTYE  180
DSSP  llllllllllhhhhhhhleelllhhhllllllllllhhHEEEEEEHHHLEEEEEELLLLL


DSSP  EEEEEELLllLLLLEEEEL-LLLLEEEELLLE-EEEELL----LLLEEEEEELlllLEEE
Query IVWEYPLEkgWECNSVAAT-KAGEILFSYSKG-AKXITR----DGRELWNIAApagCEXQ   78
ident |                              |    |                    |  
Sbjct IKTVLDTG--YAVHISRLSaSGRYLFVIGRDGkVNMIDLwmkePTTVAEIKIG---SEAR  235
DSSP  EEEEEELL--LLEEEEEELlLLLEEEEEELLLeEEEEELllllLLEEEEEELL---LEEE


DSSP  EEEELL-----LLLEEEEEELlLEEEEEEL-LLLLEEEEEEELL-------LLLLhhHLL
Query TARILP-----DGNALVAWCGhPSTILEVN-XKGEVLSKTEFET-------GIERphAQF  125
ident            |  |       |           |                         
Sbjct SIETSKmegweDKYAIAGAYW-PPQYVIMDgETLEPKKIQSTRGmtydeqeYHPE--PRV  292
DSSP  EEEELLlllllLLEEEEEEEE-LLEEEEEElLLLLEEEEEELLEellllllEELL--LLE


DSSP  LLLEELL-LLLEEEEELLLLEEEEE----llllLEEEEEELLlLLLEEEELLL-LLEEEE
Query RQINKNK-KGNYLVPLFATSEVREI----apngQLLNSVKLSgTPFSSAFLDN-GDCLVA  179
ident   |          |    |                                        |
Sbjct AAILASHyRPEFIVNVKETGKILLVdytdlnnlKTTEISAER-FLHDGGLDGShRYFITA  351
DSSP  EEEEELLlLLEEEEEELLLLEEEEEellllleeEEEEEELLL-LEEEEEELLLlLEEEEE


DSSP  LLLLleEEEELL---lLLLEEEEE-----------------------------eHHHL--
Query CGDAhcFVQLNL---eSNRIVRRV-----------------------------nANDI--  205
ident                                                             
Sbjct ANAR-nKLVVIDtkegKLVAIEDTggqtphpgrganfvhptfgpvwatshmgddSVALig  410
DSSP  EHHH-lEEEEEEllllEEEEEEELlllllllllleeeeellleeeeeeelllllEEEEee


DSSP  -------------------lllLLLEeeeeeeLLLLleeeeeelllLLLHH-HLLL----
Query -------------------egvQLFFvaqlfpLQNGglyicnwqghDREAG-KGKH----  241
ident                          |                                  
Sbjct tdpeghpdnawkildsfpalggGSLF----ikTHPN-sqylyvdatLNPEAeISGSvavf  465
DSSP  llllllhhhllleeeeeellllLLLL----eeLLLL-lleeeelllLLLLHhHHLLeeee


DSSP  -------------------------------LLEEEellllleEEEELL------LLLL-
Query -------------------------------PQLVEidsegkvVWQLND------KVKF-  263
ident                                    |                        
Sbjct dikamtgdgsdpefktlpiaewagitegqprVVQGE-fnkdgtEVWFSVwngkdqESALv  524
DSSP  ehhhllllllllleeeelhhhhhllllllleEEEEE-elllllEEEEEEelllllLLEEe


DSSP  -------------------LLLLeEEEEL------l
Query -------------------GXIStICPIR------e  274
ident                                     
Sbjct vvddktlelkhvikderlvTPTG-KFNVYntmtdty  559
DSSP  eeelllleeeeeellllllLEEE-EEEHHhhhllll


No 90: Query=mol1A Sbjct=2zwaB Z-score=13.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lttikqtnknvkqerrkkyadlaiqgtnnssiaskrsvellylpklssannfqmdknnkl   60
DSSP  lllhhhhlllhhhhhhhhhhhhhhllllllhhhhhhhhhhhlhhhllhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct leyfkffvpkkikrspcinrgywlrlfairsrlnsiieqtpqdkkivvvnlgcgydplpf  120
DSSP  lllhhhlllllllllhhhhhhhhhhhhhhhhhhhhhhhhllllleeeeeeellllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qlldtnniqsqqyhdrvsfididysdllkikieliktipelskiiglseyvddsnvdflt  180
DSSP  hhhllllhhhhhhllleeeeeeelhhhhhhhhhhhhhlhhhhhhhlllllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tpkylarpcdlndskmfstllnecqlydpnvvkvfvaevslaymkpersdsiieatskme  240
DSSP  llleeeeelllllhhhhhhhhhhllllllleeeeeeeellhhhllhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nshfiileqlipkgpfepfskqmlahfkrndsplqsvlkyntiesqvqrfnklgfayvnv  300
DSSP  leeeeeeeellllllllhhhhhhhhhhhhllllllhhhllllhhhhhhhhhhlllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gdmfqlwesadeatkkellkvepfdeleefhlfchhyvlchatnykefaftqgflfdrin  360
DSSP  eehhhhhhhllhhhhhhhhhhlllllhhhhhhhhhleeeeeeelllllllllllllllll


DSSP  -------------------------llLEEEEELLL---LLEEEEEELL----lLEEEEE
Query -------------------------spQHLLVGGSG---WNKIAIINKD----tKEIVWE   28
ident                                  |                         |
Sbjct ltvdedyqllececpinrkfgdvdvagNDVFYMGGSnpyRVNEILQLSIhydkiDMKNIE  420
DSSP  leellleeeeelllllllllleeeeelLEEEEELLLlllLLLLEEEEEElllleEEEELL


DSSP  ----eELLLlLLLLEEEEL-LLLLEEEELL--------LEEEEELL--LLLEeEEEELLL
Query ----yPLEKgWECNSVAAT-KAGEILFSYS--------KGAKXITR--DGRElWNIAAPA   73
ident             |            |                                  
Sbjct vssseVPVA-RMCHTFTTIsRNNQLLLIGGrkaphqglSDNWIFDMktREWS-MIKSLSH  478
DSSP  lllllLLLL-LLLLEEEEElLLLEEEEELLllllllllLLLEEEELllLEEE-ELLLLLL


DSSP  LLEeEEEEELLLLLEEEEEEL-lleEEEEELL-LLLEeEEEEE---LLLLllhhHLLLLL
Query GCExQTARILPDGNALVAWCG-hpsTILEVNX-KGEVlSKTEF---ETGIerphAQFRQI  128
ident       |  ||||| |           |  |                             
Sbjct TRFrHSACSLPDGNVLILGGVtegpAMLLYNVtEEIF-KDVTPkdeFFQN---sLVSAGL  534
DSSP  LLLlLEEEELLLLLEEEELLLllllLEEEEELlLLEE-EELLLllhHHHL---lLLLLEE


DSSP  EEL-LLLLEEEEEL-------LLLEEEEELL-------LLLEEEEEE---LLLLLLEEEE
Query NKN-KKGNYLVPLF-------ATSEVREIAP-------NGQLLNSVK---LSGTPFSSAF  170
ident                                                             
Sbjct EFDpVSKQGIILGGgfmdqttVSDKAIIFKYdaenatePITVIKKLQhplFQRYGSQIKY  594
DSSP  EEElLLLEEEEELLlllllllLLLEEEEEEElllllllLEEEEEEEElhhHLLLLLEEEE


DSSP  LLLLLEEEELLLL--------lEEEEELLLLLLEeEEEEHH--hLLLLLLLEE-EEEEEL
Query LDNGDCLVACGDA--------hCFVQLNLESNRIvRRVNAN--dIEGVQLFFV-AQLFPL  219
ident       |   |               |   |              |   |      |   
Sbjct ITPRKLLIVGGTSpsglfdrtnSIISLDPLSETL-TSIPISrriWEDHSLMLAgFSLVST  653
DSSP  EELLEEEEELLLLlllllllllLEEEEELLLLEE-EELLLLhhhHHHLLLLLLlEEEEEE


DSSP  LLLLEEEEEELlLLLLhHHLLLLLEEEELLLlleeeeelllllllllleeeeell
Query QNGGLYICNWQgHDREaGKGKHPQLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident   |   |                                                
Sbjct SMGTIHIIGGG-ATCYgFGSVTNVGLKLIAI-----------------------x  684
DSSP  ELLEEEEEELE-ELHHhLLLEELLLEEEEEL-----------------------l


No 91: Query=mol1A Sbjct=1nexB Z-score=13.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvspk   60
DSSP  llllhhhhllhhhhhhhhllllhhhhhhhllllhhhhhhhhlllhhhhhhhhhlllllhh


DSSP  ------------------------------------------llleeeeellllleeeeE
Query ------------------------------------------spqhllvggsgwnkiaiI   18
ident                                                             
Sbjct gfnslnlklsqkypklsqqdrlrlsflenifilknwynpkfvpqrttlrghxtsvitclQ  120
DSSP  hhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhhhhhlllllleeeeeelllllleeeeE


DSSP  ELLLLEE-------------------------------------EEEEELLL--------
Query NKDTKEI-------------------------------------VWEYPLEK--------   33
ident   |   |                                                     
Sbjct FEDNYVItgaddkxirvydsinkkfllqlsghdggvwalkyahgGILVSGSTdrtvrvwd  180
DSSP  EELLEEEeeellleeeeeelllleeeeeeellllleeeeeeellLEEEEEELllleeeee


DSSP  --------------LLLLlEEEELL---LLLEEEELLL-EEEEELLL-------------
Query --------------GWECnSVAATK---AGEILFSYSK-GAKXITRD-------------   62
ident                                |                            
Sbjct ikkgccthvfeghnSTVR-CLDIVEyknIKYIVTGSRDnTLHVWKLPkdyplvfhtpeen  239
DSSP  lllleeeeeellllLLEE-EEEEEEellEEEEEEEELLlEEEEEELLlllleeellllll


DSSP  lLEEEE-EELLllLEEEEEEELlLLLEEEEEELllEEEEEELL-LLLEEEEEeELLLlll
Query gRELWN-IAAPagCEXQTARILpDGNALVAWCGhpSTILEVNX-KGEVLSKTeFETGier  120
ident                  |                  |           |           
Sbjct pYFVGVlRGHX--ASVRTVSGH-GNIVVSGSYD--NTLIVWDVaQXKCLYIL-SGHT---  290
DSSP  lLEEEEeELLL--LLEEEEEEE-LLEEEEEELL--LLEEEEELlLLEEEEEE-LLLL---


DSSP  hhHLLLLLEEL-LLLLEEEEELLlLEEEEELL-LLLEEEEEELL-LLLLEEEELLlLLEE
Query phAQFRQINKN-KKGNYLVPLFAtSEVREIAP-NGQLLNSVKLS-GTPFSSAFLDnGDCL  177
ident                            |     || |                 |     
Sbjct --DRIYSTIYDhERKRCISASXD-TTIRIWDLeNGELXYTLQGHtALVGLLRLSD-KFLV  346
DSSP  --LLEEEEEEElLLLEEEEEELL-LLEEEEELlLLLEEEEELLLlLLLLEEEELL-LEEE


DSSP  EELlLLLEEEEELLLLLLEEEEEEHHhllllLLLEEEeEEELLlLLEEEeEELL------
Query VACgDAHCFVQLNLESNRIVRRVNANdiegvQLFFVAqLFPLQnGGLYIcNWQG------  231
ident  |                              |             |             
Sbjct SAA-ADGSIRGWDANDYSRKFSYHHT-----NLSAITtFYVSD-NILVS-GSENqfniyn  398
DSSP  EEL-LLLEEEEEELLLLLEEEEEELL-----LLLLLLeEEELL-LEEEE-EELLeeeeee


DSSP  -------llllhHHLLLLLEEEELlllleEEEELL----LLLLlllleeeeell
Query -------hdreaGKGKHPQLVEIDsegkvVWQLND----KVKFgxisticpire  274
ident                     |                                 
Sbjct lrsgklvhanilKDADQIWSVNFK--gktLVAAVEkdgqSFLE------ildfs  444
DSSP  llllllllllllLLLLEEEEEEEE--lleEEEEEEllllEEEE------eeell


No 92: Query=mol1A Sbjct=1jjuB Z-score=12.9

back to top
DSSP  lLLEEEEEllllLEEEEEELLLLEEEEEEELLL-LLLLLEEEELLL-LLEEEEL--LLEE
Query sPQHLLVGgsgwNKIAIINKDTKEIVWEYPLEK-GWECNSVAATKA-GEILFSY--SKGA   56
ident      |       |   |                |                     |   
Sbjct -RDYILAP-arpDKLVVIDTEKMAVDKVITIADaGPTPMVPMVAPGgRIAYATVnkSESL   58
DSSP  -LEEEEEE-ellLEEEEEELLLLEEEEEEELLLlLLLLLLEEELLLlLEEEEEEllLLEE


DSSP  EEELL-LLLEEEEEELL---LLLEEE-EEEELLLL-LEEEEEEL----------LLEEEE
Query KXITR-DGRELWNIAAP---AGCEXQ-TARILPDG-NALVAWCG----------HPSTIL  100
ident   |    |  |  |              |   |||                    |    
Sbjct VKIDLvTGETLGRIDLStpeERVKSLfGAALSPDGkTLAIYESPvrlelthfevQPTRVA  118
DSSP  EEEELlLLLEEEEEELLlllEEEELLlLEEELLLLlEEEEEEEEeeeelleeeeLLLEEE


DSSP  EEL-LLLLEEEEEEELLllllhhhLLLLLEEL-LLLLEEEEElllLEEEEELL-LLLEEE
Query EVN-XKGEVLSKTEFETgierphaQFRQINKN-KKGNYLVPLfatSEVREIAP-NGQLLN  157
ident              |          |                           |  | |  
Sbjct LYDaETLSRRKAFEAPR-------QITMLAWArDGSKLYGLG---RDLHVMDPeAGTLVE  168
DSSP  EEElLLLEEEEEEELLL-------LLLLEEELlLLLLEEEEL---LLEEEEELlLLEEEE


DSSP  EEEL-----------LLLLLeeeelllllEEEEL--------------llllEEEEE-lL
Query SVKL-----------SGTPFssafldngdCLVAC--------------gdahCFVQL-nL  191
ident                                                             
Sbjct DKPIqsweaetyaqpDVLAV-wnqhessgVMATPfytarkdidpadptayrtGLLTMdlE  227
DSSP  EELLlllllllllllLLLLL-llllllllEEEEEeeeellllllllhhheeeEEEEEelL


DSSP  LLLLEeEEEEHHHllllLLLEEEeeeELLLLLE----------eeeeellllllhHHLLL
Query ESNRIvRRVNANDiegvQLFFVAqlfPLQNGGL----------yicnwqghdreaGKGKH  241
ident        |            |                                       
Sbjct TGEMA-MREVRIM---dVFYFST--aVNPAKTRafgaynvlesfdleknasikrvPLPHS  281
DSSP  LLLEE-EEEEEEL---lLLEEEE--eELLLLLEeeeeeleeeeeelllleeeeeeELLLL


DSSP  L-LEEEellllleEEEE---------------------lllLLLLL-LLEEEEELL--
Query P-QLVEidsegkvVWQL---------------------ndkVKFGX-ISTICPIRE--  274
ident                 |                                         
Sbjct YySVNV--stdgsTVWLggalgdlaaydaetlekkgqvdlpGNASMsLASVRLFTRde  337
DSSP  LlEEEE--lllllEEEEelllleeeeeellllleeeeeelhHHLLLlLLLLEEEELll


No 93: Query=mol1A Sbjct=2wg4B Z-score=12.9

back to top
DSSP  -----------------------LLLEEEEELLlLLEEEEEELLlLEEE--EEEE---LL
Query -----------------------SPQHLLVGGSgWNKIAIINKDtKEIV--WEYP---LE   32
ident                          | |           |      ||          | 
Sbjct ncfciqevvsglrqpvgalhsgdGSQRLFILEK-EGYVKILTPE-GEIFkePYLDihkLV   58
DSSP  llleeeeeellllleeeeellllLLLLEEEEEL-LLEEEEELLL-LLLLllLLEElllLL


DSSP  LL-----LLLLEEEELLLL----LEEEELL-------LEEEEEL--------LLLL-EEE
Query KG-----WECNSVAATKAG----EILFSYS-------KGAKXIT--------RDGR-ELW   67
ident            | |             ||              |         | |    
Sbjct QSgikdeRGLLSLAFHPNYkkngKLYVSYTtnqhdhiLRVVEYTvsrknphqVDLRtARV  118
DSSP  LLlllllLLEEEEEELLLHhhhlEEEEEEEelllleeEEEEEEEelllllllEEEEeEEE


DSSP  EEELLLL---lEEEEEEELLLLLEEEEEELL----------------LEEEEEELL----
Query NIAAPAG---cEXQTARILPDGNALVAWCGH----------------PSTILEVNX----  104
ident                    |||                             |        
Sbjct FLEVAELhrkhLGGQLLFGPDGFLYIILGDGmitlddmeemdglsdfTGSVLRLDVdtdm  178
DSSP  EEEEEELllllLEEEEEELLLLLEEEEELLLlllhhhhhhlllllllLLEEEEELLllll


DSSP  ---LLLEE-------------eEEEELLllllhhhLLLLLEELLL-------LLEEEEEL
Query ---KGEVL-------------sKTEFETgierphaQFRQINKNKK-------GNYLVPLF  141
ident                                                        |    
Sbjct cnvPYSIPrsnphfnstnqppeVFAHGL------hDPGRCAVDRHptdininLTILCSDS  232
DSSP  lllLLLLLllllllllllllllEEEELL------lLLLLLEEELLlllllllEEEEEEEL


DSSP  LLLEEEEELL--------LLLEEEEEEL-LLLLLEEEELL-------LLLEEEELlLLLE
Query ATSEVREIAP--------NGQLLNSVKL-SGTPFSSAFLD-------NGDCLVACgDAHC  185
ident   |  |               ||       |                 |           
Sbjct NRSSARILQIikgkdyesEPSLLEFKPFsNGPLVGGFVYRgcqserlYGSYVFGD-RNGN  291
DSSP  LLLEEEEEEEllllllllLLLLEEELLLlLLLLLEEEELLlllllllLLLEEEEL-LLLL


DSSP  EEEELLL----LLLEEEEEEhhhllllllLEEEeEEELLLLLEEEEEEllllllhhhlLL
Query FVQLNLE----SNRIVRRVNandiegvqlFFVAqLFPLQNGGLYICNWqghdreagkgKH  241
ident |  |                                    |  ||               
Sbjct FLTLQQSpvtkQWQEKPLCL---------HILG-FGEDELGEVYILSS----------HN  331
DSSP  EEEEELLllllLLEEEEELL---------LEEE-EEELLLLLEEEEEL----------LL


DSSP  LLEEEELLL---------------------------------------------------
Query PQLVEIDSE---------------------------------------------------  250
ident   |  |                                                      
Sbjct GKLYKIVDPkrplmpeecratvqpaqtltsecsrlcrngyctptgkcccspgwegdfcrt  391
DSSP  LEEEEEELLlllllllllllllllllllllhhhhlllleeellllleeellleellllle


DSSP  ------lleeeeelllllllllleeeeell
Query ------gkvvwqlndkvkfgxisticpire  274
ident                               
Sbjct akcepacrhggvcvrpnkclckkgylgpqc  421
DSSP  elllllllllllllllllllllllllllll


No 94: Query=mol1A Sbjct=2wftB Z-score=12.8

back to top
DSSP  ------------------------LLLEEEEELLlLLEEEEEElLLLEEE--EEEELLLL
Query ------------------------SPQHLLVGGSgWNKIAIINkDTKEIV--WEYPLEKG   34
ident                           | |           |      ||         | 
Sbjct hncfciqevvsglrqpvgalhsgdGSQRLFILEK-EGYVKILT-PEGEIFkePYLDIHKL   58
DSSP  lllleeeeeeeeelleeeeellllLLLLEEEEEL-LLEEEEEL-LLLLLLllLLEELLLL


DSSP  L----------LLLEEEELLLL----LEEEELL-------LEEEEELLL---------lL
Query W----------ECNSVAATKAG----EILFSYS-------KGAKXITRD---------gR   64
ident               | |             ||              |             
Sbjct VqsgikggderGLLSLAFHPNYkkngKLYVSYTtnphdhiLRVVEYTVSrknphqvdlrT  118
DSSP  LllllllllllLEEEEEELLLHhhhlEEEEEEEelllleeEEEEEEEELlllllleeeeE


DSSP  EEEEEELLLL---lEEEEEEELLLLLEEEEEELL----------------LEEEEEELL-
Query ELWNIAAPAG---cEXQTARILPDGNALVAWCGH----------------PSTILEVNX-  104
ident                       |||                             |     
Sbjct ARVFLEVAELhrkhLGGQLLFGPDGFLYIILGDGmitlddmeemdglsdfTGSVLRLDVd  178
DSSP  EEEEEEEEELllllLEEEEEELLLLLEEEEELLLlllhhhhhllllllllLLEEEEELLl


DSSP  ------LLLE---------EEEEEEllllllhhHLLLLLEELLlLLEEEEELLlLEEEEe
Query ------KGEV---------LSKTEFetgierphAQFRQINKNKkGNYLVPLFAtSEVREi  149
ident                                                |      |  |  
Sbjct tdmcnvPYSIprsnphfppEVFAHG-------lHDPGRCAVDR-LTILCSDSN-SSARI-  228
DSSP  llllllLLLLlllllllllLEEEEL-------lLLLLLLEEEL-LEEEEEELL-LEEEL-


DSSP  llllleeeeeellLLLLEEEELL-------LLLEEEELLlLLEEEEELLL--LLLEEEEE
Query apngqllnsvklsGTPFSSAFLD-------NGDCLVACGdAHCFVQLNLE--SNRIVRRV  200
ident              |                 |           |  |             
Sbjct -------------GPLVGGFVYRgcqserlYGSYVFGDR-NGNFLTLQQSpvQWQEKPLC  274
DSSP  -------------LLEEEEEELLlllllllLLLEEEEEL-LLLEEEEELLllLLEEEEEL


DSSP  E--hhhLLLLLLLEEEEEEELlLLLEEEEEELlllLLHHHLLLLLEEEELLL--------
Query N--andIEGVQLFFVAQLFPLqNGGLYICNWQghdREAGKGKHPQLVEIDSE--------  250
ident         |              |  ||                 |  |           
Sbjct LgtsgsCRGYFSGHILGFGEDeLGEVYILSSS---KSMTQTHNGKLYKIVDPkrplmpee  331
DSSP  LlllllLLLLLLLEEEEEEELlLLLEEEEEEL---HHHHHLLLEEEEEEELLllllllhh


DSSP  -----------------------------------------------------lleeeee
Query -----------------------------------------------------gkvvwql  257
ident                                                             
Sbjct cratvqpaqtltsecsrlcrngyctptgkcccspgwegdfcrtakcepacrhggvcvrpn  391
DSSP  hllllllllllllhhhhhllleeellllleeellleellllleellllllllllleeell


DSSP  lllllllllleeeeell
Query ndkvkfgxisticpire  274
ident                  
Sbjct kclckkgylgpqceqvd  408
DSSP  eellllleellllleel


No 95: Query=mol1A Sbjct=2zkqa Z-score=12.8

back to top
DSSP  ------------------------LLLEEeeellllleeeeEELL------LLEE-----
Query ------------------------SPQHLlvggsgwnkiaiINKD------TKEI-----   25
ident                                          |         |        
Sbjct qmtlrgtlkghgwvtqiattpqfpDMILS------asrdktIIMWkltrdeTNYGipqra   54
DSSP  llleeeeelllllllleellllllLEEEE------elllleEEEEelllllEEEEeelll


DSSP  ------------------EEEEELL----------------------LLLLLleEEELLL
Query ------------------VWEYPLE----------------------KGWECnsVAATKA   45
ident                                                |      ||    
Sbjct lrghshfvsdvvissdgqFALSGSWdgtlrlwdlttgtttrrfvghtKDVLS--VAFSSD  112
DSSP  llllllllleeeelllllEEEEELLlleeeeeellllleeeeeeellLLLEE--EEEELL


DSSP  --LLEEEeLLLEEEEELLL---LLEEEEEELlllLEEEEEEELLLL----LEEEEEELll
Query --GEILFsYSKGAKXITRD---GRELWNIAApagCEXQTARILPDG----NALVAWCGhp   96
ident                                    |                        
Sbjct nrQIVSG-SRDKTIKLWNTlgvCKYTVQDES---SEWVSCVRFSPNssnpIIVSCGWD-k  167
DSSP  llEEEEE-ELLLEEEEEELlllLEEEEEELL---LLEEEEEELLLLllllLEEEEELL-l


DSSP  EEEEEELlllLEEEEEEELLLlllhhHLLLLLEELLL-LLEEEEELlLLEEEEELL-LLL
Query STILEVNxkgEVLSKTEFETGierphAQFRQINKNKK-GNYLVPLFaTSEVREIAP-NGQ  154
ident             |                                             | 
Sbjct LVKVWNL-anCKLKTNHIGHT-----GYLNTVTVSPDgSLCASGGK-DGQAMLWDLnEGK  220
DSSP  LEEEELL-llLLEEEEELLLL-----LLEEEEEELLLlLEEEEEEL-LLEEEEEELlLLE


DSSP  EEEEEELLlLLLEEEELLLL-LEEEELLlLLEEEEELL--------LLLLEEE-EEEHhh
Query LLNSVKLSgTPFSSAFLDNG-DCLVACGdAHCFVQLNL--------ESNRIVR-RVNAnd  204
ident  |                     | |           |                   |  
Sbjct HLYTLDGG-DIINALCFSPNrYWLCAAT-GPSIKIWDLegkiivdeLKQEVIStSSKA--  276
DSSP  EEEEEELL-LEEEEEELLLLlEEEEEEL-LLLEEEEELllllllllLLLLEEEeEELL--


DSSP  llllLLLEEEEEEEL-LLLLEEEEEELlllllhhhlllLLEEEELlllleeeeellllll
Query iegvQLFFVAQLFPL-QNGGLYICNWQghdreagkgkhPQLVEIDsegkvvwqlndkvkf  263
ident            |        |                                       
Sbjct ----EPPQCTSLAWSaDGQTLFAGYTD-----------NLVRVWQ---------------  306
DSSP  ----LLLLEEEEEELlLLLLEEEEELL-----------LLEEEEL---------------


DSSP  lllleeeeell
Query gxisticpire  274
ident            
Sbjct -----------  306
DSSP  -----------


No 96: Query=mol1A Sbjct=1u2vC Z-score=12.8

back to top
DSSP  -----------------llLEEEEELlLLLEEEEEELL--LLEEEEEEELLlLLLLLEEE
Query -----------------spQHLLVGGsGWNKIAIINKD--TKEIVWEYPLEkGWECNSVA   41
ident                                  |  |       | |           | 
Sbjct ayhsflvepischawnkdrTQIAICP-NNHEVHIYEKSgnKWVQVHELKEH-NGQVTGVD   58
DSSP  leeelllllllleeellllLEEEELL-LLLEEEEEEEEllEEEEEEEEELL-LLLEEEEE


DSSP  ELL-LLLEEEELL-LEEEEELL---LLLEEEEEELLlLLEEEEEEELLLL-LEEEEEELl
Query ATK-AGEILFSYS-KGAKXITR---DGRELWNIAAPaGCEXQTARILPDG-NALVAWCGh   95
ident        |        |   |           |           |  |      |     
Sbjct WAPdSNRIVTCGTdRNAYVWTLkgrTWKPTLVILRI-NRAARCVRWAPNEkKFAVGSGS-  116
DSSP  EELlLLEEEEEELlLLEEEEEEellEEEEEEELLLL-LLLEEEEEELLLLlEEEEEELL-


DSSP  lEEEEEELL-----LLLEeEEEEELLLlllhhHLLLLLEELLL-LLEEEEELLLlEEEEE
Query pSTILEVNX-----KGEVlSKTEFETGierphAQFRQINKNKK-GNYLVPLFATsEVREI  149
ident    |                                                     |  
Sbjct -RVISICYFeqendWWVC-KHIKKPIR-----STVLSLDWHPNsVLLAAGSCDF-KCRIF  168
DSSP  -LLEEEEEEellllEEEE-EEELLLLL-----LLEEEEEELLLlLEEEEEELLL-LEEEE


DSSP  LL-------------------LLLEEEEEE------------------------------
Query AP-------------------NGQLLNSVK------------------------------  160
ident                       | |                                   
Sbjct SAyikeveerpaptpwgskmpFGELMFESSsscgwvhgvcfsangsrvawvshdstvcla  228
DSSP  ELlllllllllllllllllllLLLEEEELLllllleeeeeellllleeeeeellleeeee


DSSP  ------------lllllleEEEL-LLLLE--eeellllleeeeelllllLEEEeeehHHL
Query ------------lsgtpfsSAFL-DNGDC--lvacgdahcfvqlnlesnRIVRrvnaNDI  205
ident                                                             
Sbjct dadkkmavatlasetlpllAVTFiTESSLvaaghdcfpvlftydsaagkLSFG---gRLD  285
DSSP  ehhhlleeeeeellllleeEEEElLLLEEeeeellllleeeeeelllleEEEE---eELL


DSSP  L---------------------LLLLLEEEEEEELLL-----LLEEEEEELlllllhhhl
Query E---------------------GVQLFFVAQLFPLQN-----GGLYICNWQghdreagkg  239
ident                             | |   |                         
Sbjct VprgltarerfqnldkkaagldSLHKNSVSQISVLSGgkakcSQFCTTGMD---------  336
DSSP  LlllllhhhhhhllllllllllLLLLLLEEEEEEEELlllllLEEEEEELL---------


DSSP  llLLEEEELLLLLeeeeelllllllllleeeeell
Query khPQLVEIDSEGKvvwqlndkvkfgxisticpire  274
ident         |                          
Sbjct --GGMSIWDVRSL------------esalkdlkiv  357
DSSP  --LEEEEEEHHHH------------hhhlllllll


No 97: Query=mol1A Sbjct=1z4wA Z-score=12.7

back to top
DSSP  -----llleeeeellllleeeeeeLLLLEEEEEEELLL-----LLLLLEEEELLLllEEE
Query -----spqhllvggsgwnkiaiinKDTKEIVWEYPLEK-----GWECNSVAATKAgeILF   50
ident                                                 |   ||      
Sbjct indnryinginqfyfsiaegrnltLGPLLNMPSFIPTAttpegCTRIPSFSLTKT-hWCY   59
DSSP  llllllllllllllllhhhhlleeEEEELLLLLLLLLLlllllEEEEEEEEELLL-lEEE


DSSP  ELL-------------LEEEEELL--------LLLEEEEEE--llLLLEEEEEEELlLLL
Query SYS-------------KGAKXITR--------DGRELWNIA--apAGCEXQTARILpDGN   87
ident                                   | |                     | 
Sbjct THNvilngcqdhvssnQFVSMGIIeptsagfpFFRTLKTLYlsdgVNRKSCSISTV-PGG  118
DSSP  EEEeelllllllllleEEEEEEEEeellllleEEEEEEEEEelllLLEEEEEEEEE-LLE


DSSP  EEEEEEL--------------LLEEEEEELLLLLEeEEEEEL-----lLLLLhhHLLL--
Query ALVAWCG--------------HPSTILEVNXKGEVlSKTEFE-----tGIERphAQFR--  126
ident                          |                                  
Sbjct CMMYCFVstqperddyfsaapPEQRIIIMYYNDTI-VERIINppgvldVWAT--LNPGtg  175
DSSP  EEEEEEEllllhhhhhhllllLEEEEEEEELLLLE-EEEEELllllllLEEE--EEELll


DSSP  LLEELLlLLEEEEELLL-------------------------------------------
Query QINKNKkGNYLVPLFAT-------------------------------------------  143
ident        |  | |                                               
Sbjct SGVYYL-GWVLFPIYGGvikgtslwnnqankyfipqmvaalcsqnqatqvqnakssyyss  234
DSSP  LLEEEL-LEEEEEEEEEellllhhhhhhllllllllllhhhllllhhhhhhhhhhlleel


DSSP  --------LEEEEEL----LLLLEEEEEE-----LLLLLLEEEELLlLLEEEELLLL---
Query --------SEVREIA----PNGQLLNSVK-----LSGTPFSSAFLDnGDCLVACGDA---  183
ident         |               |         | |                       
Sbjct wfgnrmiqSGILACPlrqdLTNECLVLPFsndqvLMGAEGRLYMYG-DSVYYYQRSNsww  293
DSSP  lllleeeeEEEEEEEllllLLLLLEEEELlllllLLLLLEEEEEEL-LEEEEEELLLlll


DSSP  --LEEEEELLL-------LLLEeEEEEhhhLLLLLL------------------LEEEEE
Query --HCFVQLNLE-------SNRIvRRVNandIEGVQL------------------FFVAQL  216
ident                          |       |                       |  
Sbjct pmTMLYKVTITftngqpsAISA-QNVP---TQQVPRpgtgdcsatnrcpgfcltGVYADA  349
DSSP  llLEEEEEEEEelllleeEEEE-EELL---LLLLLLlllhhhllllllllllllLLLLLE


DSSP  EELLLL----------LEEEEEelllLLLHHhllLLLEEEELlLLLEEEEELLLL--llL
Query FPLQNG----------GLYICNwqghDREAGkgkHPQLVEIDsEGKVVWQLNDKV--kfG  264
ident   | |                              |                        
Sbjct WLLTNPsststfgseaTFTGSY-lntATQRI---NPTMYIAN-NTQIISSQQFGSsgqeA  404
DSSP  EELLLHhhllllllllEEEEEE-ellLLLLL---LEEEEEEE-LLLEEEEEELLLllllE


DSSP  LLLEEEEEL----------------------------------l
Query XISTICPIR----------------------------------e  274
ident         |                                   
Sbjct AYGHTTCFRdtgsvmvyciyiielsssllgqfqivpfirqvtls  448
DSSP  EEEEEEEEEelllleeeeeeeeeeelllllleeeeeeeeeeeel


No 98: Query=mol1A Sbjct=1k32A Z-score=12.7

back to top
DSSP  ----------llLEEEEElllLLEEEEEELLLLEEEEEEELLllLLLLEEEEL-LLLLEE
Query ----------spQHLLVGgsgWNKIAIINKDTKEIVWEYPLEkgWECNSVAAT-KAGEIL   49
ident                                                |          | 
Sbjct mpnlllnpdihgDRIIFV--cCDDLWEHDLKSGSTRKIVSNL--GVINNARFFpDGRKIA   56
DSSP  llllleeeeeelLEEEEE--eLLEEEEEELLLLLEEEEELLL--LEEEEEEELlLLLEEE


DSSP  EEL-------lLEEEEELLL-LLEEEEE--ELLLL---LEEEEEEELLLLLEEEEEE---
Query FSY-------sKGAKXITRD-GRELWNI--AAPAG---CEXQTARILPDGNALVAWC---   93
ident                      |                     |   ||||         
Sbjct IRVmrgsslntADLYFYNGEnGEIKRITyfSGKSTgrrMFTDVAGFDPDGNLIISTDamq  116
DSSP  EEEeellllleEEEEEEELLlLEEEELLllLEEEElleELLEEEEELLLLLEEEEELlll


DSSP  --LLLEEEEEELLLL-LEEEEEEELlllllhhhlllLLEELL-LLLEEEEE---------
Query --GHPSTILEVNXKG-EVLSKTEFEtgierphaqfrQINKNK-KGNYLVPL---------  140
ident           |   |                                             
Sbjct pfSSMTCLYRVENDGiNFVPLNLGP----------aTHILFAdGRRVIGRNtfelphwkg  166
DSSP  llLLLLEEEEEEHHHlEEEELLLLL----------lLEEEEElLEEEEEELlllllllll


DSSP  --lLLLEEEE-ellllLEEEEEELLLLLLEEEELLlLLEEEEL--llLLEEEEELLlLLL
Query --fATSEVRE-iapngQLLNSVKLSGTPFSSAFLDnGDCLVAC--gdAHCFVQLNLeSNR  195
ident     |                |  |    |                         |    
Sbjct yrgGTRGKIWievnsgAFKKIVDMSTHVSSPVIVG-HRIYFITdidgFGQIYSTDL-DGK  224
DSSP  lllLLLLEEEeeeellEEEEEELLLLLLEEEEEEL-LEEEEEEllllLLEEEEEEL-LLL


DSSP  EEEEEEHhhllllllLEEEEEEELLlLLEEEEEELlllllhhhllllLEEEEL-LLLLEe
Query IVRRVNAndiegvqlFFVAQLFPLQnGGLYICNWQghdreagkgkhpQLVEID-SEGKVv  254
ident   |                 |                                    |  
Sbjct DLRKHTS-----ftdYYPRHLNTDG-RRILFSKGG------------SIYIFNpDTEKI-  265
DSSP  LLEELLL-----lllLLEEEEEELL-LLEEEEELL------------EEEEELlLLLLE-


DSSP  EEELLLLL----------------------------------------------------
Query WQLNDKVK----------------------------------------------------  262
ident                                                             
Sbjct EKIEIGDLespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplr  325
DSSP  EELLLLLLllllleeeelhhhheeeeeelhhhleeeeelleeeeelllllleeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct iryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvan  385
DSSP  eeeeeelllleeeeeeeelleeeeeeeellllleeellllllleeeeeellllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct drfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvy  445
DSSP  llleeeeeellllleeeeeelllllllleeellllleeeeeeeellllllllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct dmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfvip  505
DSSP  elllleeeellllllleeeeeellllleeeeeelllllleelllllleellllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct lipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysvpvh  565
DSSP  lllllllhhhlllhhhlllllllllllhhhhleellllllleeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfple  625
DSSP  llhhhhhhllllleeeeeeellllleeeeeeeeeeeeellllleeeeeelllleeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct kpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrnlvp  685
DSSP  llllleellllllleeeehhhhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct lcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvakaya  745
DSSP  hlllhhhhhhhhhhhhhlllllllleelllllllllllllllleeeeeelleeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgkggd  805
DSSP  llllllllllhhhhhllllllleeeeelleellllllhhhhhhllllleeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct krdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfines  865
DSSP  eeeeeeelllllhhhhhhhhhhhhhhhhhhhlllleeeeelllllhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct syqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitneya  925
DSSP  llleeeeelllllllllhhhhhhhhllllleeeeellllleeellllllleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagfgve  985
DSSP  llhhhhhhhhhhhllleeeeellllllleellllllllllleelllleeeeellllllll


DSSP  --------------------------llllleeeeell
Query --------------------------fgxisticpire  274
ident                                       
Sbjct nygvdpdveieyaphdylsgkdpqidyaidalieelrn 1023
DSSP  llllllleellllhhhhhllllhhhhhhhhhhhhhlll


No 99: Query=mol1A Sbjct=2pm9A Z-score=12.7

back to top
DSSP  llleeeeellllLEEEeeelllleeeeeeelllllllleeEELLL---------------
Query spqhllvggsgwNKIAiinkdtkeivweyplekgwecnsvAATKA---------------   45
ident                                         |                   
Sbjct -------aefsrTATF------------------------AWSHDkipllvsgtvsgtvd   29
DSSP  -------leeeeLLLL------------------------LLLLLllleeeellllllll


DSSP  ------------------------------------------lleeeellLEEEEELLL-
Query ------------------------------------------geilfsysKGAKXITRD-   62
ident                                                             
Sbjct anfstdsslelwsllaadsekpiaslqvdskfndldwshnnkiiagaldnGSLELYSTNe   89
DSSP  llllllllleeeelllhhhlllllllllllleeeeeelllllleeeeellLLEEEELLLl


DSSP  ----LLEEEEEELLLLLEeEEEEELL-LLLEEEEEELLLEEEEEELLLLL-----EEEEE
Query ----GRELWNIAAPAGCExQTARILP-DGNALVAWCGHPSTILEVNXKGE-----VLSKT  112
ident                     |        | |               |           |
Sbjct annaINSMARFSNHSSSV-KTVKFNAkQDNVLASGGNNGEIFIWDMNKCTespsnYTPLT  148
DSSP  llllLLEEEELLLLLLLL-LEEEELLlLLLLEEEELLLLLEELLLLLLLLlllllLLLLL


DSSP  EELLLLLLhhHLLLLLEEL--LLLLEEEEELlLLEEEEELL-LLLEEEEEEL-------L
Query EFETGIERphAQFRQINKN--KKGNYLVPLFaTSEVREIAP-NGQLLNSVKL-------S  162
ident                   |                                         
Sbjct PGQSMSSV--DEVISLAWNqsLAHVFASAGS-SNFASIWDLkAKKEVIHLSYtspnsgiK  205
DSSP  LLLLLLLL--LLLLEEEELllLLLEEEEELL-LLLEEEEELlLLEEEEEELLlllllllL


DSSP  LLLLEEEELLLL--LEEEELLL--LLEEEEELLLLL-LEEEEEEHhhlllLLLLEEEEEE
Query GTPFSSAFLDNG--DCLVACGD--AHCFVQLNLESN-RIVRRVNAndiegVQLFFVAQLF  217
ident                   | |           |          |              | 
Sbjct QQLSVVEWHPKNstRVATATGSdnDPSILIWDLRNAnTPLQTLNQ-----GHQKGILSLD  260
DSSP  LLEEEEEELLLLllEEEEEELLllLLLLLEEELLLLlLLLLLLLL-----LLLLLEEEEE


DSSP  EL--LLLLEEEEEELlllllhhhlllLLEEEEL---LLLLEeEEELLLlllLLLLEEE-E
Query PL--QNGGLYICNWQghdreagkgkhPQLVEID---SEGKVvWQLNDKvkfGXISTIC-P  271
ident         |                            |                      
Sbjct WChqDEHLLLSSGRD-----------NTVLLWNpesAEQLS-QFPARG---NWCFKTKfA  305
DSSP  ELllLLLLEEEEELL-----------LEEEEELlllLLEEE-EEELLL---LLLLLEEeL


DSSP  ELL---------------------------------------------------------
Query IRE---------------------------------------------------------  274
ident                                                             
Sbjct PEApdlfacasfdnkievqtlqnltntldeskekpsvfhlqaptwygepspaahwafggk  365
DSSP  LLLlleeeellllleeeeeellllllllllllllllllllllllllllllllleeellle


DSSP  -------------------
Query -------------------  274
ident                    
Sbjct lvqitpdgkgvsitnpkis  384
DSSP  eelllllllllllllllll


No 100: Query=mol1A Sbjct=1gjqA Z-score=12.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct dmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkp   60
DSSP  lllhhhhhllllllllhhhlllllllllllhhhhhhhhhhhhhhlhhhhlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmp  120
DSSP  llhhhhhhhlhhhhhhhhhhllllllllllllllllhhhhhhhhhhllllllllllllhh


DSSP  ------------------------LLLEEEEEllllleeEEEELL-----LLEEEE----
Query ------------------------SPQHLLVGgsgwnkiAIINKD-----TKEIVW----   27
ident                          |    |         |   |               
Sbjct emreswkvlvkpedrpkkqlndldLPNLFSVT--lrdagQIALVDgdskkIVKVIDtgya  178
DSSP  hhhhhleelllhhhllllllllllHHHEEEEE--ehhhlEEEEEElllllEEEEEEllll


DSSP  --------------EEEL------------------------------------------
Query --------------EYPL------------------------------------------   31
ident                                                             
Sbjct vhisrmsasgryllVIGRdaridmidlwakeptkvaeikigiearsvesskfkgyedryt  238
DSSP  eeeeeellllleeeEEELlleeeeeelllllleeeeeeellleeeeeeelllllllllee


DSSP  -LLLL-------------------llleeeellllleeeellLEEEEelllllEEEEEEL
Query -EKGW-------------------ecnsvaatkageilfsysKGAKXitrdgrELWNIAA   71
ident                                                             
Sbjct iAGAYwppqfaimdgetlepkqivstrgmtvdtqtyhpeprvAAIIA--shehPEFIVNV  296
DSSP  eEEEEelleeeeeellllleeeeeelleelllllleelllleEEEEE--llllLEEEEEE


DSSP  LL-----------------------LLEEEEEEeLLLLLEEEEE-ELLLEEEEEELLLlL
Query PA-----------------------GCEXQTARiLPDGNALVAW-CGHPSTILEVNXKgE  107
ident                                                             
Sbjct KEtgkvllvnykdidnltvtsigaaPFLHDGGW-DSSHRYFMTAaNNSNKVAVIDSKD-R  354
DSSP  LLlleeeeeelllllleeeeeeellLLEEEEEE-LLLLLEEEEEeHHHLEEEEEELLL-L


DSSP  EEEEEEELLLlllhhHLLLL-LEELLL----LLEEEEELLLLEEEEELL--------LLL
Query VLSKTEFETGierphAQFRQ-INKNKK----GNYLVPLFATSEVREIAP--------NGQ  154
ident  ||                                           |             
Sbjct RLSALVDVGK-----TPHPGrGANFVHpkygPVWSTSHLGDGSISLIGTdpknhpqyAWK  409
DSSP  EEEEEEELLL-----LEEEEeEEEEEEllleEEEEEEELLLLEEEEEELllllllllLLL


DSSP  EEEEEELLL-LLLEEEEL-LLLLEEEELLL------LLEEEEELLLLL-LEEEEEEHhhl
Query LLNSVKLSG-TPFSSAFL-DNGDCLVACGD------AHCFVQLNLESN-RIVRRVNAndi  205
ident         |                |                  |               
Sbjct KVAELQGQGgGSLFIKTHpKSSHLYVDTTFnpdariSQSVAVFDLKNLdAKYQVLPI--a  467
DSSP  EEEEEELLLlLLLLEELLlLLLEEEELLLLlllhhhHLLEEEEELLLLlLLLEEELH--h


DSSP  LLLL----lLEEEEEEEL-LLLLEEEEEELlllllHHHLlLLLEEEELL--LLLEEeEEL
Query EGVQ----lFFVAQLFPL-QNGGLYICNWQghdreAGKGkHPQLVEIDS--EGKVVwQLN  258
ident |          | |              |              ||  |            
Sbjct EWADlgegaKRVVQPEYNkRGDEVWFSVWN-----GKND-SSALVVVDDktLKLKA-VVK  520
DSSP  HHHLlllllLEEEEEEELlLLLEEEEEEEL-----LLLL-LLEEEEEELllLEEEE-EEL


DSSP  LlLLLLLLLEEEEEL------l
Query DkVKFGXISTICPIR------e  274
ident |                     
Sbjct D-PRLITPTGKFNVYntqhdvy  541
DSSP  L-LLLLLEEEEEEHHhhhllll


No 101: Query=mol1A Sbjct=1sq9A Z-score=12.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnenpkdksyshfvhk   60
DSSP  leeeeeeeellllllleeeeeellleeeeeellleeeeeellllllllhhhheeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sglhhvdvlqaierdafelclvattsfsgdllfyritredetkkvifekldlldsdmkkh  120
DSSP  lleeeeeeeeeeellleeeeeeeeeelllleeeeeeeelllllleeeeeellllllhhhl


DSSP  ----------lLLEEEEELlLLLEEEEEELL---------------LLEEEEEEELL--L
Query ----------sPQHLLVGGsGWNKIAIINKD---------------TKEIVWEYPLE--K   33
ident               |           |                   | |           
Sbjct sfwalkwgasnSHRLVATD-VKGTTYIWKFHpfadesnsltlnwspTLELQGTVESPmtP  179
DSSP  leeeeeeelllLEEEEEEE-LLLLEEEEEEEllllhhhhlllllllEEEEEEEELLLllL


DSSP  LLLLLEEEELLLLLEEEELLL-EEEEELL-LLLEEEEEELLL--LLEEEEEEELL-LLLE
Query GWECNSVAATKAGEILFSYSK-GAKXITR-DGRELWNIAAPA--GCEXQTARILP-DGNA   88
ident      ||     | |                 | | |                 |     
Sbjct SQFATSVDISERGLIATGFNNgTVQISELsTLRPLYNFESQHnnSNSIRSVKFSPqGSLL  239
DSSP  LLLLLEEEELLLLEEEEELLLlEEEEEELlLLEEEEEEELLLllLLLEEEEEELLlLLEE


DSSP  EEEEELL-LEEEEEELL-LLLEEEEEE----ELLLlllhhHLLLLLEELLL-LLEEEEEL
Query LVAWCGH-PSTILEVNX-KGEVLSKTE----FETGierphAQFRQINKNKK-GNYLVPLF  141
ident   |        |       ||          |                |           
Sbjct AIAHDSNsFGCITLYETeFGERIGSLSvpgeFAHS-----SWVMSLSFNDSgETLCSAGW  294
DSSP  EEEEEELlEEEEEEEELlLLLEEEEELllllLLLL-----LLEEEEEELLLlLEEEEEEL


DSSP  lLLEEEEELL-LLLEEEEEEL----------------------LLLLLEEEELLL-----
Query aTSEVREIAP-NGQLLNSVKL----------------------SGTPFSSAFLDN-----  173
ident      |                                         |   ||       
Sbjct -DGKLRFWDVkTKERITTLNMhcddieieedilavdehgdslaEPGVFDVKFLKKgwrsg  353
DSSP  -LLEEEEEELlLLEEEEEEELlhhhlllhhhllllllllllllLLLEEEEEEELLlllll


DSSP  ------LLEEEELlLLLEEEEELLLLlleeeeeehhhllllllleeeeeeellllleeee
Query ------GDCLVACgDAHCFVQLNLESnrivrrvnandiegvqlffvaqlfplqngglyic  227
ident             |                                               
Sbjct mgadlnESLCCVC-LDRSIRWFREAG----------------------------------  378
DSSP  llllllLEEEEEE-LLLEEEEEEEEL----------------------------------


DSSP  eellllllhhhllllleeeellllleeeeelllllllllleeeeell
Query nwqghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                                
Sbjct -----------------------------------------------  378
DSSP  -----------------------------------------------


No 102: Query=mol1A Sbjct=2vduD Z-score=12.6

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelLLLLLLleeEELL-LLLEeeelLLEEEEE
Query spqhllvggsgwnkiaiinkdtkeivweyplEKGWECnsvAATK-AGEIlfsySKGAKXI   59
ident                                                             
Sbjct -----------------------------svIHPLQN--lLTSRdGSLVfaiiKNCILSF   29
DSSP  -----------------------------leELLLLE--eEELLlLLEEeeeeLLEEEEE


DSSP  LL----LLLEeeeEELL--LLLEEEEEEELLLL-LEEEEEELlLEEEEEELL------LL
Query TR----DGRElwnIAAP--AGCEXQTARILPDG-NALVAWCGhPSTILEVNX------KG  106
ident                            |   |               |            
Sbjct KYqspnHWEFagkWSDDfpIYSYIRNLRLTSDEsRLIACADS-DKSLLVFDVdktsknVL   88
DSSP  EEelllEEEEeeeEELLllLLLLEEEEEELLLLlEEEEEEHH-HLEEEEEEEllllllLE


DSSP  LEEEEEEELLllllhhhLLLLLEELLL-LLEEEEELlLLEEEEELLL------lLEEEEE
Query EVLSKTEFETgierphaQFRQINKNKK-GNYLVPLFaTSEVREIAPN------gQLLNSV  159
ident        |             |                  |  |  |             
Sbjct KLRKRFCFSK-------RPNAISIAEDdTTVIIADK-FGDVYSIDINsipeekfTQEPIL  140
DSSP  EEEEEEELLL-------LEEEEEELLLlLEEEEEEL-LLEEEEEELLlllllllLLLLLE


DSSP  ELLLLLLEEEELL----LLLEEEELlLLLEEEEELLLLL-LEEEEEEHhhllllLLLEEE
Query KLSGTPFSSAFLD----NGDCLVACgDAHCFVQLNLESN-RIVRRVNAndiegvQLFFVA  214
ident                                                          || 
Sbjct GHVSMLTDVHLIKdsdgHQFIITSD-RDEHIKISHYPQCfIVDKWLFG------HKHFVS  193
DSSP  ELLLLEEEEEEEEllllLEEEEEEE-LLLLEEEEEELLLlLEEEELLL------LLLLEE


DSSP  EEEELLLLLEEEEEELlllllhhhlllLLEEEEL-lLLLEEEEELLLLLL----------
Query QLFPLQNGGLYICNWQghdreagkgkhPQLVEID-sEGKVVWQLNDKVKF----------  263
ident          |                       |   ||                     
Sbjct SICCGKDYLLLSAGGD-----------DKIFAWDwkTGKNLSTFDYNSLIkpylndqhla  242
DSSP  EEEELLLLEEEEEELL-----------LEEEEEEllLLEEEEEEELHHHHhhhlllllll


DSSP  -----lLLLEEEEE----------------------------------------------
Query -----gXISTICPI----------------------------------------------  272
ident         | |                                                 
Sbjct ppiiefAVSKIIKSknlpfvaffveatkciiilemsekqkgdlalkqiitfpynvislsa  302
DSSP  llllllLEEEEEELlllleeeeeelllleeeeeeellllllleeeeeeeelllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct hndefqvtldnkessgvqknfakfieynlnensfvvnneksnefdsaiiqsvqgdsnlvt  362
DSSP  elleeeeeelllllllllllleeeeeeelllleeeelhhhhhhhhhhhhhhhllllllee


DSSP  ------------ll
Query ------------re  274
ident               
Sbjct kkeeiyplynvssl  376
DSSP  lhhhllllllllll


No 103: Query=mol1A Sbjct=1e8tB Z-score=12.5

back to top
DSSP  ----------llleeeeellllleeeeeeLLLLEeEEEE-ELLL-----LLLLLEEEELL
Query ----------spqhllvggsgwnkiaiinKDTKEiVWEY-PLEK-----GWECNSVAATK   44
ident                                                       |     
Sbjct gapihdpdfiggigkelivdnasdvtsfyPSAFQ-EHLNfIPAPttgsgCTRIPSFDMSA   59
DSSP  llllllllllllllllllllllllllleeELLLL-LLLLlLLLLlllllEEEEEEEEELL


DSSP  LlleEEELL-------------LEEEEELLL--------LLEEEEEE--lLLLLEeEEEE
Query AgeiLFSYS-------------KGAKXITRD--------GRELWNIA--aPAGCExQTAR   81
ident                                           |  |              
Sbjct T-hyCYTHNvilsgcrdhshshQYLALGVLRttatgrifFSTLRSISlddTQNRKsCSVS  118
DSSP  L-leEEEEEeelllllllllleEEEEEEEEEellllleeEEEEEEEEellLLLEEeEEEE


DSSP  ELlLLLEEEEEELL--------------LEEEEEELLLLLEeEEEEELL-----LLLLhh
Query ILpDGNALVAWCGH--------------PSTILEVNXKGEVlSKTEFET-----GIERph  122
ident                                       |                     
Sbjct AT-PLGCDMLCSKVteteeedynsavptLMAHGRLGFDGQY-HEKDLDVttlfeDWVA--  174
DSSP  EE-LLEEEEEEEELlllhhhhlllllllEEEEEEELLLLLE-EEEELLHhhhllLEEE--


DSSP  HLLLL--LEELLlLLEEEEELL--------------------------------------
Query AQFRQ--INKNKkGNYLVPLFA--------------------------------------  142
ident              |                                              
Sbjct NYPGVggGSFID-GRVWFSVYGglkpnspsdtvqegkyviykryndtcpdeqdyqirmak  233
DSSP  EEELLllLEEEL-LEEEEEEEEeellllhhhhhllllllllllllllllllhhhhhhhhh


DSSP  -------------LLEEEEEL----LLLLEEEEEE-----LLLLLLEEEELLlLLEEEEL
Query -------------TSEVREIA----PNGQLLNSVK-----LSGTPFSSAFLDnGDCLVAC  180
ident                    |             |      | |                 
Sbjct ssykpgrfggkriQQAILSIKvstsLGEDPVLTVPpntvtLMGAEGRILTVG-TSHFLYQ  292
DSSP  hhlllhhhlllleEEEEEEEEllllLLEEEEEELLlllllLLLLLEEEEEEL-LEEEEEE


DSSP  LLL-----LEEEEELLL--lLLEEEEEEHHhlllLLLL-------------------EEE
Query GDA-----HCFVQLNLE--sNRIVRRVNANdiegVQLF-------------------FVA  214
ident                              |                              
Sbjct RGSsyfspALLYPMTVSnktATLHSPYTFN----AFTRpgsipcqasarcpnscvtgVYT  348
DSSP  LLLlllllEEEEEEEEElleEEELLLEEEL----LLLLlllllllllllllllllllLEE


DSSP  EEEELLL------LLEEEEEElllLLLHHhllLLLEEEELlLLLEEEEELLLL--llLLL
Query QLFPLQN------GGLYICNWqghDREAGkgkHPQLVEIDsEGKVVWQLNDKV--kfGXI  266
ident    ||         |                  |     |                    
Sbjct DPYPLIFyrnhtlRGVFGTML-dsEQARL---NPASAVFD-STSRSRITRVSSsstkAAY  403
DSSP  LLEEEEEllllleEEEEEEEE-llLLLLL---LEEEEEEL-LLLLLLLEELLLllleEEE


DSSP  LEEEEE--------------------------------------ll
Query STICPI--------------------------------------re  274
ident  |                                            
Sbjct TTSTCFkvvktnktyclsiaeisntlfgefrivpllveilkndgvr  449
DSSP  EEEEEEeelllleeeeeeeeeeellllllleeeeeeeeeeelllll


No 104: Query=mol1A Sbjct=1sqjB Z-score=12.5

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelLLLLLLlEEEEL--LLLLEEEELL-LEEE
Query spqhllvggsgwnkiaiinkdtkeivweyplEKGWECnSVAAT--KAGEILFSYS-KGAK   57
ident                                  |       |               || 
Sbjct ---------------------hyefknvaigGGGYIT-GIVAHpkTKDLLYARTDiGGAY   38
DSSP  ---------------------leeeeellllLLLLEE-EEEELllLLLLEEEEELlLLEE


DSSP  EELL-LLLEeEEEE-----lLLLL-EEEEEEELLL--LLEEEEEEL----LLEEEEEE-L
Query XITR-DGRElWNIA-----aPAGC-EXQTARILPD--GNALVAWCG----HPSTILEV-N  103
ident                                  |        |                 
Sbjct RWDAgTSKW-IPLNdfieaqDMNImGTESIALDPNnpDRLYLAQGRyvgdEWAAFYVSeD   97
DSSP  EEELlLLEE-EELLllllhhHHHHlLEEEEEEELLeeEEEEEEELLllllLLLEEEEElL


DSSP  LLLLeEEEEEELL---llllhhhllLLLEEL--LLLLEEEEELLLlEEEEE--LLLLlEE
Query XKGEvLSKTEFET---gierphaqfRQINKN--KKGNYLVPLFATsEVREI--APNGqLL  156
ident          |                    |                             
Sbjct RGQS-FTIYESPFpmgandmgrnngERLAVNpfNSNEVWMGTRTE-GIWKSsdRAKT-WT  154
DSSP  LLLE-EEEEELLLllllllllllllLLEEELllLLLLEEEELLLL-LEEEEllLLLL-LE


DSSP  EEE-ELLL-----LLLEEEEL--LLLLEEEELLLLLEEEEELLllLLEEEEE--EHHH--
Query NSV-KLSG-----TPFSSAFL--DNGDCLVACGDAHCFVQLNLesNRIVRRV--NAND--  204
ident |               |  |    ||                         |        
Sbjct NVTsIPDAftngiGYTSVIFDpeRNGTIYASATAPQGMYVTHD-gGVSWEPVagQPSSwl  213
DSSP  ELLlLLLLlllllLEEEEEELllLLLLEEEEELLLLLEEEELL-lLLLLEELllLLLLll


DSSP  ----------llllllLEEEEEEELLlLLEEEEEELLLL-LLHHhllLLLEEEELL-LLL
Query ----------iegvqlFFVAQLFPLQnGGLYICNWQGHD-REAGkgkHPQLVEIDS-EGK  252
ident                              ||                           | 
Sbjct nrttgafpdkkpasiaPQPMKVALTP-NFLYVTYADYPGpWGVT---FGEVWRQNRtSGA  269
DSSP  hhhhhlllllllllllLEEEEEEELL-LEEEEEEELLLLlLLLL---LLLEEEEELlLLL


DSSP  EEEEELL--------------------------------------------lLLLL----
Query VVWQLND--------------------------------------------kVKFG----  264
ident                                                             
Sbjct WDDITPRvgnsspapynnqtfpaggfcglsvdatnpnrlvvitldrdpgpalDSIYlstd  329
DSSP  EEELLLLllleelllllllllllleeeeeeellllllleeeeeellllllllLLEEeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct agatwkdvtqlsspsnlegnwghptnaarykdgtpvpwldfnngpqwggygaphgtpglt  389
DSSP  lllleeehhhhlllllllllleeehhhlllllllllhhhhhhhlllllllllllllllee


DSSP  ----llleeEEELL----------------------------------------------
Query ----xistiCPIRE----------------------------------------------  274
ident                                                             
Sbjct kfgwwmsavLIDPFnpehlmygtgatiwatdtlsrvekdwapswylqidgieenailslr  449
DSSP  ellllllleEELLLlllleeeelllleeeellhhhhhhllllleeellllllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct spksgaallsgigdisgmkhddltkpqkmfgapqfsnldsidaagnfpnvvvragssghe  509
DSSP  llllllleeeeelllllleellllllllllllllllleeeeeellllllleeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct ydsacargayatdggdawtifptcppgmnashyqgstiavdasgsqivwstkldeqasgp  569
DSSP  llllllleeeellllllleelllllllllllllllleeeelllllleeeellllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct wyshdygktwsvpagdlkaqtanvlsdkvqdgtfyatdggkffvstdggksyaakgaglv  629
DSSP  eeelllllllllleelllllllleeellllllleeeeelleeeeellllleeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct tgtslmpavnpwvagdvwvpvpegglfhstdfgasftrvgtanatlvsvgapkssapsav  689
DSSP  llllllleellllllleeeeellleeeeellllllleelllleeeeeeelllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct fiwgtdkpgsdiglyrsddngstwtrvndqehnysgptmieadpkvygrvylgtngrgiv  749
DSSP  eeeeellllllleeeeellllllleelllllllllleeeeeellllllleeeeellllee


DSSP  ----------------------
Query ----------------------  274
ident                       
Sbjct yadltkstakcangqkgthcyv  771
DSSP  eeeellleeeelllllllllll


No 105: Query=mol1A Sbjct=1v2iA Z-score=12.4

back to top
DSSP  ----------llleeeeellllleeeeeelLLLEEEEEEELLL-----LLLLLEEEELLL
Query ----------spqhllvggsgwnkiaiinkDTKEIVWEYPLEK-----GWECNSVAATKA   45
ident                                                      |      
Sbjct ithdvgikplnpddfwrctsglpslmktpkIRLMPGPGLLAMPttvdgCIRTPSLVINDL   60
DSSP  lllllleeellhhhhllllllleeelllllLLLLLLEELLLLLlllllEEEEEEEEELLL


DSSP  lLEEEELLL-------------EEEEELL--------LLLEEEEEE--lLLLLEEEEEEE
Query gEILFSYSK-------------GAKXITR--------DGRELWNIA--aPAGCEXQTARI   82
ident                                      |                      
Sbjct -IYAYTSNLitrgcqdigksyqVLQIGIItvnsdlvpDLNPRISHTfniNDNRKSCSLAL  119
DSSP  -LEEEEEEEelllllllllleeEEEEEEEeellllleEEEEEEEEElllLLLLEEEEEEE


DSSP  LlLLLEEEEEEL--------------LLEEEEEELLLLLEeEEEEEL-------lLLLLh
Query LpDGNALVAWCG--------------HPSTILEVNXKGEVlSKTEFE-------tGIERp  121
ident |                                ||  |   | | |              
Sbjct L-NTDVYQLCSTpkvdersdyaspgiEDIVLDIVNYDGSI-STTRFKnnnisfdqPYAA-  176
DSSP  E-LLEEEEEEELllllhhhhhhllllLLEEEEEELLLLLE-EEEEELhhhleellLEEE-


DSSP  hHLLL-LLEE-LLLLLEEEEELL-------------------------------------
Query hAQFR-QINK-NKKGNYLVPLFA-------------------------------------  142
ident             |                                               
Sbjct -LYPSvGPGIyYKGKIIFLGYGGlehpinenvicnttgcpgktqrdcnqashspwfsdrr  235
DSSP  -EEELlLLLEeELLEEEEEEEEEelllllllllllllllllllhhhhhhhlllhhhllll


DSSP  LLEEEEELL------LLLEEEEEE---LLLLL-LEEEELLlLLEEEELLLL-----LEEE
Query TSEVREIAP------NGQLLNSVK---LSGTP-FSSAFLDnGDCLVACGDA-----HCFV  187
ident                                       |                     
Sbjct MVNSIIVVDkglnsiPKLKVWTISmrqNYWGSeGRLLLLG-NKIYIYTRSTswhskLQLG  294
DSSP  EEEEEEEEEelllllEEEEEEELLlllLLLLLlEEEEEEL-LEEEEEELLLlllllLEEE


DSSP  EELLL---LLLEeEEEEHHhlllLLLL-------------------EEEEEEELL--lLL
Query QLNLE---SNRIvRRVNANdiegVQLF-------------------FVAQLFPLQ--nGG  223
ident           ||      |    |                            ||      
Sbjct IIDITdysDIRI-KWTWHN----VLSRpgnnecpwghscpdgcitgVYTDAYPLNptgSI  349
DSSP  EEELLlllLLEE-EELLLL----LLLLlllllllllllllllllllLLLLEEELLlllLE


DSSP  EEEEEelllLLLHhhLLLLlEEEELLlLLEEEEELLLL--llLLLLEEEEELL-------
Query LYICNwqghDREAgkGKHPqLVEIDSeGKVVWQLNDKV--kfGXISTICPIRE-------  274
ident                               |  |            |   |         
Sbjct VSSVI-ldsQKSR--VNPV-ITYSTA-TERVNELAILNrtlsAGYTTTSCITHynkgycf  404
DSSP  EEEEE-ellLLLL--LLEE-EEEEEL-LLEEEEEELLLllllEEEEEEEEEEEllleeee


DSSP  ---------------------------
Query ---------------------------  274
ident                            
Sbjct hiveinhkslntlqpmlfkteipkscs  431
DSSP  eeeeeeelllleeeeeeeeeelleeel


No 106: Query=mol1A Sbjct=1mg2A Z-score=12.4

back to top
DSSP  --------------------------------------llLEEEEELLL----lLEEEEE
Query --------------------------------------spQHLLVGGSG----wNKIAII   18
ident                                             |              |
Sbjct eaetqaqetqgqaaaraaaadlaagqddeprileapapdaRRVYVNDPAhaaavTQQFVI   60
DSSP  llllhhhhhhhhhhhhhhhhhhhhllllllllllllllllLEEEEEELHhhlllEEEEEE


DSSP  ELLLLEEEEEEELLllLLLLeEEEL-LLLLEEEELL-----------lEEEEELL-LLLE
Query NKDTKEIVWEYPLEkgWECNsVAAT-KAGEILFSYS-----------kGAKXITR-DGRE   65
ident                    |          |                             
Sbjct DGEAGRVIGMIDGG--FLPN-PVVAdDGSFIAHASTvfsriargertdYVEVFDPvTLLP  117
DSSP  ELLLLEEEEEEEEL--LLLE-EEELlLLLLEEEEEEeeeelleeeeeeEEEEELLlLLLE


DSSP  EEEEELLLLLEE------eEEEELLLL-LEEEEEELLLEEEEEELLL-LLEEEEEEELLl
Query LWNIAAPAGCEX------qTARILPDG-NALVAWCGHPSTILEVNXK-GEVLSKTEFETg  117
ident    |  |                 |||   |            |                
Sbjct TADIELPDAPRFlvgtypwMTSLTPDGkTLLFYQFSPAPAVGVVDLEgKAFKRMLDVPD-  176
DSSP  EEEEEELLLLLLlllllhhHEEELLLLlEEEEEELLLLLEEEEEELLlLEEEEEEELLL-


DSSP  lllhhhlllLLEELLlLLEEEEElLLLEEEEELL----LLLEEEEEEL----LLLLLEEE
Query ierphaqfrQINKNKkGNYLVPLfATSEVREIAP----NGQLLNSVKL----SGTPFSSA  169
ident           |                     |                          |
Sbjct -------cyHIFPTApDTFFMHC-RDGSLAKVAFgtegTPEITHTEVFhpedEFLINHPA  228
DSSP  -------eeEEEEEElLEEEEEE-LLLLEEEEELllllLLEEEELLLLllllLLLLLLLE


DSSP  EL-LLLLEEEELlLLLEEEEELL--lLLLEEEEEEHHH----llllLLLEEEeEEEL-LL
Query FL-DNGDCLVACgDAHCFVQLNL--eSNRIVRRVNAND----iegvQLFFVAqLFPL-QN  221
ident      |             |  |          | |                        
Sbjct YSqKAGRLVWPT-YTGKIHQIDLssgDAKFLPAVEALTeaeradgwRPGGWQqVAYHrAL  287
DSSP  EElLLLEEEEEL-LLLEEEEEELlllLLEELLLEELLLhhhhhlleEELLLLlEEEElLL


DSSP  LLEEE----eeellLLLLH-----------------hhLLLL-LEEEellllleEEEELL
Query GGLYI----cnwqgHDREA-----------------gkGKHP-QLVEidsegkvVWQLND  259
ident    |          |                       |                     
Sbjct DRIYLlvdqrdewrHKTASrfvvvldaktgerlakfemGHEIdSINV-sqdekpLLYALS  346
DSSP  LEEEEeeeelllllLLLLEeeeeeeellllleeeeeeeEEEElEEEE-llllllEEEEEE


DSSP  -LLLL--------------------LLLLeEEEE-ll
Query -KVKF--------------------GXIStICPI-re  274
ident    |                     |    |      
Sbjct tGDKTlyihdaesgeelrsvnqlghGPQV-ITTAdmg  382
DSSP  lLLLEeeeeellllleeeeelllllLLLE-EEELlll


No 107: Query=mol1A Sbjct=1b9xA Z-score=12.4

back to top
DSSP  ----------------------llleeeeellllleeeeeelLLLEEEEEEELLlLLLLL
Query ----------------------spqhllvggsgwnkiaiinkDTKEIVWEYPLEkGWECN   38
ident                                                             
Sbjct mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgrIQMRTRRTLRGH-LAKIY   59
DSSP  llllllhhhhhhhhhhhhhhhhhllllllhhhhlllllllllLLLLEEEEELLL-LLLEE


DSSP  EEEELLL-LLEEEELL-LEEEEELL-LLLEEEEEELLllLEEEEEEELLLL-LEEEEEEL
Query SVAATKA-GEILFSYS-KGAKXITR-DGRELWNIAAPagCEXQTARILPDG-NALVAWCG   94
ident            |                     |         |    | |         
Sbjct AMHWGTDsRLLLSASQdGKLIIWDSyTTNKVHAIPLR-sSWVMTCAYAPSGnYVACGGLD  118
DSSP  EEEELLLlLEEEEEELlLEEEEEELlLLEEEEEEELL-lLLEEEEEELLLLlEEEEEELL


DSSP  llEEEEEELLL-----lLEEEEEEELLllllhhhLLLLLEELL-lLLEEEEEllllEEEE
Query hpSTILEVNXK-----gEVLSKTEFETgierphaQFRQINKNK-kGNYLVPLfatsEVRE  148
ident         | |       |       |                                 
Sbjct --NICSIYNLKtregnvRVSRELAGHT------gYLSCCRFLDdnQIVTSSG---dTTCA  167
DSSP  --LLEEEEELLllllllLLLEEELLLL------lLEEEEEEEEllEEEEEEL---lLLEE


DSSP  EL----LLLLEEEEEELLlLLLEEEELLL-LLEEeellllleeEEELLL----LLLEEEE
Query IA----PNGQLLNSVKLSgTPFSSAFLDN-GDCLvacgdahcfVQLNLE----SNRIVRR  199
ident                       |                                |    
Sbjct LWdietGQQTTTFTGHTG-DVMSLSLAPDtRLFV---sgacdaSAKLWDvregMCRQTFT  223
DSSP  EEelllLEEEEEELLLLL-LEEEEEELLLlLEEE---eeelllEEEEEEllllEEEEEEE


DSSP  -----------------------------------eehhHLLL--LLLLeEEEEEELL-L
Query -----------------------------------vnanDIEG--VQLFfVAQLFPLQ-N  221
ident                                                             
Sbjct ghesdinaicffpngnafatgsddatcrlfdlradqelmTYSHdnIICG-ITSVSFSKsG  282
DSSP  llllleeeeeellllleeeeeelllleeeeelllleeeeEELLllLLLL-EEEEEELLlL


DSSP  LLEEEEEELlllllhhhllllLEEEELLL-LLEEEEELLLllLLLLLEEEEEL-------
Query GGLYICNWQghdreagkgkhpQLVEIDSE-GKVVWQLNDKvkFGXISTICPIR-------  273
ident   |                       |         |         |             
Sbjct RLLLAGYDD-----------fNCNVWDALkADRAGVLAGH--DNRVSCLGVTDdgmavat  329
DSSP  LEEEEEELL-----------lLEEEEELLlLLEEEEEHHH--LLLLLEEEELLlllleee


DSSP  ----------l
Query ----------e  274
ident            
Sbjct gswdsflkiwn  340
DSSP  ellllleeeel


No 108: Query=mol1A Sbjct=2j04B Z-score=12.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sardkieriyglnkekllllakvkegfetsvfdfpfkniqpdspyfvcldppckkesayn   60
DSSP  llhhhhhhhhlllhhhhhhhhhhhhhhllllllllhhhhlllllllllllllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kvigdknrtvyheinktefenmiklrtkrlklligevdaevstgdkiefpvlangkrrgf  120
DSSP  hlllllllllllllllhhhhlllllllleeeeeelleeeeeellleeehhhlllllllee


DSSP  ----------------------LLLEEEEEllllLEEEEEEL----LLLEEEEEEELLll
Query ----------------------SPQHLLVGgsgwNKIAIINK----DTKEIVWEYPLEkg   34
ident                         | | |       | |            |        
Sbjct iynvggtdiawlnieentdigkDIQYLAVAvsqsSCIQIFKMntstLHCVKVQTIVHS-f  179
DSSP  eeelllllllleeellllllllLEEEEEEEeellEEEEEEEEelllLLEEEEEEEEEL-l


DSSP  LLLLEEEELLL-------LLEEEELLL-EEEEELLL------------lLEEEEEELLLl
Query WECNSVAATKA-------GEILFSYSK-GAKXITRD------------gRELWNIAAPAg   74
ident  |                |   |                                     
Sbjct GEVWDLKWHEGchaphlvGCLSFVSQEgTINFLEIIdnatdvhvfkmceKPSLTLSLAD-  238
DSSP  LLEEEEEELLLlllllllLEEEEEELLlLEEEEELLllllllleeelllLLLEEELLLL-


DSSP  LEEEEEEELLLLLEEEEEELllEEEEEELLLLL--EEEEEEELLllllhhHLLLLLEELL
Query CEXQTARILPDGNALVAWCGhpSTILEVNXKGE--VLSKTEFETgierphAQFRQINKNK  132
ident     |   |                 |                                 
Sbjct SLITTFDFLSPTTVVCGFKN--GFVAEFDLTDPevPSFYDQVHD------SYILSVSTAY  290
DSSP  LLEEEEEELLLLEEEEEELL--LEEEEEELLLLllLLEEEELLL------LLEEEEEEEL


DSSP  ----LLLEEEEELLlLEEEEELL-LLLE-EEEEELL--LLLLEEEEL-LLLLEEEELLlL
Query ----KGNYLVPLFAtSEVREIAP-NGQL-LNSVKLS--GTPFSSAFL-DNGDCLVACGdA  183
ident                       |         |                        | |
Sbjct sdfeDTVVSTVAVD-GYFYIFNPkDIATtKTTVSRFrgSNLVPVVYCpQIYSYIYSDG-A  348
DSSP  llllLLEEEEEELL-LEEEEELHhHHHHhLEEEEELllLLLLLEEEElLLLEEEEELL-L


DSSP  LEEEEELLLLL-LEEEEEEHhhllllLLLEEEeEEEL-LLLLEEEEEEL-----------
Query HCFVQLNLESN-RIVRRVNAndiegvQLFFVAqLFPL-QNGGLYICNWQ-----------  230
ident                  |             |                            
Sbjct SSLRAVPSRAAfAVHPLVSR------ETTITA-IGVSrLHPMVLAGSADgsliitnaarr  401
DSSP  LEEEEEELLLLlLLEEEEEL------LLLEEE-EELLlLLLLLEEEELLleeelllllll


DSSP  -------------------------lllllhhhLLLLLE----eeellllleEEEELLLL
Query -------------------------ghdreagkGKHPQL----veidsegkvVWQLNDKV  261
ident                                                         |   
Sbjct llhgiqkslrlwkwdysikddkyridssyevypHGINITctkwnetsaggkcYAFSNSAG  461
DSSP  llllllllleeeelllllllleeeellllllllLLLLLLleeelllllllleEEEELLLL


DSSP  LLlllleeeeell
Query KFgxisticpire  274
ident              
Sbjct LL---tleylsle  471
DSSP  EE---eeeellll


No 109: Query=mol1A Sbjct=3greA Z-score=12.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct esiekflstfilpplrdykefgpiqeivrspnmgnlrgkliatlmenepnsitssavspg   60
DSSP  lllhhhllllllllhhhlhhhlllllllllllhhhlllleeeeellllllleeeeeeell


DSSP  -----------------------------------------------lLLEEEEEllLLL
Query -----------------------------------------------sPQHLLVGgsGWN   13
ident                                                      |      
Sbjct etpylitgsdqgvikiwnlkeiivgevysssltydcsstvtqitmipnFDAFAVS-sKDG  119
DSSP  llleeeeeellleeeeeehhhhhlllllllleeeelllleeeeeelllLLEEEEE-eLLL


DSSP  EEEEEELL-----------LLEEEEEEELL---LLLLLLEEEELL---LLLEEEELL-LE
Query KIAIINKD-----------TKEIVWEYPLE---KGWECNSVAATK---AGEILFSYS-KG   55
ident  |                   |      |    |        |                 
Sbjct QIIVLKVNhyqqesevkflNCECIRKINLKnfgKNEYAVRMRAFVneeKSLLVALTNlSR  179
DSSP  EEEEEEEEeeeelleeeeeEEEEEEEEEHHhhlLLLLEEEEEEEElllLEEEEEEELlLE


DSSP  EEEELL-LLLEEEEEELLLL-LEEEEEEELLLLLEEEEEELLLEEEEEELlLLLEEEEEE
Query AKXITR-DGRELWNIAAPAG-CEXQTARILPDGNALVAWCGHPSTILEVNxKGEVLSKTE  113
ident            |  |             |      |                  ||    
Sbjct VIIFDIrTLERLQIIENSPRhGAVSSICIDEECCVLILGTTRGIIDIWDI-RFNVLIRSW  238
DSSP  EEEEELlLLLEEEEEELLHHhLLEEEEEELLLLLEEEEEELLLLEEEEEL-LLLEEEEEE


DSSP  ELLLLllhhHLLLLLEELLL---LLEEEEE-lLLLEEEEELL-LLLEEEEEEL-------
Query FETGIerphAQFRQINKNKK---GNYLVPL-fATSEVREIAP-NGQLLNSVKL-------  161
ident          |                 |                |               
Sbjct SFGDH----APITHVEVCQFygkNSVIVVGgsSKTFLTIWNFvKGHCQYAFINsdeqpsm  294
DSSP  LLLLL----EEEEEEEELLLlllLEEEEEEelLLEEEEEEELlLLEEEEEEELllllllh


DSSP  --------------------LLLLLEEEELlLLLEEEELLLLLEEEEELLLLL-LEEEEE
Query --------------------SGTPFSSAFLdNGDCLVACGDAHCFVQLNLESN-RIVRRV  200
ident                                |   |         |   |          
Sbjct ehflpiekgleelnfcgirsLNALSTISVS-NDKILLTDEATSSIVMFSLNELsSSKAVI  353
DSSP  hhhllllllhhhllllllllHHHHLLEEEE-LLEEEEEEHHHLEEEEEELLLHhHLEEEE


DSSP  EHH----------------hllllLLLEEEeEEELLL---LLEEEeEELLllllhhhlll
Query NAN----------------diegvQLFFVAqLFPLQN---GGLYIcNWQGhdreagkgkh  241
ident                                           |                 
Sbjct SPFsdvfiptqvtanltmllrkmkHDIINS-ISTCEVdetPLLVA-CDNS----------  401
DSSP  LLLlleeeeeeeelleeeeeeellLLLEEE-EEEEELlllEEEEE-EELL----------


DSSP  lleeeELLLlleeeeelllllllllleeeeell
Query pqlveIDSEgkvvwqlndkvkfgxisticpire  274
ident                                  
Sbjct --gliGIFQ------------------------  408
DSSP  --lleEEEL------------------------


No 110: Query=mol1A Sbjct=1q47B Z-score=12.2

back to top
DSSP  llleeeeellllleeeeeelllleeEEEEELLLL-LLLLEEEELLL-LLEEEELLLEEEE
Query spqhllvggsgwnkiaiinkdtkeiVWEYPLEKG-WECNSVAATKA-GEILFSYSKGAKX   58
ident                          |                                  
Sbjct ------knnvprlklsykemlesnnVITFNGLANsSSYHTFLLDEErSRLYVGAKDHIFS   54
DSSP  ------lllllleeelhhhhhllllLEEELLLLLlLLLLEEEEELLlLEEEEELLLEEEE


DSSP  ELLL--LLEEEEEELL------------------LLLEEEEEEELLLLLEEEEEEL-LLE
Query ITRD--GRELWNIAAP------------------AGCEXQTARILPDGNALVAWCG-HPS   97
ident                                                        |    
Sbjct FNLVniKDFQKIVWPVsytrrdeckwagkdilkeCANFIKVLEAYNQTHLYACGTGaFHP  114
DSSP  EELLllLLEEEEELLLlhhhhhhhhhllllllllLLEEEEEEEELLLLEEEEEEEElLLL


DSSP  EEEEELL-------LLLEE--EEEEELL-llLLHHHlLLLLEELLlLLEEEEEL-----L
Query TILEVNX-------KGEVL--SKTEFET-giERPHAqFRQINKNKkGNYLVPLF-----A  142
ident                                  |            |             
Sbjct ICTYIEVghhpednIFKLQdsHFENGRGkspYDPKL-LTASLLID-GELYSGTAadfmgR  172
DSSP  EEEEEELlllllllLLEEEeeEEEELLLlllLLLLL-LLEEEEEL-LEEEEEEElllllL


DSSP  LLEEEEELLllLEEEEEE-------lLLLLLEEEELLL------LLEEEELLL-------
Query TSEVREIAPngQLLNSVK-------lSGTPFSSAFLDN------GDCLVACGD-------  182
ident                                |                            
Sbjct DFAIFRTLG-hHHPIRTEqhdsrwlnDPRFISAHLIPEsdnpedDKVYFFFREnaidgeh  231
DSSP  LEEEEEEEL-lLLLLLLLllllllllLLEEEEEEEEELlllhhhEEEEEEEEEellllll


DSSP  -----lLEEEEELLLL-----------LLEEEEEEH------hhlllLLLLEEEeEEELL
Query -----aHCFVQLNLES-----------NRIVRRVNA------ndiegVQLFFVAqLFPLQ  220
ident           |                                             |   
Sbjct sgkathARIGQICKNDfgghrslvnkwTTFLKARLIcsvpgpngidtHFDELQD-VFLMN  290
DSSP  lllleeEEEEEEELLLlllllllllllLLLEEEELLleellllllleELLEEEE-EEEEL


DSSP  L-----LLEEEEEellLLLLhhHLLLLlEEEELLLL------------------------
Query N-----GGLYICNwqgHDREagKGKHPqLVEIDSEG------------------------  251
ident          |                                                  
Sbjct SkdpknPIVYGVF--tTSSN-iFKGSA-VCMYSMSDvrrvflgpyahrdgpnyqwvpyqg  346
DSSP  LlllllLEEEEEE--eLLLL-lLLLEE-EEEELHHHhhhhhlllleelllllllleelll


DSSP  ------------------------------------------LEEE---EELL-------
Query ------------------------------------------KVVW---QLND-------  259
ident                                                             
Sbjct rvpyprpgtcpsktfggfdstkdlpddvitfarshpamynpvFPINnrpIMIKtdvnyqf  406
DSSP  llllllllllllllllllllhhhlllhhhhllllllllllllLLHHhllLEEElllllle


DSSP  ----------------------LLLL-----------------------------LLLLE
Query ----------------------KVKF-----------------------------GXIST  268
ident                        |                                 || 
Sbjct tqivvdrvdaedgqydvmfigtDVGTvlkvvsvpketwhdleevlleemtvfrepTTISA  466
DSSP  eeeeeeeeeelleeeeeeeeeeLLLEeeeeelllllllllllleeeeeeelllllLLLLE


DSSP  EEEELL-----------------------
Query ICPIRE-----------------------  274
ident                              
Sbjct MELSTKqqqlyigstagvaqlplhrcdiy  495
DSSP  EEEELLlleeeeeelleeeeeelllllll


No 111: Query=mol1A Sbjct=1s18A Z-score=12.2

back to top
DSSP  ------------------LLLEEEEELLLL------------lEEEEEELL--------l
Query ------------------SPQHLLVGGSGW------------nKIAIINKD--------t   22
ident                         |                                   
Sbjct nwyndtyplsppqrtpagIRYRIAVIADLDtesraqeentwfsYLKKGYLTlsdsgdkva   60
DSSP  lllllllllllleeelleEEEEEEEEEELHhhhllllllleeeEEEEEEEEeelllllee


DSSP  LEEE--EEEELL------LLLLLLEEEELLLlLEEEELL--LEEEEELlLLLEEEEEELL
Query KEIV--WEYPLE------KGWECNSVAATKAgEILFSYS--KGAKXITrDGRELWNIAAP   72
ident  |                 | |                        |             
Sbjct VEWDkdHGVLEShlaekgRGMELSDLIVFNG-KLYSVDDrtGVVYQIE-GSKAVPWVILS  118
DSSP  EEELllLEEEEEllllllLLLLEEEEEEELL-EEEEEELllLEEEEEE-LLEEEEEEELL


DSSP  ------LLLEEE-EEEELlLLLEEEE-------------eellleeEEEELLLLLEeEEE
Query ------AGCEXQ-TARILpDGNALVA-------------wcghpstILEVNXKGEVlSKT  112
ident                    |    |                        |  || |    
Sbjct dgdgtvEKGFKAeWLAVK-DERLYVGglgkewttttgdvvnenpewVKVVGYKGSV-DHE  176
DSSP  llllllLLLLLLlEEEEE-LLEEEEEllllleellllleeelhhheEEEELLLLLE-EEE


DSSP  EellllllhhhllllleellllleeeeelllleeEEELlllleeeEEEL---------LL
Query EfetgierphaqfrqinknkkgnylvplfatsevREIApngqllnSVKL---------SG  163
ident                                                             
Sbjct N---------------------------------WVSN------yNALRaaagiqppgYL  197
DSSP  E---------------------------------LHHH------hHHHHhhlllllllEE


DSSP  LLLEEEEL-LLLLEEEELLLL--------------LEEEEELL--lLLLEeEEEEHHhll
Query TPFSSAFL-DNGDCLVACGDA--------------HCFVQLNL--eSNRIvRRVNANdie  206
ident    |                |                                       
Sbjct IHESACWSdTLQRWFFLPRRAsqerysekdderkgANLLLSASpdfGDIA-VSHVGA---  253
DSSP  ELLLEEEElLLLEEEELLLEEelllllhhhhllllLLEEEEELlllLLEE-EEELLL---


DSSP  llLLLEEEEEEEL---LLLLEEEEEELlLLLLHHhllllLEEEELLLLLEEE-EELLLLl
Query gvQLFFVAQLFPL---QNGGLYICNWQgHDREAGkgkhpQLVEIDSEGKVVW-QLNDKVk  262
ident                              |                 |            
Sbjct vvPTHGFSSFKFIpntDDQIIVALKSE-EDSGRV---asYIMAFTLDGRFLLpETKIGS-  308
DSSP  llLLEEEEEEEELlllLLLEEEEEEEE-EELLEE---eeEEEEEELLLLEEEeEEEEEL-


DSSP  lLLLLEEEEEll
Query fGXISTICPIre  274
ident       |  |  
Sbjct -VKYEGIEFI--  317
DSSP  -LEEEEEEEL--


No 112: Query=mol1A Sbjct=2uvkB Z-score=12.1

back to top
DSSP  llleeeeellllleeeeeelllleEEEE-EELLllLLLLEEEELLlLLEEEELL--LEEE
Query spqhllvggsgwnkiaiinkdtkeIVWE-YPLEkgWECNSVAATKaGEILFSYS--KGAK   57
ident                          |    |          |                | 
Sbjct ------------------------SVLPeTPVP--FKSGTGAIDN-DTVYIGLGsaGTAW   33
DSSP  ------------------------LLLLlLLLL--LLLLEEEEEL-LEEEEELHhhLLLE


DSSP  EELL-----LLLEEEEEELLLLLEeEEEEELlLLLEEEEEEL---------lLEEEEEEL
Query XITR-----DGRELWNIAAPAGCExQTARILpDGNALVAWCG---------hPSTILEVN  103
ident                           |     |||  |                     |
Sbjct YKLDtqakdKKWTALAAFPGGPRDqATSAFI-DGNLYVFGGIgknsegltqvFNDVHKYN   92
DSSP  EEEElllllLLLEELLLLLLLLLLlLEEEEE-LLEEEEELLEeellllleeeLLLEEEEE


DSSP  L-LLLEEEE-EEELLllllhhhLLLLLEELLlLLEEEEELL-------------------
Query X-KGEVLSK-TEFETgierphaQFRQINKNKkGNYLVPLFA-------------------  142
ident                                 |   |                       
Sbjct PkTNSWVKLxSHAPX-----gxAGHVTFVHN-GKAYVTGGVnqnifngyfedlneagkds  146
DSSP  LlLLEEEELlLLLLL-----llLLEEEEEEL-LEEEEEELLlhhhhhhhhhhhhhhlllh


DSSP  -------------------LLEEEEELL---LLLEEEEEE--LLLLLLEEEELLlLLEEE
Query -------------------TSEVREIAP---NGQLLNSVK--LSGTPFSSAFLDnGDCLV  178
ident                                                             
Sbjct taidkinahyfdkkaedyfFNKFLLSFDpstQQWSYAGESpwYGTAGAAVVNKG-DKTWL  205
DSSP  hhhhhhhhhhhlllhhhhlLLLEEEEEElllLEEEEEEELllLLLLLLEEEEEL-LEEEE


DSSP  E------llLLLEEEEELLL--LLLEEEEEEHhhllllLLLEeEEEEELLlLLEEEEEEL
Query A------cgDAHCFVQLNLE--SNRIVRRVNAndiegvQLFFvAQLFPLQnGGLYICNWQ  230
ident                 |                                    |      
Sbjct IngeakpglRTDAVFELDFTgnNLKWNKLAPV---sspDGVAgGFAGISN-DSLIFAGGA  261
DSSP  ElleeelleELLLEEEEELLllLLEEEELLLL---lllLLLLlLEEEEEL-LEEEEELLE


DSSP  lLLLL--------------hhhlllLLEEEE-LLLLLEEEEELLLlllLLLL-EEEEEL-
Query gHDRE--------------agkgkhPQLVEI-DSEGKVVWQLNDKvkfGXIS-TICPIR-  273
ident                                                 |       |   
Sbjct -GFKGsrenyqngknyaheglkksySTDIHLwHNGKWDKSGELSQ---GRAYgVSLPWNn  317
DSSP  -ELLLhhhhhhlllllllllllleeLLEEEEeELLEEEEEEELLL---LLLLlEEEEELl


DSSP  -------------------------------l
Query -------------------------------e  274
ident                                 
Sbjct slliiggetaggkavtdsvlitvkdnkvtvqn  349
DSSP  eeeeelleehhheellleeeeeeelleeeeel


No 113: Query=mol1A Sbjct=2ovqB Z-score=12.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr   60
DSSP  llhhhhhhhhlllllllhhhhllhhhhhhhhllllhhhhhhhllllhhhhhhhllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ekckeegideplhikrrkvikpgfihspwksayirqhridtnwrrgelkspkvlkghddh  120
DSSP  hhhhhllllllllllllllllllllllhhhhhhhhhhhhhhhhhhlllllleeeelllll


DSSP  --------LLLEE----------------------eeellLLLEEEEEElllleeEEEEE
Query --------SPQHL----------------------lvggsGWNKIAIINkdtkeiVWEYP   30
ident                                         |                   
Sbjct vitclqfcGNRIVsgsddntlkvwsavtgkclrtlvghtgGVWSSQMRD-----nIIISG  175
DSSP  leeeeeeeLLEEEeeelllleeeeellllleeeeelllllLEEEEEEEL-----lEEEEE


DSSP  LLL---------------------LLLLlEEEELLlLLEEEELLL-EEEEELLL-LLEEE
Query LEK---------------------GWECnSVAATKaGEILFSYSK-GAKXITRD-GRELW   67
ident                                                        |  | 
Sbjct STDrtlkvwnaetgecihtlyghtSTVR-CMHLHE-KRVVSGSRDaTLRVWDIEtGQCLH  233
DSSP  ELLlleeeeellllleeeeellllLLEE-EEEEEL-LEEEEEELLlEEEEEELLlLLEEE


DSSP  E-EELLllLEEEEEEELlLLLEEEEEELllEEEEEELLL-LLEEEEEeELLLlllhhHLL
Query N-IAAPagCEXQTARILpDGNALVAWCGhpSTILEVNXK-GEVLSKTeFETGierphAQF  125
ident                                            |                
Sbjct VlMGHV--AAVRCVQYD-GRRVVSGAYD--FMVKVWDPEtETCLHTL-QGHT-----NRV  282
DSSP  EeELLL--LLEEEEEEL-LLLEEEEELL--LLEEEEEHHhLEEEEEE-LLLL-----LLE


DSSP  LLLEELllLLEEEEELLlLEEEEELL-LLLEEEEEE-LLLLLLEEEELLlLLEEEELLlL
Query RQINKNkkGNYLVPLFAtSEVREIAP-NGQLLNSVK-LSGTPFSSAFLDnGDCLVACGdA  183
ident                      |      |                   |           
Sbjct YSLQFD-gIHVVSGSLD-TSIRVWDVeTGNCIHTLTgHQSLTSGMELKD-NILVSGNA-D  338
DSSP  EEEEEL-lLEEEEEELL-LLEEEEELlLLLEEEEELlLLLLEEEEEEEL-LEEEEEEL-L


DSSP  LEEEEELLLLLLEEEEEEHHH------------------------------------lLL
Query HCFVQLNLESNRIVRRVNAND------------------------------------iEG  207
ident                                                             
Sbjct STVKIWDIKTGQCLQTLQGPNkhqsavtclqfnknfvitssddgtvklwdlktgefirNL  398
DSSP  LLEEEEELLLLLEEEEELLLLllllleeeeeellleeeeeellleeeeeellllleeeEE


DSSP  LLlleeeeeeellllleeeeeelllllLHHHLLLLLEEEELLllleEEEELLLL----ll
Query VQlffvaqlfplqngglyicnwqghdrEAGKGKHPQLVEIDSegkvVWQLNDKV----kf  263
ident |                            | |                            
Sbjct VT-----------------------leSGGSGGVVWRIRASN--tkLVCAVGSRngteet  433
DSSP  EE-----------------------llLHHHLLEEEEEEELL--leEEEEEELLllllll


DSSP  lllleeeeell
Query gxisticpire  274
ident            
Sbjct kllvldfdvdm  444
DSSP  eeeeeelllll


No 114: Query=mol1A Sbjct=1shyB Z-score=12.0

back to top
DSSP  llleeeeellllleeeeeelllleeEEEEELLlLLLLlEEEELlLLLEEEELLLEEEEEL
Query spqhllvggsgwnkiaiinkdtkeiVWEYPLEkGWECnSVAATkAGEILFSYSKGAKXIT   60
ident                                |       |       |            
Sbjct ----------------------kyqLPNFTAE-TPIQ-NVILH-EHHIFLGATNYIYVLN   35
DSSP  ----------------------lllLLEEELL-LLEE-EEEEE-LLEEEEEELLEEEEEE


DSSP  L-LLLEEEEEELLL-------------------------LLEEEEEEELL--LLLEEEEE
Query R-DGRELWNIAAPA-------------------------GCEXQTARILP--DGNALVAW   92
ident   |                                                 |       
Sbjct EeDLQKVAEYKTGPvlehpdcfpcqdcsskanlsggvwkDNINMALVVDTyyDDQLISCG   95
DSSP  LlLLLEEEEEELLLeeellllllllllllllllllleeeLLLEEEEEEELllLLEEEEEE


DSSP  ELLLEEEEEEL------LLLL-EEEEEE--------ellllllHHHLLlLLEELLL---L
Query CGHPSTILEVN------XKGE-VLSKTE--------fetgierPHAQFrQINKNKK---G  134
ident      |                                                 |    
Sbjct SVNRGTCQRHVfphnhtADIQsEVHCIFspqieepsqcpdcvvSALGA-KVLSSVKdrfI  154
DSSP  LLLLLLEEEEEllllllLLLLlLEEELLlllllllllllllllLLLLE-EEEEEEElleE


DSSP  LEEEEELLL---------lEEEEELL-----LLLEE---EEEE--------lLLLLLEEE
Query NYLVPLFAT---------sEVREIAP-----NGQLL---NSVK--------lSGTPFSSA  169
ident |  |                               |                        
Sbjct NFFVGNTINssyfpdhplhSISVRRLketkdGFMFLtdqSYIDvlpefrdsyPIKYVHAF  214
DSSP  EEEEEELLLllllllllllLEEEEEElllllLEEELlhhHEELllllhhhhlLLEEEEEE


DSSP  ELlLLLEEEELLL---------lLEEEEELLL---lLLEEEEEEH-hhlllLLLLEEEeE
Query FLdNGDCLVACGD---------aHCFVQLNLE---sNRIVRRVNA-ndiegVQLFFVAqL  216
ident    |                                               |     |  
Sbjct ES-NNFIYFLTVQretldaqtfhTRIIRFCSInsglHSYMEMPLEciltkeVFNILQA-A  272
DSSP  EE-LLEEEEEEELllllllllllEEEEEEELLllllLLLEEEEEEeellllLLLLLLE-E


DSSP  EELLL--------------LLEEEEE----ellLLLLhhhLLLLlEEEELLLL-------
Query FPLQN--------------GGLYICN----wqgHDREagkGKHPqLVEIDSEG-------  251
ident                      |                                      
Sbjct YVSKPgaqlarqigaslndDILFGVFaqskpdsAEPM---DRSA-MCAFPIKYvndffnk  328
DSSP  EEELLlhhhhhhhllllllLEEEEEEeeellllLLEE---EEEE-EEEEEHHHhhhhhhl


DSSP  --------------------------------------------------------leEE
Query --------------------------------------------------------kvVW  255
ident                                                             
Sbjct invrclqhfygpnhehcfnrdeyrtefttalqrvdlfmgqfsevlltsistfikgdltIA  388
DSSP  lllllllllllllllllllllllleelllleeeellllllllllleeeeeeeeelleeEE


DSSP  EELLLLLL-----------------------LLLLEEEEEL-------------------
Query QLNDKVKF-----------------------GXISTICPIR-------------------  273
ident  |                                                          
Sbjct NLGTSEGRfmqvvvsrsgpstphvnflldshPVSPEVIVEHtlnqngytlvitgkkitki  448
DSSP  EEEELLLEeeeeelllllllllllleellllLEEEEEEEEEellleeeeeeeelleeeee


DSSP  --------------------------------------------------l
Query --------------------------------------------------e  274
ident                                                    
Sbjct plnglgcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqiclpa  499
DSSP  ellhhhhlllllhhhhhlllhhhlleeelleeelhhhllllllllllllll


No 115: Query=mol1A Sbjct=2uzyB Z-score=11.8

back to top
DSSP  llleeeeellllleeeeeelllleeEEEEELLllLLLLEEEELlLLLEEEELLLEEEEEL
Query spqhllvggsgwnkiaiinkdtkeiVWEYPLEkgWECNSVAATkAGEILFSYSKGAKXIT   60
ident                                |       |       |            
Sbjct ------------------------qLPNFTAE--TPIQNVILH-EHHIFLGATNYIYVLN   33
DSSP  ------------------------lLLLLLLL--LLEEEEEEL-LLLEEEEELLEEEEEE


DSSP  LL-LLEEEEEELLL------LLEEEEEEELLL--LLEEEEEELLLEEEEEELLL---LLE
Query RD-GRELWNIAAPA------GCEXQTARILPD--GNALVAWCGHPSTILEVNXK---GEV  108
ident                                               |           ||
Sbjct EEdLQKVAEYKTGPvlevwkDNINMALVVDTYydDQLISCGSVNRGTCQRHVFPhnhSEV   93
DSSP  LLlLEEEEEEELLLeelleeLLLLLEEEEELLllLEEEEELLLLLLLEEEEELLlllLLL


DSSP  EEEE-------eellllllhHHLLlLLEELLL---LLEEEEELLL-----lEEEEELL--
Query LSKT-------efetgierpHAQFrQINKNKK---GNYLVPLFAT-----sEVREIAP--  151
ident                                |    |  |                    
Sbjct HCIFspqieepsqcpdcvvsALGA-KVLSSVKdrfINFFVGNTINssyplhSISVRRLke  152
DSSP  LLLLllllllllllllllllLLLE-EEEEELLlllLEEEEEELLLllllllLEEEEEEll


DSSP  ---LLLEE---EEEE--------lLLLLLEEEELlLLLEEEELLL--------lLEEEEE
Query ---NGQLL---NSVK--------lSGTPFSSAFLdNGDCLVACGD--------aHCFVQL  189
ident        |                           |                  |     
Sbjct tkdGFMFLtdqSYIDvlpefrdsyPIKYVHAFES-NNFIYFLTVQretldaqtfHTRIIR  211
DSSP  lllLEELLlllLEELllhhhllllLLEEEEEEEE-LLEEEEEEELlllllllllLLEEEE


DSSP  LLL-----LLLEeEEEEHHhllllLLLEEEeEEELLL--------------LLEEEEEE-
Query NLE-----SNRIvRRVNANdiegvQLFFVAqLFPLQN--------------GGLYICNW-  229
ident                              |                       |      
Sbjct FCSinsglHSYM-EMPLECiltevFNILQA-AYVSKPgaqlarqigaslndDILFAVFAq  269
DSSP  EELlllllLLLE-EEEEEEellllLLEEEE-EEEELLlllhhhhlllllllLEEEEEEEl


DSSP  ----llLLLLH-------------------------------------------------
Query ----qgHDREA-------------------------------------------------  236
ident                                                             
Sbjct skpdsaEPMDRsamcafpikyvndffnkirclqhfygpnhehcsgcedeyrtefttalqr  329
DSSP  llllllLLLLLllleeeehhhhhhhlllllllllllllllllllllllllllllllleee


DSSP  -------hhlLLLLEEE-ellllleEEEE-LLLLLL----------------------LL
Query -------gkgKHPQLVE-idsegkvVWQL-NDKVKF----------------------GX  265
ident                             |      |                        
Sbjct vdlfmgqfseVLLTSIStfikgdltIANLgTSEGRFmqvvvsrsgpstphvnflldshPV  389
DSSP  elllllllllLLEEEEEelllllleEEEEeELLLEEeeeeellllllllleeeellllLL


DSSP  LLEEEEELL---------------------------------------------------
Query ISTICPIRE---------------------------------------------------  274
ident                                                             
Sbjct SPEVIVEHTlnqngytlvitgkkitkiplnglgcrhfqscsqclsappfvqcgwchdkcv  449
DSSP  LLLEEEELLllllleeeeeelleeeeeelllllllllllhhhhhllllllleeeelleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct rseeclsgtwtqqiclpaiykvfpnsapleggtrlticgwdfgfrrnnkfdlkktrvllg  509
DSSP  ehhhllllleelllllleeeeeelllllllllleeeeeeellleelllleelllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct nesctltlsestmntlkctvgfnmsiiisnghgttqystfsyvdpvitsispkygpmagg  569
DSSP  leeleelhhhlllleeeeelllllleeeelllleeeellllllllleeeeelleelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct tlltltgnhisiggktctlksvsnsilecytpaqtistefavklkidlanretsifsyre  629
DSSP  leeeeeellleellllleeeelllleeeeelllllllleeleelllllllllllleeell


DSSP  -
Query -  274
ident  
Sbjct d  630
DSSP  l


No 116: Query=mol1A Sbjct=1cvmA Z-score=11.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct klsdpyhftvnaaaetepvdtagdaaddpaiwldpknpqnsklittnkksglavyslegk   60
DSSP  lllllleeeellleelllllllllleeeeeeelllllhhhleeeeeellllleeeellll


DSSP  ------------------------LLLEEEEELLL--LLEEEEEELL----LLEEEE---
Query ------------------------SPQHLLVGGSG--WNKIAIINKD----TKEIVW---   27
ident                                       | | |   |    |        
Sbjct mlhsyhtgklnnvdirydfplngkKVDIAAASNRSegKNTIEIYAIDgkngTLQSITdpn  120
DSSP  eeeellllleeeeeeeeeeeelleEEEEEEEEELHhhLLEEEEEEELllllLEEELLlll


DSSP  -EEELLLLLLLlEEEELL-----LLLEEEELL-LEEEEELLL--------LLEEEEEELL
Query -EYPLEKGWECnSVAATK-----AGEILFSYS-KGAKXITRD--------GRELWNIAAP   72
ident                                                   |         
Sbjct rPIASAIDEVY-GFSLYHsqktgKYYAMVTGKeGEFEQYELNadkngyisGKKVRAFKMN  179
DSSP  lLLLLLLLLEE-EEEEEElllllLEEEEEEELlLEEEEEEEEellllleeEEEEEEEELL


DSSP  llLEEEEEEELL-LLLEEEEEELLlEEEEEE-LLLLLEEEEEEELLLLllhhHLLLLLEE
Query agCEXQTARILP-DGNALVAWCGHpSTILEV-NXKGEVLSKTEFETGIerphAQFRQINK  130
ident               |    |               |                        
Sbjct --SQTEGMAADDeYGSLYIAEEDE-AIWKFSaEPDGGSNGTVIDRADGrhltPDIEGLTI  236
DSSP  --LLEEEEEEELlLLEEEEEELLL-EEEEEElLHHHLLLLEEEEELLLllllLLEEEEEE


DSSP  LLL----LLEEEEELLLLEEEEEL--lLLLEEEEEEL--------LLLLLEEEELL----
Query NKK----GNYLVPLFATSEVREIA--pNGQLLNSVKL--------SGTPFSSAFLD----  172
ident        |  |      |                                    |     
Sbjct YYAadgkGYLLASSQGNSSYAIYErqgQNKYVADFQItdgpetdgTSDTDGIDVLGfglg  296
DSSP  EELllllEEEEEEELLLLEEEEEElllLLLEEEEEEEllllllllLLLLLLEEEELllll


DSSP  ----LLLEEEELLLL--------LEEEEELLLLLleeeeeehhhllllllleeeeeeELL
Query ----NGDCLVACGDA--------HCFVQLNLESNrivrrvnandiegvqlffvaqlfPLQ  220
ident      |      |            |     |                            
Sbjct peypFGLFVAQNGENidhgqkanQNFKMVPWERI---------adkigfhpqvnkqvDPR  347
DSSP  llllLLEEEEEELLLeelleellLEEEEEELHHH---------hhhhllllllllllLLL


DSSP  Llleeeeeellllllhhhllllleeeellllleeeeelllllllllleeeeell
Query Ngglyicnwqghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                                       
Sbjct K------------------------------------------------mtdrs  353
DSSP  L------------------------------------------------lllll


No 117: Query=mol1A Sbjct=1v0eA Z-score=11.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqpl   60
DSSP  lllleeeeelhhhhhhhhhhlllllleelllleeeelllllhhheelleeeellllllle


DSSP  --------------------------------LLLEEEEeLLLL-------LEEEEEELL
Query --------------------------------SPQHLLVgGSGW-------NKIAIINKD   21
ident                                           |                 
Sbjct yyaseefvqgelfkitdtpyynawpqdkafvyENVIYAP-YMGSdrhgvsrLHVSWVKSG  119
DSSP  eeelllllleeeeelllllleeelllllleeeLLEEEEE-EEEElllllllLEEEEEEEL


DSSP  ----LLEEEEEEELL------LLLLLLEEEELLLLLEEEEL--------llEEEEELL--
Query ----TKEIVWEYPLE------KGWECNSVAATKAGEILFSY--------skGAKXITR--   61
ident     |                    | |                             |  
Sbjct ddgqTWSTPEWLTDLhpdyptVNYHCMSMGVCRNRLFAMIEtrtlaknaltNCALWDRpm  179
DSSP  llllLLLLLEELLLLllllllEEEELLLEEEELLEEEEEEEeeellllleeEEEEEEEel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   61
ident                                                             
Sbjct srslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnft  239
DSSP  lleeeeelleeellllleeeeelllllllllleeeeelllllllleeeelleeeelleee


DSSP  ---------------------------LLLEEEEEELLlLLEEEEEEELLL-LLEEEEEE
Query ---------------------------DGRELWNIAAPaGCEXQTARILPD-GNALVAWC   93
ident                              |       |            |         
Sbjct vltpnqqtsdlnnagknwhmgtsfhksPWRKTDLGLIP-SVTEVHSFATIDnNGFAMGYH  298
DSSP  eelllllllleelllleeeeeelllllLLEEEELLLLL-LLLEEEEEEELLlLLEEEEEE


DSSP  L-----LLEEEEEELL----LLLEeEEEEE---LLLLllhhhLLLLLEELL-LLLEEEEE
Query G-----HPSTILEVNX----KGEVlSKTEF---ETGIerphaQFRQINKNK-KGNYLVPL  140
ident                                                 |      ||   
Sbjct QgdvapREVGLFYFPDafnsPSNY-VRRQIpseYEPD-----ASEPCIKYYdGVLYLITR  352
DSSP  ElllllLEEEEEEELLllllLLLL-EEEELlhhHLLL-----EEEEEEEEElLEEEEEEE


DSSP  LL----LLEEEEEL---LLLLeEEEEE--lLLLLLEEEELLLLLEEEELLLL--------
Query FA----TSEVREIA---PNGQlLNSVK--lSGTPFSSAFLDNGDCLVACGDA--------  183
ident                                            |                
Sbjct GTrgdrLGSSLHRSrdiGQTW-ESLRFphnVHHTTLPFAKVGDDLIMFGSERaeneweag  411
DSSP  ELllllLLLEEEEElllLLLL-EEEELlllLLLLLLLEEEELLEEEEEEELLllllllll


DSSP  ------------LEEEEELLLLLLE--EEEEEHhhlllLLLL---------EEEEEEELL
Query ------------HCFVQLNLESNRI--VRRVNAndiegVQLF---------FVAQLFPLQ  220
ident                  ||           ||                            
Sbjct apddrykasyprTFYARLNVNNWNAddIEWVNI-----TDQIyqggivnsgVGVGSVVVK  466
DSSP  llllllllllleEEEEEEELLLLLLllLLLEEE-----EELLlllllllllLEEEEEEEE


DSSP  -LLLEEEEEELlllllHHHL------------------LLLLEEEELL------------
Query -NGGLYICNWQghdreAGKG------------------KHPQLVEIDS------------  249
ident  |   |                                                      
Sbjct dNYIYYMFGGE-----DHFNpwtygdnsakdpfksdghPSDLYCYKMKigpdnrvsrdfr  521
DSSP  lLEEEEEEEEL-----LLLLllllllllllllllllllLLEEEEEEEEllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct ygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmegeygfig  581
DSSP  elllllllllleellllleeellleeellleeelleeelllllllleeeeeellleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct ksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsadvkpyn  641
DSSP  ellllllhhhleeeeellllllhhhlleeeeelllllllleeeeelleeeeellleeell


DSSP  llleeeeelllllllllleeeeell
Query egkvvwqlndkvkfgxisticpire  274
ident                          
Sbjct dnvtalggpsnrfttaylgsnpivt  666
DSSP  lllllllllllllllleelllleel


No 118: Query=mol1A Sbjct=3eu7A Z-score=11.5

back to top
DSSP  ---llleeeeellllLEEEEEE---lllleeEEEEELL----------------------
Query ---spqhllvggsgwNKIAIIN---kdtkeiVWEYPLE----------------------   32
ident                                                             
Sbjct nlqlvselknpsgscSVDVSAMfwegckepcIITACEDvvslwkaldawqweklytwhfa   60
DSSP  leeeeeeelllllllEEEEEEEelllllleeEEEEELLeeeeeeellllleeeeeeeell


DSSP  -LLLLLleEEELL-LLLEEEEL----LLEEEEELllLLEEEEEELlllLEEEEEEeLLLL
Query -KGWECnsVAATK-AGEILFSY----SKGAKXITrdGRELWNIAApagCEXQTARiLPDG   86
ident         |                                               |   
Sbjct eVPVLQ-iVPVPDvYNLVCVALgnleIREIRALFcsEKQVLLKSG---NIKAVLG-LTKR  115
DSSP  lLLEEE-eELLLLlLLLEEEEEllllEEEEEEEEllLEEEEEEEE---EEEEEEE-ELLL


DSSP  lEEEEEEL---LLEEEEEEL-LLLLeEEEEEELLLLllhhHLLLlLEEL--LLLLEEEEE
Query nALVAWCG---HPSTILEVN-XKGEvLSKTEFETGIerphAQFRqINKN--KKGNYLVPL  140
ident   ||   |               |                                |   
Sbjct -RLVSSSGtlsDQQVEVMTFaGGGK-ENQFLMPPEE----TILT-FAEVqgMQEALLGTT  168
DSSP  -EEEEEELlllLLEEEEEEElLLEE-EEEEELLLLL----LEEE-EEEEelLLLEEEEEE


DSSP  lLLLEEEEELL-LLLEEEEEEL---LLLLLE-EEELLLLLEEEELLL-llEEEEELLLLL
Query fATSEVREIAP-NGQLLNSVKL---SGTPFS-SAFLDNGDCLVACGD-ahCFVQLNLESN  194
ident              ||||                |    |                |    
Sbjct -IMNNIVIWNLkTGQLLKKMHIddsYQASVChKAYSEMGLLFIVLSHpvfQLIVINPKTT  227
DSSP  -LLLEEEEEELlLLLEEEEEELlllLLLLLEeEEEEELLEEEEEEELlleEEEEELLLLL


DSSP  LEEEEEEhhHLLL----LLLLEeeEEEELllllEEEEEellllllhhhlLLLLeEEEL-L
Query RIVRRVNanDIEG----VQLFFvaQLFPLqnggLYICNwqghdreagkgKHPQlVEID-S  249
ident   |                                                      |  
Sbjct LSVGVML--YCLPpgqaGRFLE-gDVKDH----XAAAI---------ltSGTI-AIWDlL  270
DSSP  LEEEEEE--ELLLllllLLEEE-eEEELL----EEEEE---------elLLLE-EEEElL


DSSP  LLLEEEEELLL--LLLLLLleEEEEL------------------l
Query EGKVVWQLNDK--VKFGXIstICPIR------------------e  274
ident  |     |                                     
Sbjct LGQCTALLPPVsdQHWSFV--KWSGTdshllagqkdgnifvyhys  313
DSSP  LLLEEEEELLLllLLLLEE--EELLLlleeeeellllleeeeeel


No 119: Query=mol1A Sbjct=1xipA Z-score=11.4

back to top
DSSP  llleeeeellllleeeeeelLLLEEEEEEELLLL------lllLEEEELL-LLLEEEELL
Query spqhllvggsgwnkiaiinkDTKEIVWEYPLEKG------wecNSVAATK-AGEILFSYS   53
ident                       |       |                             
Sbjct ----asslkdevptetsedfGFKFLGQKQILPSFneklpfaslQNLDISNsKSLFVAASG   56
DSSP  ----lleellllleeeelllEEEEEEEEELLLLLlllllllllLLEEEELlLLEEEEEEL


DSSP  LEEEEELLLL------------LEEEEEELLlllEEEEEEELlLLLEEEEEElllEEEEE
Query KGAKXITRDG------------RELWNIAAPagcEXQTARILpDGNALVAWCghpSTILE  101
ident   |                      |    |                ||           
Sbjct SKAVVGELQLlrdhitsdstplTFKWEKEIP---DVIFVCFH-GDQVLVSTR---NALYS  109
DSSP  LEEEEEEHHHhhhhhhllllllLLLEEEELL---LEEEEEEE-LLEEEEEEL---LEEEE


DSSP  ELLL-LLEEEEEEeLLLLllhhHLLLlLEELLlLLEEEEElLLLEEEEELL-LLLEEEEE
Query VNXK-GEVLSKTEfETGIerphAQFRqINKNKkGNYLVPLfATSEVREIAP-NGQLLNSV  159
ident                         |                                   
Sbjct LDLEeLSEFRTVT-SFEK----PVFQ-LKNVN-NTLVILN-SVNDLSALDLrTKSTKQLA  161
DSSP  EELLlLLLEEEEE-ELLL----LEEE-EEELL-LEEEEEE-LLLEEEEEELlLLLEEEEE


DSSP  ELLLLLleEEELllLLEEeellllleeeEELLL--LLLEE--------------------
Query KLSGTPfsSAFLdnGDCLvacgdahcfvQLNLE--SNRIV--------------------  197
ident                                                             
Sbjct QNVTSF--DVTN--SQLA-vllkdrsfqSFAWRngEXEKQfefslpseleelpveeyspl  216
DSSP  ELEEEE--EELL--LEEE-eeelllleeEEEEEllEEEEEeeelllhhhhllllllleee


DSSP  --------eEEEH----------------HHLL--------------LLLLL-------E
Query --------rRVNA----------------NDIE--------------GVQLF-------F  212
ident                                                             
Sbjct svtilspqdFLAVfgnvisetddevsydqKXYIikhidgsasfqetfDITPPfgqivrfP  276
DSSP  eeeelllleEEEEeellllllllllllleEEEEeeeelleeeeeeelLLLLLlllllllL


DSSP  EEEEEELL------LLLEEEEEELlllllhhhlllLLEEEELLLlLEEE------eELLL
Query VAQLFPLQ------NGGLYICNWQghdreagkgkhPQLVEIDSEgKVVW------qLNDK  260
ident       |                                  ||   |             
Sbjct YXYKVTLSgliepdANVNVLASSC----------sSEVSIWDSK-QVIEpsqdserAVLP  325
DSSP  LEEEEEEEeeeellEEEEEEEELL----------lLLLEEELLL-LEEEellhhhlLLLL


DSSP  LL-----LLLLLEEEEELL-----------------------
Query VK-----FGXISTICPIRE-----------------------  274
ident                                           
Sbjct ISeetdkDTNPIGVAVDVVtsglplvyilnnegslqivglfh  367
DSSP  LLlllllLLLEEEEEEELLllllleeeeeellleeeeeeeel


No 120: Query=mol1A Sbjct=1r5mA Z-score=11.4

back to top
DSSP  ---llleeeeelllLLEEEEeelllleeEEEEELLL------------------------
Query ---spqhllvggsgWNKIAIinkdtkeiVWEYPLEK------------------------   33
ident                                |                            
Sbjct gfvkilkeivkldnIVSSTW--npldesILAYGEKNsvarlarivetywkltiiaelrhp   58
DSSP  llleeleeeeelllLLEEEE--llllllEEEEEELLleeeeeeeeelleeeeeeeeeell


DSSP  -----LLLLlEEEEL-LLLLEEEELL-LEEEEELLLLLEEEE-EELLllLEEEEEEELLL
Query -----GWECnSVAAT-KAGEILFSYS-KGAKXITRDGRELWN-IAAPagCEXQTARILPD   85
ident             |       |               |  |                   |
Sbjct falstNQVT-CLAWShDGNSIVTGVEnGELRLWNKTGALLNVlNFHR--APIVSVKWNKD  115
DSSP  lllllLLEE-EEEELlLLLEEEEEELlLLEEEEELLLLEEEEeLLLL--LLEEEEEELLL


DSSP  L-LEEEEEELllEEEEEELLLLLEeEEEEeLLLLllhhHLLLLLEELLLLLEEEEElLLL
Query G-NALVAWCGhpSTILEVNXKGEVlSKTEfETGIerphAQFRQINKNKKGNYLVPLfATS  144
ident |            |||     | |      |                       |     
Sbjct GtHIISMDVE-nVTILWNVISGTV-MQHF-ELKG----SLGVDVEWVDDDKFVIPG-PKG  167
DSSP  LlEEEEEELL-lLEEEEELLLLEE-EEEE-LLLL----LLLLLLEEEELLEEEEEL-HHH


DSSP  EEEEELL-LLLEEEEEE-LLLLLLEEEEL-LLLLEEEELLlLLEEEEELLLLLLEEEEEE
Query EVREIAP-NGQLLNSVK-LSGTPFSSAFL-DNGDCLVACGdAHCFVQLNLESNRIVRRVN  201
ident                     |      |   |   | |                      
Sbjct AIFVYQItEKTPTGKLIgHHGPISVLEFNdTNKLLLSASD-DGTLRIWHGGNGNSQNCFY  226
DSSP  LEEEEELlLLLLLEEELlLLLLEEEEEEElLLLEEEEEEL-LLLEEEELLLLLLLLEEEL


DSSP  H---------------------------------HHLLLlllleeeeeeellllleeeee
Query A---------------------------------NDIEGvqlffvaqlfplqngglyicn  228
ident                                                             
Sbjct GhsqsivsaswvgddkviscsmdgsvrlwslkqnTLLAL---------------------  265
DSSP  LlllleeeeeeellleeeeeellleeeeeellllEEEEE---------------------


DSSP  ellllllHHHLLLLLEEEEllllleEEEELLLL---------------------------
Query wqghdreAGKGKHPQLVEIdsegkvVWQLNDKV---------------------------  261
ident           |       |                                         
Sbjct ------sIVDGVPIFAGRIsqdgqkYAVAFMDGqvnvydlkklnsplpiplyasyqssqd  319
DSSP  ------eELLLLLEEEEEEllllleEEEEELLLleeeeelhhhhlleelleeeeelllll


DSSP  -LLLLL------------------leeeeell
Query -KFGXI------------------sticpire  274
ident                                 
Sbjct nDYIFDlswncagnkisvayslqegsvvaipg  351
DSSP  lLLEEEeeellllleeeeeellllleeeelll


No 121: Query=mol1A Sbjct=2j04A Z-score=11.3

back to top
DSSP  -----------------------llLEEEEElllLLEEEEEELL-----------LLEEE
Query -----------------------spQHLLVGgsgWNKIAIINKD-----------TKEIV   26
ident                            |         | |                    
Sbjct kllkdllvdrkefedwknnltwardGTLYLT--tFPDISIGQPKyakdincnsknLFHVK   58
DSSP  llllleeellllllllllleeelllLLEEEE--lLLLEEEEEELllllllllhhhLEEEE


DSSP  EEEELL-------------------LLLLLlEEEEL-LLLLEEEEL-LLEEEEELLlLLE
Query WEYPLE-------------------KGWECnSVAAT-KAGEILFSY-SKGAKXITRdGRE   65
ident                                                             
Sbjct EFPLEFenkldfelaqqngllnsqpVCYPR-VCKPSpIDDWMAVLSnNGNVSVFKD-NKM  116
DSSP  EELLLLlllllllllllllllllllLLLEE-EEEELlLLLLEEEEElLLLEEEEEL-LEE


DSSP  EEEEE--lLLLL-EEEEEEELL-LLLEEEEEELllEEEEEELL--------LLLEEEEEE
Query LWNIA--aPAGC-EXQTARILP-DGNALVAWCGhpSTILEVNX--------KGEVLSKTE  113
ident | |                  |      |                           |   
Sbjct LTNLDskgNLSSrTYHCFEWNPiESSIVVGNED--GELQFFSIrknsentpEFYFESSIR  174
DSSP  EEELLlllLLLLlLEEEEEELLlLLLEEEEELL--LEEEEEELllllllllLLEEEEEEE


DSSP  ElLLLLLHhHLLLLLEELLLlLEEEEELlLLEEEEELL-----LLLEEEEEE--lLLLLL
Query FeTGIERPhAQFRQINKNKKgNYLVPLFaTSEVREIAP-----NGQLLNSVK--lSGTPF  166
ident               |           |     |                           
Sbjct L-SDAGSK-DWVTHIVWYED-VLVAALS-NNSVFSMTVsasshQPVSRMIQNasrRKITD  230
DSSP  L-LLLLLL-LLEEEEEEELL-EEEEEEL-LLLEEEELLlllllLLLEEEEELlllLLLLL


DSSP  eEEELLlLLEEEELllLLEEEEELLLLLLEeEEEEHHhllllLLLEEEeEEELLLL---L
Query sSAFLDnGDCLVACgdAHCFVQLNLESNRIvRRVNANdiegvQLFFVAqLFPLQNG---G  223
ident      |       |          |    |             |       ||       
Sbjct -LKIVD-YKVVLTC--PGYVHKIDLKNYSI-SSLKTG-----SLENFH-IIPLNHEkesT  279
DSSP  -EEEEL-LEEEEEL--LLEEEEEELLLLEE-EEEELL-----LLLLLL-EEEELLLlllE


DSSP  EEE----------------------------------eeellllllhhHLLLLLEEeell
Query LYI----------------------------------cnwqghdreagKGKHPQLVeids  249
ident                                                             
Sbjct ILLmsnktsykvlledelhvtadniiapylekkfkkwstiwnefnnyeTTLVIHGIslsp  339
DSSP  EEEelllleeeeeellleeeelllllhhhhhhhhhhllllllllllllLEEEEEEEeell


DSSP  llleEEEELL--------------LLLL--------------------------------
Query egkvVWQLND--------------KVKF--------------------------------  263
ident          |                                                  
Sbjct dgysIAIVYDmervafkykiaseqSFNImfaplyhtwtiseravglawyqtyqiynqslp  399
DSSP  llleEEEEEEeellllllllllllLEEEeeeelllllllllllllhhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct klpenfsmnkkllngnypisldfqsylnalmkseemriimflnmtidkpsilsflealye  459
DSSP  lllllllllllhhhhlllllllhhhhhhhhhhlhhhhhhhhhlllllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct yainkkseltnsfdlacvlsiaailkreapiyngtllmknsfleetfnlesftadpetvt  519
DSSP  hhhhlhhhlllhhhhhhhhhhhhhlllllllllleeeeeelleeeeeelhhhllllleee


DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------gxi  266
ident                                                             
Sbjct sttnntwkrcgvtllpiltthvkicpvskqrvidikrddlndygwftrgllerfneisvy  579
DSSP  llllleeellllllllllllleeelllllleeelhhhlllllllhhhhhhhhhlllllll


DSSP  leeeeell
Query sticpire  274
ident         
Sbjct cgttlevm  587
DSSP  llllleel


No 122: Query=mol1A Sbjct=3b7fA Z-score=11.1

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellLLLEEEELLLEEEEEL
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkAGEILFSYSKGAKXIT   60
ident                                                 |    |||    
Sbjct --------------------------------------sapesgPVXLLVATIKGAWFLA   22
DSSP  --------------------------------------llllllLLEEEEEELLEEEEEE


DSSP  LL-----LLEEEEEELLllLEEEEEEELLL--LLEEEEEELLLEEEEEELLLLLEEEEEE
Query RD-----GRELWNIAAPagCEXQTARILPD--GNALVAWCGHPSTILEVNXKGEVLSKTE  113
ident  |                          |      | |      |       |       
Sbjct SDparrtWELRGPVFLG--HTIHHIVQDPRepERXLXAARTLGPTVFRSDDGGGNWTEAT   80
DSSP  ELlllllEEEEEEELLL--LEEEEEEELLLllLLEEEEEELLLEEEEEELLLLLLLEELL


DSSP  ELLLL----llhhHLLLLLEELL---LLLEEEEELLlLEEEEELL-lLLEEEEEEL----
Query FETGI----erphAQFRQINKNK---KGNYLVPLFAtSEVREIAP-nGQLLNSVKL----  161
ident                            |                                
Sbjct RPPAFnkapgrvvDHVFWLTPGHasePGTWYAGTSP-QGLFRSTDhgASWEPVAGFndhp  139
DSSP  LLLLLllllllllLEEEEEEELLlllLLLEEEEEEL-LEEEEELLllLLLEELHHHhlll


DSSP  -----------lLLLLEEEELLLL--LEEEELLLLlEEEEELLLlLLEEEEEEHhhllLL
Query -----------sGTPFSSAFLDNG--DCLVACGDAhCFVQLNLEsNRIVRRVNAndieGV  208
ident                 |                                   |     | 
Sbjct xrrawtggepdgPKXHSILVDPRDpkHLYIGXSSG-GVFESTDA-GTDWKPLNR----GC  193
DSSP  lhhhhhllllllLEEEEEEELLLLllLEEEEEELL-EEEEELLL-LLLLEELLL----LL


DSSP  LL-----------LEEEEEEEL--LLLLEEEEEELlllllhhhllllLEEEELL-LLLEE
Query QL-----------FFVAQLFPL--QNGGLYICNWQghdreagkgkhpQLVEIDS-EGKVV  254
ident                             ||  |                   |  ||   
Sbjct AAnflpdpnvefgHDPHCVVQHpaAPDILYQQNHC------------GIYRXDRrEGVWK  241
DSSP  LLlllllllllllLLEEEEEELllLLLEEEEEELL------------EEEEEELlLLEEE


DSSP  EEELLLLL--LLLLLEE-------------------------------------------
Query WQLNDKVK--FGXISTI-------------------------------------------  269
ident                 |                                           
Sbjct RIGDAXPRevGDIGFPIvvhqrdprtvwvfpxdgsdvwprvspggkpavyvtrdageswq  301
DSSP  LHHHHLLLllLLLEEEEeellllllleeeeellllllllllllllllleeeellllllle


DSSP  --------------------EEELL-----------------------------------
Query --------------------CPIRE-----------------------------------  274
ident                                                             
Sbjct rqdrglptdqawltvkrqaxTADAHapvgvyfgttggeiwasadegehwqciashlphiy  361
DSSP  eellllllllllllllllleEELLLlllleeeellllleeeellllllleeeelllllee


DSSP  -------
Query -------  274
ident        
Sbjct avqsarp  368
DSSP  eeeeell


No 123: Query=mol1A Sbjct=3hx6A Z-score=11.0

back to top
DSSP  -----LLLE---------------------------------------------------
Query -----SPQH---------------------------------------------------    4
ident                                                             
Sbjct spatvGKAQyltylaqpiepsgnystfaeaqktraprvyvgandgmlhgfdtdgnetfaf   60
DSSP  llleeLLLLllhhhhhhhlllllhhhhhhhhhlllleeeeellllleeelllllllleee


DSSP  -------------eeeeLLLLLE-eeeeelllleEEEEEELLLL----------------
Query -------------llvgGSGWNK-iaiinkdtkeIVWEYPLEKG----------------   34
ident                                                             
Sbjct ipsavfekmhqggahqfYVDGSPvvadaffggawHTVLIGSLRAggkglfaldvtdpani  120
DSSP  llhhhhhhllllhhhhhHHHLLLeeeeeeelleeEEEEEEELLLllleeeeeelllhhhl


DSSP  ---------------LLLLEEEELL----LLLEEEELLL-------EEEEELLL-LLEEE
Query ---------------WECNSVAATK----AGEILFSYSK-------GAKXITRD-GRELW   67
ident                                                   |    |    
Sbjct kllweigvdqepdlgYSFPKPTVARlhngKWAVVTGNGYssmndkaALLIIDMEtGAITR  180
DSSP  eeeeeeellllllllLLLLLLEEEEllllLEEEEEELLLlllllleEEEEEELLlLLEEE


DSSP  EEELL----LLLEEEEEEELLL------LLEEEEEELllEEEEEELLL------------
Query NIAAP----AGCEXQTARILPD------GNALVAWCGhpSTILEVNXK------------  105
ident                  |            |                             
Sbjct KLEVTgrtgVPNGLSSPRLADNnsdgvaDYAYAGDLQ--GNLWRFDLIagkvnqddpfsr  238
DSSP  EEEELllllLLLLEEEEEEELLllllllLEEEEEELL--LEEEEEELLllllllllllll


DSSP  ----------LLEEE---EEEELL--LLLLhhHLLLL-LEELLL-----LLEEEEEL---
Query ----------GEVLS---KTEFET--GIERphAQFRQ-INKNKK-----GNYLVPLF---  141
ident             |                                               
Sbjct andgpavassFRVSFggqPLYSAVdsAGAA--QAITAaPSLVRHptrkgYIVIFGTGkyf  296
DSSP  llllhhhhhhLEELHhhlLLEELLllLLLL--LLLLLlLEEEELlllllEEEEEELLlll


DSSP  ----------LLLEEEEELL------------LLLE------------------------
Query ----------ATSEVREIAP------------NGQL------------------------  155
ident                  |                                          
Sbjct enadaradtsRAQTLYGIWDqqtkgeaagstpRLTRgnlqqqtldlqadstfastartir  356
DSSP  lhhhhlllllLLLEEEEEEEllllllllllllLLLHhheeeeeeeeeeeeeelleeeeee


DSSP  -------------------eeEEELL-------LLLL-EEEELlLLLEEEELLL---LLE
Query -------------------lnSVKLS-------GTPF-SSAFLdNGDCLVACGD---AHC  185
ident                                                 |           
Sbjct iasqnpvnwlnndgstkqsgwYLDFMvngtlkgEMLIeDMIAI-GQVVLLQTITpnaSNW  415
DSSP  eellllllllllllllllleeEEEEEellllllLLLLlLLEEE-LLEEEEEEEElllEEE


DSSP  EEEELLLLLLEE----------------------------EEEEHhhllllLLLEEeeEE
Query FVQLNLESNRIV----------------------------RRVNAndiegvQLFFVaqLF  217
ident    |                                                      | 
Sbjct TYGLDPYTGGRTsftvfdlarqgvvdsksdysynkqnvavSGTEQ------KGLGG--LT  467
DSSP  EEEELLLLLLLLllllllllllllllhhhleelllleellLEEEE------LLLLL--LE


DSSP  ELL----LLLEEEeeellllllhhhlllllEEEELLllleeeeelllllllllleeeeel
Query PLQ----NGGLYIcnwqghdreagkgkhpqLVEIDSegkvvwqlndkvkfgxisticpir  273
ident        |                                                    
Sbjct LSTneqgNPEVCS----------------sGECLTV---------------------npg  490
DSSP  EEEelllEEEEEL----------------lLLEEEL---------------------lll


DSSP  l
Query e  274
ident  
Sbjct p  491
DSSP  l


No 124: Query=mol1A Sbjct=3d12A Z-score=11.0

back to top
DSSP  -llleeeeellllleeeeeelLLLEEEEE--EELL-----LLLLLlEEEELLlLLEEEEL
Query -spqhllvggsgwnkiaiinkDTKEIVWE--YPLE-----KGWECnSVAATKaGEILFSY   52
ident                        |        |               |    |    | 
Sbjct egvsnlvglpnniclqktsnqILKPKLISytLPVVgqsgtCITDP-LLAMDE-GYFAYSH   58
DSSP  lleeellllllllllllllllLLLLEELHhhLLLLlllleEEEEE-EEEEEL-LEEEEEE


DSSP  L-------------LEEEEEL--------lLLLEEEEEEL--LLLLEeEEEEELlLLLEE
Query S-------------KGAKXIT--------rDGRELWNIAA--PAGCExQTARILpDGNAL   89
ident                                           |       |         
Sbjct LerigscsrgvskqRIIGVGEvldrgdevpSLFMTNVWTPpnPNTVYhCSAVYN-NEFYY  117
DSSP  EeeelllllleeeeEEEEEEEeeellllleEEEEEEEELLllLLLEEeEEEEEL-LLEEE


DSSP  EEEELL--------------LEEEEEELLLL-------LEEEEEE--ellllllhhHLLL
Query VAWCGH--------------PSTILEVNXKG-------EVLSKTE--fetgierphAQFR  126
ident |                            |                              
Sbjct VLCAVStvgdpilnstywsgSLMMTRLAVKPksngggyNQHQLALrsiekgrydkvMPYG  177
DSSP  EEEEELllllllllhhhlllLEEEEEEELLLllllhhhHEELLLLlleellllleeEELL


DSSP  LLEELLLLLEEEEELLL-----------------------------------------LE
Query QINKNKKGNYLVPLFAT-----------------------------------------SE  145
ident             |                                             | 
Sbjct PSGIKQGDTLYFPAVGFlvrtefkyndsncpitkcqyskpencrlsmgirpnshyilrSG  237
DSSP  LLLEEELLEEEEEEEEEeehhhllllhhhllllllllllllhhhhllllllllleeeeEE


DSSP  EEEELL----LLLEEEEEE-----lLLLLLEEEELLlLLEEEELLLL-----LEEEEELL
Query VREIAP----NGQLLNSVK-----lSGTPFSSAFLDnGDCLVACGDA-----HCFVQLNL  191
ident           |               | |        |                |     
Sbjct LLKYNLsdgeNPKVVFIEIsdqrlsIGSPSKIYDSL-GQPVFYQASFswdtmIKFGDVLT  296
DSSP  EEEEELllllLLLEEEEELllllllLLLLEEEEEEL-LEEEEEELLLlllllLEEEEEEE


DSSP  -lLLLEeEEEEHHhlllLLLL-------------------EEEEEEELL--LLLEEEEEE
Query -eSNRIvRRVNANdiegVQLF-------------------FVAQLFPLQ--NGGLYICNW  229
ident           |      |                           |     |        
Sbjct vnPLVV-NWRNNT----VISRpgqsqcprfntcpeicwegVYNDAFLIDriNWISAGVFL  351
DSSP  llLLEE-EELLLL----LLLLlllllllllllllllllllLLLLEEEEEllLLEEEEEEE


DSSP  LllLLLHHhllLLLEEEELLlLLEEEEELLLL--llLLLLEEEEELL-------------
Query QghDREAGkgkHPQLVEIDSeGKVVWQLNDKV--kfGXISTICPIRE-------------  274
ident       |     |                                               
Sbjct D-sNQTAE---NPVFTVFKD-NEILYRAQLASedtnAQKTITNCFLLknkiwcislveiy  406
DSSP  L-lLLLLL---LEEEEEEEL-LEEEEEEELLLllleEEEEEEEEEEEllleeeeeeeeee


DSSP  ----------------------
Query ----------------------  274
ident                       
Sbjct dtgdnvirpklfavkipeqcta  428
DSSP  llllllllleeeeeelllllll


No 125: Query=mol1A Sbjct=2zb6A Z-score=10.9

back to top
DSSP  llleeeeellllleeeeeelLLLEEEEE-----EELL----LLLLLlEEEELLlLLEEEE
Query spqhllvggsgwnkiaiinkDTKEIVWE-----YPLE----KGWECnSVAATKaGEILFS   51
ident                                                       |     
Sbjct vaaeelmnalskgncsgpttIRGQFSNMslsllDLYLgrgyNVSSI-VTMTSQ-GMYGGT   58
DSSP  llhhhhhllllllllllleeEEEEELLLlllhhHHHHhlllEEEEE-EEEEEL-LEEEEE


DSSP  LL------------lEEEEELL--------LLLEEEEEE---llLLLEEeEEEELlLLLE
Query YS------------kGAKXITR--------DGRELWNIA---apAGCEXqTARILpDGNA   88
ident |                                                           
Sbjct YLvekpnlsqlsmyrVFEVGVIrnpglgapVFHMTNYLEqpvsnDLSNC-MVALG-ELKL  116
DSSP  EEeeelllllleeeeEEEEEEEelllllllEEEEEEEEEeelllLLLEE-EEEEE-LLEE


DSSP  EEEEEL--------------LLEEEEEELLLLL--EEEEEEEL---lllllhhHLLLL-L
Query LVAWCG--------------HPSTILEVNXKGE--VLSKTEFE---tgierphAQFRQ-I  128
ident      |                                                      
Sbjct AALCHGedsitipyqgsgkgVSFQLVKLGVWKSptDMQSWVPLstddpvidrlYLSSHrG  176
DSSP  EEEEELlleeelllllllllLEEEEEEEELLLLllLEEEEEELlllllleeeeELLLLeE


DSSP  EELlLLLEEEEELLL--------------------------------------lEEEEEL
Query NKNkKGNYLVPLFAT--------------------------------------sEVREIA  150
ident               |                                             
Sbjct VIA-DNQAKWAVPTTrtddklrmetcfqqackgkiqalcenpewaplkdnripsYGVLSV  235
DSSP  EEE-LLEEEEEEEEEellhhhhhhhhhhhhlllllhhhhhllllhhhhllllleEEEEEE


DSSP  L------LLLEEEEEE---LLLL-LLEEEELLL-LLEEEELLLL-----LEEEEELLL-L
Query P------NGQLLNSVK---LSGT-PFSSAFLDN-GDCLVACGDA-----HCFVQLNLE-S  193
ident              |                                        |     
Sbjct DlsltveLKIKIASGFgplITHGsGMDLYKSNHnNVYWLTIPPMknlalGVINTLEWIpR  295
DSSP  EllllllLLLEEEEELlllLLLLlLLEEEELLLlLEEEEEELLLlllllLEEEEEELLlL


DSSP  LLEEEEEEHH-----------------hllllllLEEEEEEELLLLLEEEEEELlllllH
Query NRIVRRVNAN-----------------diegvqlFFVAQLFPLQNGGLYICNWQghdreA  236
ident                                                 |           
Sbjct FKVSPYLFTVpikeaggdchaptylpaevdgdvkLSSNLVILPGQDLQYVLATY-----D  350
DSSP  LEEEEEELEEelllllllleeellllllllllleEELLLEELLLLLLLEEEEEE-----E


DSSP  HHL--LLLLEEEELlLLLEeEEELLLLL------llLLLEEEEELL--------------
Query GKG--KHPQLVEIDsEGKVvWQLNDKVK------fgXISTICPIRE--------------  274
ident                                          |                  
Sbjct TSRveHAVVYYVYS-PSRS-FSYFYPFRlpikgvpiELQVECFTWDqklwcrhfcvlads  408
DSSP  LLLllLLEEEEEEL-LLLE-EEEELLLLllllllllEEEEEEEELLlleeeeeeeellll


DSSP  -------------------
Query -------------------  274
ident                    
Sbjct esgghithsgmvgmgvsct  427
DSSP  lllllleeeeeeeeeeeel


No 126: Query=mol1A Sbjct=1kv9A Z-score=10.8

back to top
DSSP  ---------------------llleeeeellllleeeeeelLLLEEEEEEEL-LLLLLLL
Query ---------------------spqhllvggsgwnkiaiinkDTKEIVWEYPL-EKGWECN   38
ident                                                |   |        
Sbjct agvdeaairateqaggewlshgrtyaeqrfsplkqidasnvRSLGLAWYMDLdNTRGLEA   60
DSSP  llllhhhhhhllllllllllllllllllleelllllllllhHHEEEEEEEELlLLLLLLL


DSSP  EEEELlLLLEEEELLL-EEEEELL-LLLEEEEEELLLL----------lEEEEEEELlLL
Query SVAATkAGEILFSYSK-GAKXITR-DGRELWNIAAPAG----------cEXQTARILpDG   86
ident        | |  | |           | |||                             
Sbjct TPLFH-DGVIYTSMSWsRVIAVDAaSGKELWRYDPEVAkvkartsccdaVNRGVALW-GD  118
DSSP  LLEEE-LLEEEEEEHHhEEEEEELlLLLEEEEELLLLLhhhhhhlllllLLLLLEEE-LL


DSSP  LEEEEEELllEEEEEEL-LLLLEEEEEEELL-LLLLhhHLLLLLEELLlLLEEEEELL--
Query NALVAWCGhpSTILEVN-XKGEVLSKTEFET-GIERphAQFRQINKNKkGNYLVPLFA--  142
ident    |                |                          | |          
Sbjct KVYVGTLD--GRLIALDaKTGKAIWSQQTTDpAKPY--SITGAPRVVK-GKVIIGNGGae  173
DSSP  EEEEELLL--LEEEEEElLLLLEEEEEELLLlLLLL--LLLLLLEEEL-LEEEELLLLll


DSSP  ---LLEEEEELL-LLLEEEEEEL-------------------------------LLLL-L
Query ---TSEVREIAP-NGQLLNSVKL-------------------------------SGTP-F  166
ident       |       | |                                      ||   
Sbjct ygvRGFVSAYDAdTGKLAWRFYTvpgdpalpyehpelreaaktwqgdqywklggGGTVwD  233
DSSP  lllLLEEEEEELlLLLEEEEEELlllllllllllhhhhhhhlllllllhhhhleELLLlL


DSSP  EEEELL-LLLEEEELLL------------------LLEEEEELLLLLLEEEEEE------
Query SSAFLD-NGDCLVACGD------------------AHCFVQLNLESNRIVRRVN------  201
ident | |         |  |                                            
Sbjct SMAYDPeLDLLYVGTGNgspwnrevrspgggdnlyLSSILAIRPDTGKLAWHYQvtpgds  293
DSSP  LEEEELlLLEEEEELLLeelllhhhhlllllllllLLEEEEELLLLLLEEEEEEllllll


DSSP  --------------------------------HHHL----------------------ll
Query --------------------------------ANDI----------------------eg  207
ident                                                             
Sbjct wdftatqqitlaelnidgkprkvlmqapkngfFYVLdrtngklisaekfgkvtwaekvdl  353
DSSP  lllllllleeeeeeeelleeeeeeeellllleEEEEellllleeeeeelllllleeeell


DSSP  lllleeeeeeellllleeeeeelLLLL---------------------------------
Query vqlffvaqlfplqngglyicnwqGHDR---------------------------------  234
ident                                                             
Sbjct atgrpveapgvryekepivmwpsPFGAhnwhsmsfnpgtglvyipyqevpgvyrnegkdf  413
DSSP  lllleeelllllllllleeelllLLLLlllllleeelllleeeeeeeelleeelllhhhl


DSSP  ---------------------lhHHLLL---------------------lLEEEelllll
Query ---------------------eaGKGKH---------------------pQLVEidsegk  252
ident                                                    |        
Sbjct vtrkafntaagfadatdvpaavvSGALLawdpvkqkaawkvpypthwnggTLST-----a  468
DSSP  lllllllllllhhhlllllhhhlEEEEEeeelllleeeeeeeelllllllEEEE-----l


DSSP  eEEEE--llLLLL------------------lLLLEEEEELL------------------
Query vVWQL--ndKVKF------------------gXISTICPIRE------------------  274
ident                                                             
Sbjct gNLVFqgtaAGQMhaysadkgealwqfeaqsgIVAAPMTFELagrqyvaimagwggvatl  528
DSSP  lLEEEeellLLEEeeeellllleeeeeellllLLLLLEEEEElleeeeeeeellllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct tggesmnlpgmknrsrllvfaldgkaqlpppapapakvervpqpvtaapeqvqagkqlyg  588
DSSP  hllhhhhlllllllleeeeeeellllllllllllllllllllllllllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct qfcsvchgmgtisgglipdlrqssdatrehfqqivlqgalkplgmpsfddslkpeeveqi  648
DSSP  hhlhhhhlhhhllllllllhhhllhhhhhlhhhhhhhlllhhhllllllllllhhhhhhh


DSSP  ----------------
Query ----------------  274
ident                 
Sbjct klyvmsreyedymarh  664
DSSP  hhhhhhhhhhhhhhll


No 127: Query=mol1A Sbjct=1yfqA Z-score=10.8

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llLLEEEE-EELLllLEEEEEEELL-LLLEEEEEELllEEEEEELL-----LLLEEEEEE
Query rdGRELWN-IAAPagCEXQTARILP-DGNALVAWCGhpSTILEVNX-----KGEVLSKTE  113
ident           |           | |     |                        |    
Sbjct --MQIVQIeQAPK--DYISDIKIIPsKSLLLITSWD--GSLTVYKFdiqakNVDLLQSLR   54
DSSP  --LEEEELlLLLL--LLEEEEEEEHhHLEEEEEELL--LEEEEEEEellllEEEEEEEEE


DSSP  ELLllllhhhLLLLLEELL--LLLEEEEELLlLEEEEELLL-lLEEEEEE---LLLLLLE
Query FETgierphaQFRQINKNK--KGNYLVPLFAtSEVREIAPN-gQLLNSVK---LSGTPFS  167
ident                |          |      |                          
Sbjct YKH-------PLLCCNFIDntDLQIYVGTVQ-GEILKVDLIgsPSFQALTnneANLGICR  106
DSSP  LLL-------LEEEEEEEEllLEEEEEEELL-LLEEEELLLllLLEEELLlllLLLLEEE


DSSP  EEELLLLLEEEELLLlLEEEEELLL--LLLEEEEEEHHhllllllLEEEEEEELLlLLEE
Query SAFLDNGDCLVACGDaHCFVQLNLE--SNRIVRRVNANdiegvqlFFVAQLFPLQnGGLY  225
ident            |  |                    | |                    | 
Sbjct ICKYGDDKLIAASWD-GLIEVIDPRnyGDGVIAVKNLNsnntkvkNKIFTMDTNS-SRLI  164
DSSP  EEEELLLEEEEEELL-LEEEEELHHhhLLLLEEEEELLlllllllLLEEEEEELL-LEEE


DSSP  EEEEllllllhhhllLLLEEEELL-----LLLEeEEELLLllLLLLLEEE----------
Query ICNWqghdreagkgkHPQLVEIDS-----EGKVvWQLNDKvkFGXISTIC----------  270
ident                  |                           |              
Sbjct VGMN-----------NSQVQWFRLplcedDNGT-IEESGL--KYQIRDVAllpkeqegya  210
DSSP  EEEL-----------LLEEEEEELlllllLLLE-EEELLL--LLLEEEEEellhhhleee


DSSP  -----------------------------------------------EELL---------
Query -----------------------------------------------PIRE---------  274
ident                                                             
Sbjct cssidgrvaveffddqgddynsskrfafrchrlnlkdtnlaypvnsiEFSPrhkflytag  270
DSSP  eeellleeeeeellllllllllllleeeelllllllllllllleeeeEELLlllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct sdgiiscwnlqtrkkiknfakfnedsvvkiacsdnilclatsddtfktnaaidqtielna  330
DSSP  lllleeeeelllleeeeellllllleeeeeeellleeeeeeellhhhhllllllllllll


DSSP  ------------
Query ------------  274
ident             
Sbjct ssiyiifdyenp  342
DSSP  leeeeeelllll


No 128: Query=mol1A Sbjct=2vskA Z-score=10.7

back to top
DSSP  llleeeeellllleeeeeelLLLEEEEEeelLLLLLLlEEEELLlLLEEEELL-------
Query spqhllvggsgwnkiaiinkDTKEIVWEyplEKGWECnSVAATKaGEILFSYS-------   53
ident                       |                 |    |    |         
Sbjct -----------iclqkttstILKPRLIS-egVCITDP-LLAVDN-GFFAYSHLekigsct   46
DSSP  -----------lllllllllLLLLEELL-llEEEEEE-EEEEEL-LEEEEEEEeeellll


DSSP  ------LEEEEELLL--------LLEEEEEEL--LLLLEEEEeeeLLLLLEEEEEELL--
Query ------KGAKXITRD--------GRELWNIAA--PAGCEXQTariLPDGNALVAWCGH--   95
ident                                   |                         
Sbjct rgiakqRIIGVGEVLdrgdkvpsMFMTNVWTPpnPSTIHHCS-stYHEDFYYTLCAVShv  105
DSSP  lleeeeEEEEEEEEEellllleeEEEEEEELLllLLLEEEEE-eeEELLEEEEEEEELll


DSSP  ------------LEEEEEELLL--lLEEEEEE--ellllllhhhLLLLLEELLLLLEEEE
Query ------------PSTILEVNXK--gEVLSKTE--fetgierphaQFRQINKNKKGNYLVP  139
ident                                                            |
Sbjct gdpilnstswteSLSLIRLAVRpdyNQKYIAItkvergkydkvmPYGPSGIKQGDTLYFP  165
DSSP  llhhhlhhhlllLEEEEEEELLlllLEEEELLlleellllleeeELLLLLEEELLEEEEE


DSSP  EL-----------------------------------------LLLEEEEELL-LLLEEE
Query LF-----------------------------------------ATSEVREIAP-NGQLLN  157
ident                                              |           |  
Sbjct AVgflprtefqyndsncpiihckyskaencrlsmgvnskshyiLRSGLLKYNLsLIILQF  225
DSSP  EEeeeehhhllllhhhlllllllllllhhhhhllllllllleeEEEEEEEEELlLLLEEE


DSSP  EEE-----lLLLLLEEEELLLlLEEEELLLL-----LEEEEELL-lLLLEeEEEEHHhll
Query SVK-----lSGTPFSSAFLDNgDCLVACGDA-----HCFVQLNL-eSNRIvRRVNANdie  206
ident           | |                                   |     |     
Sbjct IEIadnrltIGSPSKIYNSLG-QPVFYQASYswdtmIKLGDVDTvdPLRV-QWRNNS---  280
DSSP  EELllllllLLLLEEEEEELL-EEEEEELLLlllllLEEEEEEEllLLEE-EELLLL---


DSSP  lLLLL-------------------EEEEEEELL--LLLEEEEEELllLLLHHhllLLLEE
Query gVQLF-------------------FVAQLFPLQ--NGGLYICNWQghDREAGkgkHPQLV  245
ident  |                           |     |              |     |   
Sbjct -VISRpgqsqcprfnvcpevcwegTYNDAFLIDrlNWVSAGVYLN-sNQTAE---NPVFA  335
DSSP  -LLLLlllllllllllllllllllLLLLLEEEEllLLEEEEEEEL-lLLLLL---LEEEE


DSSP  EELlLLLEEEEELLLL--LLLLLLEEEEE-------------------------------
Query EIDsEGKVVWQLNDKV--KFGXISTICPI-------------------------------  272
ident           |                                                 
Sbjct VFK-DNEILYQVPLAEddTNAQKTITDCFllenviwcislveiydtgdsvirpklfavki  394
DSSP  EEE-LLEEEEEEELLLllLEELLLLEEEEeelleeeeeellleellllllllllleelll


DSSP  ----ll
Query ----re  274
ident       
Sbjct paqcse  400
DSSP  llllll


No 129: Query=mol1A Sbjct=1pguB Z-score=10.7

back to top
DSSP  llleeeeellllleeeeeelLLLEEEEEEELLL---------------------------
Query spqhllvggsgwnkiaiinkDTKEIVWEYPLEK---------------------------   33
ident                              |                              
Sbjct --------------------SSISLKEIIPPQPstqrnftthlsydpttnaiaypcgksa   40
DSSP  --------------------LEEEEEEEELLLLlllllllllleeelllleeeeeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   33
ident                                                             
Sbjct fvrclddgdskvppvvqftghgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkes  100
DSSP  eeeelllllllllleeeellllllleeeeeellllllleeeeeellleeeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   33
ident                                                             
Sbjct nsvevnvksefqvlagpisdiswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsq  160
DSSP  lleeeeeeeeeellllleeeeeellllleeeeeelllllleeeeellllleeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   33
ident                                                             
Sbjct rinachlkqsrpxrsxtvgddgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgef  220
DSSP  leeeeeellllleeeeeeellleeeeeeellleeeeeellllllllleeeeeelllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   33
ident                                                             
Sbjct vitvgsdrkiscfdgksgeflkyieddqepvqggifalswldsqkfatvgadatirvwdv  280
DSSP  eeeeelllleeeeellllleeeellllllllllleeeeeelllleeeeeellleeeeeel


DSSP  ---------------------------------------------------------LLL
Query ---------------------------------------------------------GWE   36
ident                                                             
Sbjct ttskcvqkwtldkqqlgnqqvgvvatgngriislsldgtlnfyelghdevlktisghNKG  340
DSSP  llleeeeeeelllllhhhleeeeeelllleeeeeelllleeeeellllllleeelllLLL


DSSP  LLEEEELlllLEEEELLL-EEEEELlllLEEEEEELLllLEEEEEEELLLLLEEEEEELl
Query CNSVAATkagEILFSYSK-GAKXITrdgRELWNIAAPagCEXQTARILPDGNALVAWCGh   95
ident                                                             
Sbjct ITALTVN---PLISGSYDgRIXEWS---SSSXHQDHS--NLIVSLDNSKAQEYSSISWD-  391
DSSP  EEEEELL---LLEEEELLlLEEELL---LLEEELLLL--LLEEEEELLLLLLLEEEELL-


DSSP  lEEEEEElllllEEEEEEELLllllhhHLLLlLEELLLLLEEEEElllleeEEELL----
Query pSTILEVnxkgeVLSKTEFETgierphAQFRqINKNKKGNYLVPLfatsevREIAP----  151
ident   |            | ||                |  |   |          |      
Sbjct -DTLKVN-----GITKHEFGS------QPKV-ASANNDGFTAVLT--ndddLLILQsftg  436
DSSP  -LEEEEL-----LEEEEELLL------LEEE-EEELLLLEEEEEE--llleEEEEEllll


DSSP  LLLEEE----------------eEELL-------------------------LLLLeEEE
Query NGQLLN----------------sVKLS-------------------------GTPFsSAF  170
ident                        | |                                  
Sbjct DIIKSVrlnspgsavslsqnyvaVGLEegntiqvfklsdlevsfdlktplraKPSY-ISI  495
DSSP  LEEEEEelllleeeeeellleeeEEELllleeeeeelleeeeeeelllllllLEEE-EEE


DSSP  LLLL-LEEEELlLLLEEEEELLLLlLEEEeeehHHLLlLLLLEEEEEEELL-----LLLE
Query LDNG-DCLVACgDAHCFVQLNLESnRIVRrvnaNDIEgVQLFFVAQLFPLQ-----NGGL  224
ident                      | | | |                                
Sbjct SPSEtYIAAGD-VXGKILLYDLQS-REVK---tSRWA-FRTSKINAISWKPaeeieEDLV  549
DSSP  LLLLlEEEEEE-LLLLEEEEELLL-LEEE---eLLLL-LLLLLEEEEEELLlllllLLEE


DSSP  EEEEELlllllhhhllllLEEEELL-LLLEEEEELLlllLLLLLEEEEEL----------
Query YICNWQghdreagkgkhpQLVEIDS-EGKVVWQLNDkvkFGXISTICPIR----------  273
ident                                                             
Sbjct ATGSLD-----------tNIFIYSVkRPXKIIKALN-ahKDGVNNLLWETpstlvssgad  597
DSSP  EEEELL-----------lLEEEEELlLLLLLEEELL-llLLLEEEEEEEElleeeeeell


DSSP  ----------l
Query ----------e  274
ident            
Sbjct acikrwnvvle  608
DSSP  lleeeeeeell


No 130: Query=mol1A Sbjct=2h47F Z-score=10.6

back to top
DSSP  --------------lLLEEEEE-----llllLEEEEEELLLLEEEEEEELLlllllleEE
Query --------------sPQHLLVG-----gsgwNKIAIINKDTKEIVWEYPLEkgwecnsVA   41
ident                     |                           |         | 
Sbjct prevltgghsvsapqENRIYVMdsvfmhlteSRVHVYDYTNGKFLGMVPTA---fnghVQ   57
DSSP  llllllllllllllhHHEEEEEellhhhhhhLEEEEEELLLLEEEEEEELL---eeeeEE


DSSP  ELLL-LLEE-----------eellleeeEELL--LLLEE------eEEELlllleeEEEE
Query ATKA-GEIL-----------fsyskgakXITR--DGREL------wNIAApagcexQTAR   81
ident        |                             |                      
Sbjct VSNDgKKIYtmttyheritrgkrsdvveVWDAdkLTFEKeislppkRVQG-----lNYDG  112
DSSP  ELLLlLEEEeeeeeellllllleeeeeeEEELllLEEEEeeeelllLLLL-----lLLHH


DSSP  --ELLL---LLEE---------------------eeeellLEEEEeellllleEEEEEEL
Query --ILPD---GNAL---------------------vawcghPSTILevnxkgevLSKTEFE  115
ident             |                                           |   
Sbjct lfRQTTdgkFIVLqnaspatsigivdvakgdyvedvtaaaGCWSVipqpnrprSFMTICG  172
DSSP  heEELLlllEEEEeellllleeeeeelllleeeeeehhhlLEEEEeellllllEEEEEEL


DSSP  ------------------------LLLLLhhHLLLLLEELLlLLEEEEELlLLEEEEELL
Query ------------------------TGIERphAQFRQINKNKkGNYLVPLFaTSEVREIAP  151
ident                                  |      |             |     
Sbjct dgglltinlgedgkvasqsrskqmFSVKD-dPIFIAPALDK-DKAHFVSY-YGNVYSADF  229
DSSP  llleeeeeellllleeeeeellllLLLLL-lLLLLLLEELL-LEEEEELL-LLEEEEEEL


DSSP  ---lLLEEEEEEL---------LLLLL--EEEEL-LLLLEEEEL---------LLLL-EE
Query ---nGQLLNSVKL---------SGTPF--SSAFL-DNGDCLVAC---------GDAH-CF  186
ident             |                        |   |                  
Sbjct sgdeVKVDGPWSLlndedkaknWVPGGynLVGLHrASGRMYVFMhpdgkegthKFPAaEI  289
DSSP  llllLEEEEEEELllhhhhhhlLEELLllLEEEElLLLEEEEEEellllllllLLLLlEE


DSSP  EEELLLLLLEEEEEEhhhlllllLLEEEEEEEL-LLLLEEEEEEllllllhhhllllLEE
Query VQLNLESNRIVRRVNandiegvqLFFVAQLFPL-QNGGLYICNWqghdreagkgkhpQLV  245
ident           | |                     |                         
Sbjct WVMDTKTKQRVARIP--------GRDALSMTIDqQRNLMLTLDG------------gNVN  329
DSSP  EEEELLLLEEEEEEE--------LLLLLEEEEElLLLEEEEELL------------lLEE


DSSP  EELL---lLLEEEEELLlllLLLLLEEEEEL---l
Query EIDS---eGKVVWQLNDkvkFGXISTICPIR---e  274
ident   |      |                         
Sbjct VYDIsqpePKLLRTIEG--aAEASLQVQFHPvggv  362
DSSP  EEELllllLEEEEEELL--lLLLEEEEEELLllll


No 131: Query=mol1A Sbjct=3hxjA Z-score=10.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kweflignsidsspilakngtiylgssnknlyaintdgsvkwffksgeiiecrpsigkdg   60
DSSP  llllllleeelllleellllleelllllllleeellllleeelllhhheeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tiyfgsdkvyainpdgtekwrfdtsdftifedilyvtsxdghlyaintdgtekwrfktkk  120
DSSP  eellllleeeeelllhhhhhhllllleeeelleeeeelllleeeeellllleeeeeelll


DSSP  ---------lLLEEeeellllLEEEEEELLlLEEEEEEELLlLLLLLEEEELLLLLEEEE
Query ---------sPQHLlvggsgwNKIAIINKDtKEIVWEYPLEkGWECNSVAATKAGEILFS   51
ident                      |    || |     |                | | | | 
Sbjct aiyatpivseDGTI-yvgsndNYLYAINPD-GTEKWRFKTN-DAITSAASIGKDGTIYFG  177
DSSP  lllllleellLLLE-eeelllLEEEEELLL-LLEEEEEELL-LLLLLLLEELLLLLEEEE


DSSP  LlLEEEEELLLLLEEEEEELLllLEEEE-EEELLLLLEEEEEELllEEEEEELLLLLEEE
Query YsKGAKXITRDGRELWNIAAPagCEXQT-ARILPDGNALVAWCGhpSTILEVNXKGEVLS  110
ident        |  || | ||  |       |   |  ||   |            |  |    
Sbjct S-DKVYAINPDGTEKWNFYAG--YWTVTrPAISEDGTIYVTSLD--GHLYAINPDGTEKW  232
DSSP  L-LLEEEELLLLLEEEEELLL--LLLLLlLEELLLLLEEEEELL--LEEEEELLLLLEEE


DSSP  EEEELLllllhhhLLLLLEELLLLLEEEEELlLLEEEEELlllLEEEEEEL-LLLLLEEE
Query KTEFETgierphaQFRQINKNKKGNYLVPLFaTSEVREIApngQLLNSVKL-SGTPFSSA  169
ident                                       |             |       
Sbjct RFKTGK------rIESSPVIGNTDTIYFGSY-DGHLYAINpdgTEKWNFETgSWIIATPV  285
DSSP  EEELLL------lLLLLLEELLLLLEEEELL-LLEEEEELlllLEEEEEELlLLLLLLLE


DSSP  ELLLLLEEEELlLLLEEEEELLlllleeeeeehhhllllllleeeeeeellllleeeeee
Query FLDNGDCLVACgDAHCFVQLNLesnrivrrvnandiegvqlffvaqlfplqngglyicnw  229
ident    ||           |  |                                        
Sbjct IDENGTIYFGT-RNGKFYALFN--------------------------------------  306
DSSP  ELLLLLEEEEL-LLLLEEEEEL--------------------------------------


DSSP  llllllhhhllllleeeellllleeeeelllllllllleeeeell
Query qghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                              
Sbjct ---------------------------------------------  306
DSSP  ---------------------------------------------


No 132: Query=mol1A Sbjct=3fsnB Z-score=10.4

back to top
DSSP  ------------------------------------LLLEEEEE-------------lLL
Query ------------------------------------SPQHLLVG-------------gSG   11
ident                                         |  |                
Sbjct sqvehpaggykklfetveelsspltahvtgriplwlTGSLLRCGpglfevgsepfyhlFD   60
DSSP  llllllllhhhhhhllllllllleeleeeellllllLEEEEEEEeeeleelleellllLL


DSSP  LLEEEEEELL----LLEEEEEEELLL-----------------------llllleEEEL-
Query WNKIAIINKD----TKEIVWEYPLEK-----------------------gwecnsVAAT-   43
ident                                                             
Sbjct GQALLHKFDFkeghVTYHRRFIRTDAyvramtekrivitefgtcafpevtdnalvNIYPv  120
DSSP  LEEEEEEEEEelleEEEEEEELLLHHhhhhhhhllllllllllllllllllllllEEEEe


DSSP  lLLLEEEeLLLEEEEELL----LLLEEEEEE-llllLEEE-EEEELLLLLEEEEEEL---
Query kAGEILFsYSKGAKXITR----DGRELWNIA-apagCEXQ-TARILPDGNALVAWCG---   94
ident                                             |  ||           
Sbjct gEDYYAC-TETNFITKVNpetlETIKQVDLCnyvsvNGATaHPHIENDGTVYNIGNCfgk  179
DSSP  lLEEEEE-LLLLEEEEELllllLEEEEEEHHhllllLLLLlLLEELLLLLEEEEEEElll


DSSP  ---LLEEEEEEL--------LLLLEEEEEEELLLL-LLHHhLLLLLEELLlLLEEEEELL
Query ---HPSTILEVN--------XKGEVLSKTEFETGI-ERPHaQFRQINKNKkGNYLVPLFA  142
ident        |                      |       |                     
Sbjct nfsIAYNIVKIPplqadkedPISKSEIVVQFPCSDrFKPS-YVHSFGLTP-NYIVFVETP  237
DSSP  lllLEEEEEEELllllllllHHHHLEEEEEEELLLlLLLL-LLLLLEELL-LEEEEEELL


DSSP  L-----------------------------LEEEEEL---LLLLEEEEEELLLLLLEEEE
Query T-----------------------------SEVREIA---PNGQLLNSVKLSGTPFSSAF  170
ident                                                        |    
Sbjct VkinlfkflsswslwganymdcfesnetmgVWLHIADkkrKKYINNKYRTSPFNLFHHIN  297
DSSP  EeelhhhhhhhllllllllhhheeelllllEEEEEEElllLEEEEEEEEELLEEEEEEEE


DSSP  L----llLLEEEELLL-----------------------------lLEEEEELLL-----
Query L----dnGDCLVACGD-----------------------------aHCFVQLNLE-----  192
ident              |                                       |      
Sbjct TyedhefLIVDLCCWKgfefvynylylanlrenweevkknarkapqPEVRRYVLPlnidk  357
DSSP  EeeelleEEEEEEEEEllllhhhhllhhhhlllhhhhhhhllllleEEEEEEEEEllllh


DSSP  -------------------------lllEEEEEEHHhllllLLLEeEEEEEL-------l
Query -------------------------snrIVRRVNANdiegvQLFFvAQLFPL-------q  220
ident                                             |               
Sbjct adtgknlvtlpnttatailcsdetiwlePEVLFSGP-----RQAF-EFPQINyqkyggkp  411
DSSP  hhllllllllllllleeeelllleeeeeLEEEELLL-----LEEE-EEEELLhhhhllll


DSSP  lLLEEEEEellllllhhhlLLLLeEEELL----LLLEE----------------------
Query nGGLYICNwqghdreagkgKHPQlVEIDS----EGKVV----------------------  254
ident     |                |           |  |                       
Sbjct yTYAYGLG--------lnhFVPDrLCKLNvktkETWVWqepdsypsepifvshpdaleed  463
DSSP  lLEEEEEE--------eelLEEEeEEEEEllllLEEEEllllleellleeeellllllll


DSSP  ----eeeLLLL----------------------------LLLLLleEEEEL-l
Query ----wqlNDKV----------------------------KFGXIstICPIR-e  274
ident                                                      
Sbjct dgvvlsvVVSPgagqkpayllilnakdlsevaraeveinIPVTF--HGLFKks  514
DSSP  leeeeeeEELLlllllleeeeeeellllleeeeeeelllLLLLL--EEEEEel


No 133: Query=mol1A Sbjct=3c75H Z-score=10.4

back to top
DSSP  -------------------------------llLEEEEELLLL----LEEEEEELLLLEE
Query -------------------------------spQHLLVGGSGW----NKIAIINKDTKEI   25
ident                                                     |   |  |
Sbjct qtegqrgaaeaaaalaageadepvileapapdaRRVYIQDPAHfaaiTQQFVIDGSTGRI   60
DSSP  llhhhhhhhhhhhhhhlllllllllllllllllLEEEEEELLLllllEEEEEEELLLLEE


DSSP  EEEEELllLLLLleEEEL--LLLLEE---------eellleeeEELL----LLLEEE---
Query VWEYPLekGWECnsVAAT--KAGEIL---------fsyskgakXITR----DGRELW---   67
ident         |       |                                           
Sbjct LGMTDG--GFLP-hPVAAedGSFFAQastvferiargkrtdyvEVFDpvtfLPIADIelp  117
DSSP  EEEEEE--LLLL-eEEELllLLLEEEeeeeeeelleeeeeeeeEEELllllLEEEEEeel


DSSP  --EEELllllEEEEEE--ELLL---LLEE--------------------eeeellLEEEE
Query --NIAApagcEXQTAR--ILPD---GNAL--------------------vawcghPSTIL  100
ident                    |                                        
Sbjct daPRFL----VGTYQWmnALTPdnkNLLFyqfspapavgvvdlegktfdrmldvpDCYHI  173
DSSP  llLLLL----LLLLHHhlEELLlllEEEEeellllleeeeeelllleeeeeeellLEEEE


DSSP  EellllleEEEEEEL----------------------LLLLlhhHLLLLLEEL-LLLLEE
Query EvnxkgevLSKTEFE----------------------TGIErphAQFRQINKN-KKGNYL  137
ident                                                         |   
Sbjct F--pasptVFYMNCRdgslarvdfadgetkvtntevfHTED--eLLINHPAFSlRSGRLV  229
DSSP  E--eeellEEEEEELllleeeeelllllleeeellllLLLL--lLLLLLLEELlLLLEEE


DSSP  EEELlLLEEEEELL------------llleeeeeelLLLLL--EEEEL-LLLLEEEEL--
Query VPLFaTSEVREIAP------------ngqllnsvklSGTPF--SSAFL-DNGDCLVAC--  180
ident  |   |                                       |              
Sbjct WPTY-TGKIFQADLtaegatfrapiealteaeraddWRPGGwqQTAYHrQSDRIYLLVdq  288
DSSP  EELL-LLEEEEEEElllleeellleellllllhhhlEEELLllLEEEEhHHLEEEEEEee


DSSP  -------LLLLEEEEELLLLLLEEEEEEHhhllllLLLEeEEEEEL--LLLLEEEEEELl
Query -------GDAHCFVQLNLESNRIVRRVNAndiegvQLFFvAQLFPL--QNGGLYICNWQg  231
ident              | || |                                 ||      
Sbjct rdewkhkAASRFVVVLNAETGERINKIEL------GHEI-DSINVSqdAEPLLYALSAG-  340
DSSP  lllllllLLEEEEEEEELLLLLEEEEEEE------EEEE-LEEEELllLLLEEEEEELL-


DSSP  llllhhhllLLLEEEEL-LLLLEEEEELlllLLLL-LLEEEEE--ll
Query hdreagkgkHPQLVEID-SEGKVVWQLNdkvKFGX-ISTICPI--re  274
ident             |   |   |            |     |       
Sbjct ---------TQTLHIYDaATGEELRSVD---QLGRgPQIITTHdmds  375
DSSP  ---------LLEEEEEElLLLLEEEEEL---LLLLlLLEEELLllll


No 134: Query=mol1A Sbjct=2iwaA Z-score=10.4

back to top
DSSP  -----------------------------llleeEEELLL--LLEEEeeelllleEEEEE
Query -----------------------------spqhlLVGGSG--WNKIAiinkdtkeIVWEY   29
ident                                                             
Sbjct rpssrvyivevlnefphdpyaftqglvyaendtlFESTGLygRSSVRqvalqtgkVENIH   60
DSSP  llllleeeeeeeeeeelllllleeeeeelllleeEEEELLllLLEEEeeelllllEEEEE


DSSP  ELLLLLLLLEEEELLlLLEEEELLL-EEEEELL----LLLEEEEEELLlllEEEEEEELL
Query PLEKGWECNSVAATKaGEILFSYSK-GAKXITR----DGRELWNIAAPagcEXQTARILP   84
ident                               |                             
Sbjct KMDDSYFGEGLTLLN-EKLYQVVWLkNIGFIYDrrtlSNIKNFTHQMK---DGWGLATDG  116
DSSP  ELLLLLLEEEEEEEL-LEEEEEELLlLEEEEEEllllEEEEEEELLLL---LLLEEEELL


DSSP  lLLEEEEEELllEEEEEELLL-LLEEEEEEELLLlllhhhLLLLLEELLlLLEEEEELLL
Query dGNALVAWCGhpSTILEVNXK-GEVLSKTEFETGierphaQFRQINKNKkGNYLVPLFAT  143
ident             |   |          |                      |        |
Sbjct -KILYGSDGT--SILYEIDPHtFKLIKKHNVKYN-ghrviRLNELEYIN-GEVWANIWQT  171
DSSP  -LLEEEELLL--LEEEEELLLlLLEEEEEELEEL-leellLEEEEEEEL-LEEEEEELLL


DSSP  LEEEEEL-LLLLEEEEEELL--------------lLLLEEEEL-LLLLEEEELLLLLEEE
Query SEVREIA-PNGQLLNSVKLS--------------gTPFSSAFL-DNGDCLVACGDAHCFV  187
ident      |    | ||    |                     |    |    |         
Sbjct DCIARISaKDGTLLGWILLPnlrkklidegfrdidVLNGIAWDqENKRIFVTGKLWPKLF  231
DSSP  LEEEEEElLLLLEEEEEELHhhhhhhhhlllllllLEEEEEEElLLLEEEEEELLLLEEE


DSSP  EELLLLlleeeeeehhhllllllleeeeeeellllleeeeeellllllhhhllllleeee
Query QLNLESnrivrrvnandiegvqlffvaqlfplqngglyicnwqghdreagkgkhpqlvei  247
ident    |                                                        
Sbjct EIKLHL------------------------------------------------------  237
DSSP  EEEEEE------------------------------------------------------


DSSP  llllleeeeelllllllllleeeeell
Query dsegkvvwqlndkvkfgxisticpire  274
ident                            
Sbjct ----------vrhripdgyierhclnl  254
DSSP  ----------llllllllhhhhhhlll


No 135: Query=mol1A Sbjct=2oitA Z-score=10.3

back to top
DSSP  llleeeeellllleeeeeeLLLLEEEEE--eelllllLLLE-EEELLL------------
Query spqhllvggsgwnkiaiinKDTKEIVWE--yplekgwECNS-VAATKA------------   45
ident                          |           |  |  |                
Sbjct -mgdemdamiperemkdfqFRALKKVRIfdspeelpkERSSlLAVSNKyglvfaggasgl   59
DSSP  -lllllllllleeeelleeEEELLEEELlllllllllLLLLlEEEELLlleeeeeellee


DSSP  --------------------------------------------------lleeeellLE
Query --------------------------------------------------geilfsysKG   55
ident                                                             
Sbjct qifptknlliqnkpgddpnkivdkvqgllvpmkfpihhlalscdnltlsacmmsseygSI  119
DSSP  eeeehhhhlllllllllllleeelllleeellllleeeeeellllleeeeeeeellleEE


DSSP  EEEELLLLL---------eeeEEEL-LLLL-EEEEEEELLLL--LEEEEEELllEEEEEE
Query AKXITRDGR---------elwNIAA-PAGC-EXQTARILPDG--NALVAWCGhpSTILEV  102
ident                                        |       |      |     
Sbjct IAFFDVRTFsneakqqkrpfaYHKLlKDAGgMVIDMKWNPTVpsMVAVCLAD-gSIAVLQ  178
DSSP  EEEEEHHHHhlllllllllleEEELlLLHHhLEEEEEELLLLllEEEEEELL-lLEEEEE


DSSP  LL-LLLEeEEEEELLLlllhhhLLLLLEELLL-LLEEEEELlLLEEEEELLLLLEEEEEE
Query NX-KGEVlSKTEFETGierphaQFRQINKNKK-GNYLVPLFaTSEVREIAPNGQLLNSVK  160
ident       |   |   |                |     |       |    |  |      
Sbjct VTeTVKV-CATLPSTV------AVTSVCWSPKgKQLAVGKQ-NGTVVQYLPTLQEKKVIP  230
DSSP  ELlLEEE-EEEELHHH------LEEEEEELLLlLLEEEEEL-LLLEEEELLLLLEEEEEL


DSSP  LL--------LLLLEEEELLLLLEEEELLL-------lLEEEEELLL------LLLEeEE
Query LS--------GTPFSSAFLDNGDCLVACGD-------aHCFVQLNLE------SNRIvRR  199
ident                                          |   |              
Sbjct CPpfyesdhpVRVLDVLWIGTYVFAIVYAAadgtletsPDVVMALLPkkeekhPEIF-VN  289
DSSP  LLllllllllEEEEEEEEEELLEEEEEEEEllllllllLEEEEEELLllllllLLEE-EE


DSSP  EEHhhlllLLLL-----EEEEEEELL-LLLEEEEEELlllllhhhlllLLEEEELL----
Query VNAndiegVQLF-----FVAQLFPLQ-NGGLYICNWQghdreagkgkhPQLVEIDS----  249
ident                      |                             | |      
Sbjct FME----pCYGScterqHHYYLSYIEeWDLVLAASAA-----------STEVSILArqsd  334
DSSP  LLL----lLLLLlllllLLEEEEEEHhHLEEEEEELL-----------LLLLEEEEelll


DSSP  ----LLLEE----EEELLLL---LLLLLLEEEEELL------------------------
Query ----EGKVV----WQLNDKV---KFGXISTICPIRE------------------------  274
ident     |                                                       
Sbjct qinwESWLLedssRAELPVTdksDDSLPMGVVVDYTnqveitisdektlppapvlmllst  394
DSSP  llleEEEEElhhhLLLLLLLlllLLLLEEEEEEELLlllleeeelleeelllleeeeeel


DSSP  ----------------------------------------
Query ----------------------------------------  274
ident                                         
Sbjct dgvlcpfyminqnpgvksliktperlslegerqpkspgst  434
DSSP  lleeeeeeeeelllllllllllllllllllllllllllll


No 136: Query=mol1A Sbjct=1g72A Z-score=10.2

back to top
DSSP  ---------llleeeeellllleeeeeELLL--------lEEEEEEELL-LLLLLLEEEE
Query ---------spqhllvggsgwnkiaiiNKDT--------kEIVWEYPLE-KGWECNSVAA   42
ident                                            |                
Sbjct dadldkqvntagawpiatggyysqhnsPLAQinksnvknvKAAWSFSTGvLNGHEGAPLV   60
DSSP  lhhhhhhhllllllllllllllllleeLLLLlllllhhhlEEEEEEELLlLLLLLLLLEE


DSSP  LlLLLEEEELLL--EEEEELL--LLLEEEEEELLLL----------leEEEEEELlLLLE
Query TkAGEILFSYSK--GAKXITR--DGRELWNIAAPAG----------ceXQTARILpDGNA   88
ident                         |   |                            |  
Sbjct I-GDMMYVHSAFpnNTYALNLndPGKIVWQHKPKQDastkavmccdvvDRGLAYG-AGQI  118
DSSP  E-LLEEEEELLLllLEEEEELllLLLEEEEELLLLLhhhhhhllllllLLLLEEE-LLEE


DSSP  EEEEELllEEEEEEL-LLLLEEEEEEElLLLLLhhHLLLLLEELLlLLEEEEELL-----
Query LVAWCGhpSTILEVN-XKGEVLSKTEFeTGIERphAQFRQINKNKkGNYLVPLFA-----  142
ident            |      |      |                  |    |          
Sbjct VKKQAN--GHLLALDaKTGKINWEVEV-CDPKVgsTLTQAPFVAK-DTVLMGCSGaelgv  174
DSSP  EEELLL--LEEEEEElLLLLEEEEEEL-LLHHHllLLLLLLEEEL-LEEEEELLLhhhll


DSSP  LLEEEEELL-LLLEEEEEEL--------------------------------------lL
Query TSEVREIAP-NGQLLNSVKL--------------------------------------sG  163
ident    |       | |                                             |
Sbjct RGAVNAFDLkTGELKWRAFAtgsddsvrlakdfnsanphygqfglgtktwegdawkiggG  234
DSSP  LLEEEEEELlLLLEEEEEELlllhhhhllllllllllhhhllllhhhhlllhhhhhhllL


DSSP  LLL-EEEELL-LLLEEEELLL---------------lLEEEEELLLLLLEEEEEE-----
Query TPF-SSAFLD-NGDCLVACGD---------------aHCFVQLNLESNRIVRRVN-----  201
ident |     |            |                        |               
Sbjct TNWgWYAYDPkLNLFYYGSGNpapwnetmrpgdnkwtMTIWGRDLDTGMAKWGYQktphd  294
DSSP  LLLlLLEEELlLLEEEEELLLlllllhhhllllllllLEEEEEELLLLLEEEEEElllll


DSSP  --------------------------------HHHL------------------------
Query --------------------------------ANDI------------------------  205
ident                                                             
Sbjct ewdfagvnqmvltdqpvngkmtpllshidrngILYTlnrengnlivaekvdpavnvfkkv  354
DSSP  lllllllllleeeeeeelleeeeeeeeellllEEEEeellllleeeeeellllllleeee


DSSP  --lllllleeeeeeellllleeeeeelLLLL-----------------------------
Query --egvqlffvaqlfplqngglyicnwqGHDR-----------------------------  234
ident                                                             
Sbjct dlktgtpvrdpefatrmdhkgtnicpsAMGFhnqgvdsydpesrtlyaglnhicmdwepf  414
DSSP  lllllleeelhhhllllllleeeelllLLLLlllllleeelllleeeeeeeleeeeeeel


DSSP  -------------------------lhhHLLL---------------------lLEEEel
Query -------------------------eagKGKH---------------------pQLVEid  248
ident                              |                              
Sbjct mlpyragqffvgatlamypgpngptkkeMGQIrafdlttgkakwtkwekfaawgGTLY--  472
DSSP  lllllllllllleeeeeeelllllllllLEEEeeelllllleeeeeeellllllLLEE--


DSSP  lllleEEEElLLLLLL--------------------LLLEEeEELL--------------
Query segkvVWQLnDKVKFG--------------------XISTIcPIRE--------------  274
ident                                       |                     
Sbjct -tkggLVWYaTLDGYLkaldnkdgkelwnfkmpsggIGSPM-TYSFkgkqyigsmygvgg  530
DSSP  -elllEEEEeLLLLEEeeeellllleeeeeelllllLLLLE-EEEElleeeeeeeellll


DSSP  -----------------------------------------
Query -----------------------------------------  274
ident                                          
Sbjct wpgvglvfdltdpsaglgavgafrelqnhtqmggglmvfsl  571
DSSP  lllhhhhllllllllhhhhhhhlllhhhlllllleeeeeel


No 137: Query=mol1A Sbjct=1oygA Z-score=10.1

back to top
DSSP  ---------------llleeeeellllleeeeeeLLLLEEE-eEEELLLlLLLLEEE---
Query ---------------spqhllvggsgwnkiaiinKDTKEIV-wEYPLEKgWECNSVA---   41
ident                                    |   |              |     
Sbjct qkpyketygishitrhdmlqipeqqknekyqvpeFDSSTIKniSSAKGL-DVWDSWPlqn   59
DSSP  lllllllllleellhhhhhlhhhhlllhhhllllLLHHHLLllHHHLLL-EEEEEEEeel


DSSP  -----ELLL-LLEEEEL--------lLEEEEELL--------LLLEEEEEEL--------
Query -----ATKA-GEILFSY--------sKGAKXITR--------DGRELWNIAA--------   71
ident      |      | |                                             
Sbjct adgtvANYHgYHIVFALagdpknaddTSIYMFYQkvgetsidSWKNAGRVFKdsdkfdan  119
DSSP  lllllLLLLlEEEEEEEeelllllllLEEEEEEEelllllhhHLEEEEELLLllhhhhll


DSSP  -----LLLLEEEEEEELLL--LLEEEEEEL------LLEEEEEELLL----------LLE
Query -----PAGCEXQTARILPD--GNALVAWCG------HPSTILEVNXK----------GEV  108
ident          |              |                                |  
Sbjct dsilkDQTQEWSGSATFTSdgKIRLFYTDFsgkhygKQTLTTAQVNVsasdsslninGVE  179
DSSP  lllhhHLLEEEEEEEEELLllLEEEEEEEEehhhllEEEEEEEEEEEeelllleeeeEEE


DSSP  EEEEEELL-----LLLL------------hhHLLLlLEELL---LLLEEEEE--------
Query LSKTEFET-----GIER------------phAQFRqINKNK---KGNYLVPL--------  140
ident   |  |                                                      
Sbjct DYKSIFDGdgktyQNVQqfidegnyssgdnhTLRD-PHYVEdkgHKYLVFEAntgtedgy  238
DSSP  EEEEEELLlllllLLHHhhhhhlhhhhllllLLEE-EEEEEellEEEEEEEEelllllll


DSSP  ------------------------------------lllLEEEEELL-----LLLEEEEE
Query ------------------------------------fatSEVREIAP-----NGQLLNSV  159
ident                                             |               
Sbjct qgeeslfnkayygkstsffrqesqkllqsdkkrtaelanGALGMIELnddytLKKVMKPL  298
DSSP  llhhhhhlhhhllllhhhhhhhhhhhhhlllhhhhhhllEEEEEEEElllllEEEEEEEE


DSSP  ELL-----LLLLEEEELL-LLLEEEELLL-------------LLEEEEELLL-LLLEEE-
Query KLS-----GTPFSSAFLD-NGDCLVACGD-------------AHCFVQLNLE-SNRIVR-  198
ident   |            |       |                                    
Sbjct IASntvtdEIERANVFKMnGKWYLFTDSRgskmtidgitsndIYMLGYVSNSlTGPYKPl  358
DSSP  EELlllllLLEEEEEEEElLEEEEEEEEEhhhllllllllllEEEEEEEELLlLLLLEEh


DSSP  ---EEEHH---hlllllllEEEEEEEL-LLLLEEEEEELLL--lllhhhllllLEEEELL
Query ---RVNAN---diegvqlfFVAQLFPL-QNGGLYICNWQGH--dreagkgkhpQLVEIDS  249
ident                          |        |                         
Sbjct nktGLVLKmdldpndvtftYSHFAVPQaKGNNVVITSYMTNrgfyadkqstfaPSFLLNI  418
DSSP  hhlLEEEEellllllllleEEEEEELLlLLLEEEEEEEELLllllllllleelLLEEEEE


DSSP  ----LLLEE-EEELllllllllleeeeell
Query ----EGKVV-WQLNdkvkfgxisticpire  274
ident        |    |                 
Sbjct kgkkTSVVKdSILE--------qgqltvnk  440
DSSP  elleEEELLlLLLL--------llllllll


No 138: Query=mol1A Sbjct=2gopA Z-score=10.1

back to top
DSSP  llleeeeellllLEEEEeelllleeeeEEELLL------------------------lll
Query spqhllvggsgwNKIAIinkdtkeivwEYPLEK------------------------gwe   36
ident                             | | |                           
Sbjct -----tfakfayLSDPR----tkgelvAYVLTKanlkdnkyentivienlknnarrfien   51
DSSP  -----lllllleEEEEE----eelleeEEEEEEeelllleeeeeeeeeellllleeeeel


DSSP  lleEEEL-LLLLEEEE-----llLEEE-EELL-LLLEEEEEELLlllEEEEEEELLLL-L
Query cnsVAAT-KAGEILFS-----ysKGAK-XITR-DGRELWNIAAPagcEXQTARILPDG-N   87
ident             | |                           |             |   
Sbjct atmPRISpDGKKIAFMraneekkVSEIwVADLeTLSSKKILEAK---NIRSLEWNEDSrK  108
DSSP  leeEEELlLLLEEEEEeeellllEEEEeEEELlLLEEEEEEEEL---EEEEEEELLLLlE


DSSP  EEEEEE-------lLLEEEEEELLL-LLEEEEEEELlllllhHHLLllLEELLlLLEEEE
Query ALVAWC-------gHPSTILEVNXK-GEVLSKTEFEtgierpHAQFrqINKNKkGNYLVP  139
ident  |               |         ||    |                        | 
Sbjct LLIVGFkrrevpawEKTTFWIFDTEsEEVIEEFEKP------RFSS--GIWHR-DKIVVN  159
DSSP  EEEEEEllllllllLEEEEEEEELLlLEEEEEEEEE------LLLE--EEEEL-LEEEEE


DSSP  ELL---------lLEEEEELLLlLEEEEEELLLLLlEEEELLlLLEEEEL-------lll
Query LFA---------tSEVREIAPNgQLLNSVKLSGTPfSSAFLDnGDCLVAC-------gda  183
ident                                               |             
Sbjct VPHreiipqyfkfWDIYIWEDG-KEEKMFEKVSFY-AVDSDG-ERILLYGkpekkymseh  216
DSSP  EELllllllllllEEEEEEELL-EEEEEEEEELEE-EEEELL-LLEEEEEllllllllll


DSSP  LEEEEELLlllLEEEEEEHHHllllLLLEeeEEEELLlLLEEEEEellllllhhhLLLLL
Query HCFVQLNLesnRIVRRVNANDiegvQLFFvaQLFPLQnGGLYICNwqghdreagkGKHPQ  243
ident              |                 |      |  |                  
Sbjct NKLYIYDG---KEVMGILDEV---dRGVG--QAKIKD-GKVYFTL--------feEGSVN  259
DSSP  LEEEEELL---LLEEELLLLL---lLEEE--EEEEEL-LEEEEEE--------eeLLEEE


DSSP  EEEELllLLEEEEELLLLlLLLLleEEEE-------------------------------
Query LVEIDseGKVVWQLNDKVkFGXIstICPI-------------------------------  272
ident |   |  |                                                    
Sbjct LYIWD--GEIKPIAKGRH-WIMG-fDVDEivvylketatrlrelftwdgeekqltdyndp  315
DSSP  EEEEL--LLEEEEELLLL-EEEE-eEELLleeeeeelllllleeeeellleeelllllll


DSSP  ---ll
Query ---re  274
ident      
Sbjct ifakl  320
DSSP  lllll


No 139: Query=mol1A Sbjct=2hyeA Z-score=10.0

back to top
DSSP  ---llleeeeelllLLEEEE-eelllleeEEEEELLL---------------------LL
Query ---spqhllvggsgWNKIAI-inkdtkeiVWEYPLEK---------------------GW   35
ident                |                                          | 
Sbjct msynyvvtaqkptaVNGCVTghftsaedlNLLIAKNTrleiyvvtaeglrpvkevgmyGK   60
DSSP  llleeeeeeellllLLEEEEellllllllEEEEELLLeeeeeeelllleeeeeeeellLL


DSSP  LLlEEEELL-----LLLEEEELLLE-EEEELLL-------LLEEEE-EELL--LLLE--e
Query ECnSVAATK-----AGEILFSYSKG-AKXITRD-------GRELWN-IAAP--AGCE--x   77
ident                        |  |                                 
Sbjct IA-VMELFRpkgesKDLLFILTAKYnACILEYKqsgesidIITRAHgNVQDriGRPSetg  119
DSSP  LL-EEEEELlllllLLEEEEELLLLeEEEEEEEelllleeEEEEEEeELLLllLLLLlll


DSSP  EEEEELLLL-LEEEEEeLLLEEEEEELL----LLLEeEEEEELLLlllhhHLLLlLEELL
Query QTARILPDG-NALVAWcGHPSTILEVNX----KGEVlSKTEFETGierphAQFRqINKNK  132
ident     | |                                   |                 
Sbjct IIGIIDPECrMIGLRL-YDGLFKVIPLDrdnkELKA-FNIRLEEL-----HVID-VKFLY  171
DSSP  LEEEELLLLlEEEEEE-ELLEEEEEELLllllLLLL-EEEELLLL-----LEEE-EEEEL


DSSP  ---LLLEEEEELL--LLEEEEELL-----LLLEE-EEEE-LLLLLLEEEEL--LLLLEEE
Query ---KGNYLVPLFA--TSEVREIAP-----NGQLL-NSVK-LSGTPFSSAFL--DNGDCLV  178
ident                   |                                    |    
Sbjct gcqAPTICFVYQDpqGRHVKTYEVslrekEFNKGpWKQEnVEAEASMVIAVpePFGGAII  231
DSSP  lllLLEEEEEEEEllEEELLLLLEellllEELLLlLLLLlLLLLLLEEEELllLLLLEEE


DSSP  ELllLLEEEEELlllLLEEEEEEHHhllllLLLEeeeEEELL--lLLEEEeEELLllllh
Query ACgdAHCFVQLNlesNRIVRRVNANdiegvQLFFvaqLFPLQ--nGGLYIcNWQGhdrea  236
ident            |                  |                             
Sbjct IG--QESITYHN---GDKYLAIAPP--iikQSTI-vcHNRVDpngSRYLL-GDME-----  277
DSSP  EL--LLLEEEEL---LLLLLLLLLH--hhhLLLE-eeEEELLlllLEEEE-EELL-----


DSSP  hhlllLLEEEELLL--------------llEEEEELLL-----------lLLLL------
Query gkgkhPQLVEIDSE--------------gkVVWQLNDK-----------vKFGX------  265
ident        |     |                                      |       
Sbjct -----GRLFMLLLEkeeqmdgtvtlkdlrvELLGETSIaecltyldngvvFVGSrlgdsq  332
DSSP  -----LEEEEEEEElllllllllllleeeeEEEEELLLeeeeeelllleeEEEEllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct lvklnvdsneqgsyvvametftnlgpivdmcvvdlerqgqgqlvtcsgafkegslriirn  392
DSSP  eeeelllllhhhlleeeeeeellllllleeeeelllllllleeeeeelllllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct gigihehasidlpgikglwplrsdpnretydtlvlsfvgqtrvlmlngeeveetelmgfv  452
DSSP  elleeeeeelllllllleeeelllllllllleeeellllllleeeeelleeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct ddqqtffcgnvahqqliqitsasvrlvsqepkalvsewkepqaknisvascnssqvvvav  512
DSSP  lllleeeeeeellleeeeeellleeeeellllleeellllllllllleellllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct gralyylqihpqelrqishtemehevaclditplgdsnglsplcaiglwtdisarilklp  572
DSSP  lleeeeeeeelleeeeeeeeelllleeeeelllllllllllleeeeeellllllleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct sfellhkemlggeiiprsilmttfesshyllcalgdgalfyfglnietgllsdrkkvtlg  632
DSSP  lleeeellllllllleeelleeelllleeeeleellleeeeelllllllllllleeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct tqptvlrtfrslsttnvfacsdrptviyssnhklvfsnvnlkevnymcplnsdgypdsla  692
DSSP  lllllllleelllleellllllllllleelllleelllllllllleeeeellllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct lannstltigtideiqklhirtvplyesprkicyqevsqcfgvlssrievqdtsggttal  752
DSSP  eelllleeeeeelllleeeeeeeelllllleeeeelllleeeeelleeeeeellleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct rpsastqalsssvsssklfssstaphetsfgeevevhnlliidqhtfevlhahqflqney  812
DSSP  lllhhhllllllllllllllllllllllllllleeeleeeeeellllleeeeeellllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct alslvscklgkdpntyfivgtamvypeeaepkqgrivvfqysdgklqtvaekevkgavys  872
DSSP  eeeeeeelllllllleeeeeeeelllllllllleeeeeellllllllllleeeellllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct mvefngkllasinstvrlyewttekdvrtecnhynnimalylktkgdfilvgdlmrsvll  932
DSSP  eeeelleeeeelllllleeeellllleeeeellllllleeelllllleeeeeelllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct laykpmegnfeeiardfnpnwmsaveildddnflgaenafnlfvcqkdsaattdeerqhl  992
DSSP  eeeelllleellleelllllleeeeeeeelleeeeeellleeeeeeelllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct qevglfhlgefvnvfchgslvmqnlgetstptqgsvlfgtvngmiglvtslseswynlll 1052
DSSP  eeeeeeelllleeeeeelllllllllllllleeeeeeeeelllleeeeeeelhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct dmqnrlnkviksvgkiehsfwrsfhterktepatgfidgdliesfldisrpkmqevvanl 1112
DSSP  hhhhhhhhhllllllllhhhhlllllllllllllleeellhhhllllllhhhhhhhhlll


DSSP  -------------------lleeeeell
Query -------------------isticpire  274
ident                             
Sbjct qyddgsgmkreataddlikvveeltrih 1140
DSSP  lllllllllllllhhhhhhhhhhhhhhl


No 140: Query=mol1A Sbjct=1jmxB Z-score=9.9

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellLLLEEEELL-LEEEEE
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkAGEILFSYS-KGAKXI   59
ident                                                             
Sbjct -------------------------------------gpalkagHEYMIVTNYpNNLHVV   23
DSSP  -------------------------------------lllllllLEEEEEEELlLEEEEE


DSSP  LL--LLLEEEEEELLlLLEEEEEEELLLL-LEEEEEELllEEEEEELLL-LLEEEEEEEL
Query TR--DGRELWNIAAPaGCEXQTARILPDG-NALVAWCGhpSTILEVNXK-GEVLSKTEFE  115
ident     |                ||   ||   | |        |                 
Sbjct DVasDTVYKSCVMPD-KFGPGTAMMAPDNrTAYVLNNH-yGDIYGIDLDtCKNTFHANLS   81
DSSP  ELllLEEEEEEELLL-LLLLLEEEELLLLlEEEEEELL-lLEEEEEELLlLEEEEEEELL


DSSP  LLlllhhhLLLL-LEELLL-LLEEEEELL-----------lLEEEEELL----LLLEEEE
Query TGierphaQFRQ-INKNKK-GNYLVPLFA-----------tSEVREIAP----NGQLLNS  158
ident                                                             
Sbjct SV-pgevgRSMYsFAISPDgKEVYATVNPtqrlndhyvvkpPRLEVFSTadglEAKPVRT  140
DSSP  LL-lleeeELLLlEEELLLlLEEEEEEEEeeelllleeellLEEEEEEHhhhhHLLLLEE


DSSP  EELLLLLLEEEELLLLLEEEELlllLEEEEELLLLLLEEEEEEHHHL----llLLLLEee
Query VKLSGTPFSSAFLDNGDCLVACgdaHCFVQLNLESNRIVRRVNANDI----egVQLFFva  214
ident              | |   ||                                       
Sbjct FPMPRQVYLMRAADDGSLYVAG---PDIYKMDVKTGKYTVALPLRNWnrkgysAPDVLyf  197
DSSP  EELLLLLLLEEELLLLLEEEEL---LLEEEELLLLLLEEEEELLLLLllllllLLLLLll


DSSP  eeeellLLLEEEEEellllllhhHLLLLlEEEE----llLLLEeEEELLLLLLLLL----
Query qlfplqNGGLYICNwqghdreagKGKHPqLVEI----dsEGKVvWQLNDKVKFGXI----  266
ident                                                 |           
Sbjct wphqspRHEFSMLY--tiarfatADLLY-GYLSvdlktgKTHT-QEFADLTELYFTglrs  253
DSSP  llllllLLEEEEEE--eeeelllLEEEE-EEEEeellllLEEE-EEEEELLLLEEEeeel


DSSP  ---------------------------------leEEEELL-------------------
Query ---------------------------------stICPIRE-------------------  274
ident                                                             
Sbjct pkdpnqiygvlnrlakydlkqrklikaanldhtyyCVAFDKkgdklylggtfndlavfnp  313
DSSP  llllleeeeeeleeeeeelllleeeeeeellllllEEEELLlllleeeelllleeeeeel


DSSP  --------------------------
Query --------------------------  274
ident                           
Sbjct dtlekvkniklpggdmstttpqvfir  339
DSSP  llleeeeeeellllllllllleeeel


No 141: Query=mol1A Sbjct=2htyA Z-score=9.7

back to top
DSSP  llleeeeellllleeeeeellLLEEEEEEEL--------LLLLLLLEEEELLLLLEEEEL
Query spqhllvggsgwnkiaiinkdTKEIVWEYPL--------EKGWECNSVAATKAGEILFSY   52
ident                                                          |  
Sbjct --------vklagnsslcpinGWAVYSKDNSirigskgdVFVIREPFISCSHLECRTFFL   52
DSSP  --------lllllllllllllLLEEEEELLHhhhhllllLEEEEEEEEEELLLLEEEEEE


DSSP  --------------------lLEEEEELLLL----lEEEEEELlllLEEEEEEELLLlLE
Query --------------------sKGAKXITRDG----rELWNIAApagCEXQTARILPDgNA   88
ident                                                    |        
Sbjct tqgallndkhsngtvkdrsphRTLMSCPVGEapspyNSRFESV---AWSASACHDGT-SW  108
DSSP  eeeeelllhhhllllllllllLEEEEEELLLlllllLLEEEEE---LLEEEEEELLL-LE


DSSP  EEEEEL-----LLEEEEEElllllEEEEEEELLLLLLhhHLLLL--lEELLL-LLEEEEE
Query LVAWCG-----HPSTILEVnxkgeVLSKTEFETGIERphAQFRQ--iNKNKK-GNYLVPL  140
ident |                                          |             |  
Sbjct LTIGISgpdngAVAVLKYN-----GIITDTIKSWRNN--ILRTQeseCACVNgSCFTVMT  161
DSSP  EEEEEElllllLEEEEEEL-----LEEEEEEELLLLL--LLEELlllLEEELlEEEEEEE


DSSP  -----llLLEEEEELL--LLLEEEEEEL--LLLLLE-EEELlLLLEEEELLLL----LEE
Query -----faTSEVREIAP--NGQLLNSVKL--SGTPFS-SAFLdNGDCLVACGDA----HCF  186
ident         |                                  |     | |        
Sbjct dgpsngqASYKIFKMEkgKVVKSVELDApnYHYEECsCYPN-AGEITCVCRDNwhgsNRP  220
DSSP  ellllllLEEEEEEEEllEEEEEEELLLllLLLLLLeEEEE-LLEEEEELLLLllllLLE


DSSP  EEELL--lLLLEeeEEEHHHlllLLLL--------------------eeEEEEELLL-LL
Query VQLNL--eSNRIvrRVNANDiegVQLF--------------------fvAQLFPLQN-GG  223
ident            |           |                                  | 
Sbjct WVSFNqnlEYQI--GYICSG---VFGDnprpndgtgscgpvssngaygvKGFSFKYGnGV  275
DSSP  EEEELlllLEEE--EELLLL---LLLLllllllllllllllllllllllLLLEEEELlEE


DSSP  EEEEeellllLLHHhllllLEEEELLLL-------LEEEE-ELLLLLLLLLLEEEE----
Query LYICnwqghdREAGkgkhpQLVEIDSEG-------KVVWQ-LNDKVKFGXISTICP----  271
ident                         |  |         | |           |        
Sbjct WIGR----tkSTNS--rsgFEMIWDPNGwtetdssFSVKQdIVAITDWSGYSGSFVqhpe  329
DSSP  EEEE----llLLLL--leeEEEEEELLLlllllllLLEEEeEEEEEEELLLEEEEEelhh


DSSP  -----------------------------------------------------ell
Query -----------------------------------------------------ire  274
ident                                                         
Sbjct ltgldcirpcfwvelirgrpkestiwtsgssisfcgvnsdtvgwswpdgaelpfti  385
DSSP  hhllllleeeeeeeeeeelllllllleeeeeeeeelllllllllllllllllllll


No 142: Query=mol1A Sbjct=2qr5A Z-score=9.7

back to top
DSSP  --------------------------llLEEEEE--llllLEEEEEElllLEEEEEEELL
Query --------------------------spQHLLVG--gsgwNKIAIINkdtKEIVWEYPLE   32
ident                               |||                          |
Sbjct pvefsrivrdverliavekyslqgvvdgDKLLVVgfsegsVNAYLYD---GGETVKLNRE   57
DSSP  lllhhhhhhhhhhhhhlleeeeeeeellLEEEEEeeelleEEEEEEL---LLLEEELLLL


DSSP  llLLLLEEEElLLLLEEEEL-------lLEEEEELLLL--LEEEE--EELLllLEEEEEE
Query kgWECNSVAAtKAGEILFSY-------sKGAKXITRDG--RELWN--IAAPagCEXQTAR   81
ident              |                           |                  
Sbjct -pINSVLDPHyGVGRVILVRdvskgaeqHALFKVNTSRpgEEQRLeaVKPM--RILSGVD  114
DSSP  -lLLEELEELlLLLEEEEEEelllllllEEEEEEELLLllLEEELllLLLL--EEEEEEE


DSSP  ElllLLEEEEEEL---LLEEEEEEllllLEEEEEEELLLLllhhhLLLLLEELLlLLEEE
Query IlpdGNALVAWCG---HPSTILEVnxkgEVLSKTEFETGIerphaQFRQINKNKkGNYLV  138
ident     | | |                                                   
Sbjct T---GEAVVFTGAtedRVALYALD----GGGLRELARLPG-----FGFVSDIRG-DLIAG  161
DSSP  L---LLLEEEEEElllLEEEEEEE----LLEEEEEEEELL-----LEEEEEEEL-LEEEE


DSSP  EELL---LLEEEEELL-LLLEeEEEEL--LLLLlEEEELLLLLEEEEL--lllLEEEEEL
Query PLFA---TSEVREIAP-NGQLlNSVKL--SGTPfSSAFLDNGDCLVAC--gdaHCFVQLN  190
ident   |               | |             |                     |   
Sbjct LGFFgggRVSLFTSNLsSGGL-RVFDSgeGSFS-SASISPGMKVTAGLetareARLVTVD  219
DSSP  EEEEellEEEEEEEELlLLLL-EEELLllEEEE-EEEELLLLLEEEEEeelllEEEEEEL


DSSP  LLLLLEEEEEehhHLLLL---llLEEEEEEELLLLLEEEE-------------eelllLL
Query LESNRIVRRVnanDIEGV---qlFFVAQLFPLQNGGLYIC-------------nwqghDR  234
ident                             |  |  | |                       
Sbjct PRDGSVEDLE--lPSKDFssyrpTAITWLGYLPDGRLAVVarregrsavfidgerveaPQ  277
DSSP  LLLLLEEELL--lLLLHHhhhllLEEEEEEELLLLLEEEEeeelleeeeeelleeellLL


DSSP  LHhhllllleeeellllleEEEEL---------------lLLLL----------------
Query EAgkgkhpqlveidsegkvVWQLN---------------dKVKF----------------  263
ident                                                             
Sbjct GN--------hgrvvlwrgKLVTShtslstpprivslpsgEPLLegglpedlrrsiagsr  329
DSSP  LE--------eeeeeeellEEEEEeeelleeeeeeeelllEEEElllllhhhhlleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct lvwvesfdgsrvptyvlesgraptpgptvvlvaggpfaedsdswdtfaaslaaagfhvvm  389
DSSP  eeeeellllleeeeeeeeelllllleeeeeeeellllllllllllhhhhhhhhllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct pnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyimgysyggymtlca  449
DSSP  elllllllllhhhhhllllllllhhhhhhhhhhhhhhhhlleeeeeeeeelhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct ltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimrsrspinhvdrike  509
DSSP  hhhllllllleeeelllllhhhhhhhllhhhhhhhhhhhlllhhhhhhllhhhhhhhlll


DSSP  --------------------------------------------------------llll
Query --------------------------------------------------------gxis  267
ident                                                             
Sbjct plalihpqndsrtplkpllrlmgellargktfeahiipdaghaintmedavkillpavff  569
DSSP  leeeeeellllllllhhhhhhhhhhhhlllleeeeeelllllllllhhhhhhhhhhhhhh


DSSP  eeeeell
Query ticpire  274
ident        
Sbjct latqrer  576
DSSP  hhhhhhl


No 143: Query=mol1A Sbjct=1yiqA Z-score=9.6

back to top
DSSP  -------------------------llleeeeellllleeeeeellLLEEEEEEEL-LLL
Query -------------------------spqhllvggsgwnkiaiinkdTKEIVWEYPL-EKG   34
ident                                                    | | |    
Sbjct adipanvdgariiaadkepgnwmstgrtydeqrysplkqisdqnvgQLGLAWSYKLdLDR   60
DSSP  llllllllhhhhhlhhhlllllllllllllllleelllllllllhhHEEEEEEEELlLLL


DSSP  LLLLEEEELlLLLEEEELLL-EEEEELL-LLLEEEEEE-LLLL---------lEEEEEEE
Query WECNSVAATkAGEILFSYSK-GAKXITR-DGRELWNIA-APAG---------cEXQTARI   82
ident            |                 |||  |                         
Sbjct GVEATPIVV-DGVMYTTGPFsVVYALDArDGRLIWKYDpQSDRhrageaccdaVNRGVAV  119
DSSP  LLLLLLEEE-LLEEEEELHHhLEEEEELlLLLEEEEELlLLLHhhhhhlllllLLLLLEE


DSSP  LlLLLEEEEEELllEEEEEELL-LLLEEEEEEELLL--LLLHhhLLLLLEELLlLLEEEE
Query LpDGNALVAWCGhpSTILEVNX-KGEVLSKTEFETG--IERPhaQFRQINKNKkGNYLVP  139
ident    |   |                |                             |     
Sbjct W-KGKVYVGVLD--GRLEAIDAkTGQRAWSVDTRADhkRSYT--ITGAPRVVN-GKVVIG  173
DSSP  E-LLEEEEELLL--LEEEEEELlLLLEEEEEELLLLllLLLL--LLLLLEEEL-LEEEEL


DSSP  ELL-----LLEEEEELL-LLLEEEEEELL-------------------------------
Query LFA-----TSEVREIAP-NGQLLNSVKLS-------------------------------  162
ident            |       |                                        
Sbjct NGGaefgvRGYVTAYDAeTGKEAWRFYTVpgdpklppegkgmeiaaktwfgdayveqggg  233
DSSP  LLLlllllLLEEEEEELlLLLEEEEEELLllllllllllhhhhhhhlllllllhhhhlee


DSSP  -lLLLEEEELL-LLLEEEELL------------------llleeeeelllLLLEEEEE--
Query -gTPFSSAFLD-NGDCLVACG------------------dahcfvqlnleSNRIVRRV--  200
ident      | |            |                                 |     
Sbjct gtAWDSFAYDPeLNLLYIGVGngslwdpkwrsqakgdnlflssivavnadTGEYVWHYqt  293
DSSP  llLLLLEEEELlLLEEEEELLleelllhhhhhlllllllllleeeeeellLLLEEEEEel


DSSP  -----------------------------------eHHHL--------------------
Query -----------------------------------nANDI--------------------  205
ident                                                             
Sbjct tpgdawdytatqhmilaelpidgkprkvlmqapkngFFYVidratgellsakgivpqswt  353
DSSP  llllllllllllleeeeeeeelleeeeeeeelllllEEEEeellllleeeeeelllllle


DSSP  ------------------------------lllllLEEEeeeellllleeeeeeLLLL--
Query ------------------------------egvqlFFVAqlfplqngglyicnwQGHD--  233
ident                                                             
Sbjct kgmdmktgrpildeenaaywkngkrnlvtpafwgaHDWQ---pmsynpdtglvyIPAHim  410
DSSP  eeeelllleeeelhhhhlllllllleeelllllllLLLL---lleeelllleeeEEEEel


DSSP  ------------------------------------------LLHH--------------
Query ------------------------------------------REAG--------------  237
ident                                                             
Sbjct sayyehipeapkrnpfksmyqlglrtgmmpegaegllemaksWSGKliawdpvkqqaawe  470
DSSP  leeeellllllllllllllllllleellllllhhhhhhhhllLEEEeeeeelllleeeee


DSSP  -HLLL----lLEEEellllleEEEE--llLLLL------------------LLLLEEEEE
Query -KGKH----pQLVEidsegkvVWQL--ndKVKF------------------GXISTICPI  272
ident            |                                       |        
Sbjct vPYVTifnggTLST-----agNLVFegsaDGRViayaadtgeklweqpaasGVMAAPVTY  525
DSSP  eEELLlllllEEEE-----llLEEEeellLLEEeeeellllleeeeeelllLLLLLLEEE


DSSP  LL----------------------------------------------------------
Query RE----------------------------------------------------------  274
ident                                                             
Sbjct SVdgeqyvtfmagwggafstfagalslragvqpyaqvltyklggtaklqepaprpdtpkp  585
DSSP  EElleeeeeeeelllllhhhhlhhhhhhhlllllleeeeeeellllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct palsndtasieagaklydgycsqchgihavsggvlpdlrkltpekhqmflgilfggrvpd  645
DSSP  llllllhhhhhhhhhhhhhhlhhhhlhhhlllllllllllllhhhhhlhhhhhllllhhh


DSSP  ---------------------------------------
Query ---------------------------------------  274
ident                                        
Sbjct gmpsfadaftpeqvdqihqylikrahdlhqegdtwkqfs  684
DSSP  llllllllllhhhhhhhhhhhhhhhhhhhhlllllhhhl


No 144: Query=mol1A Sbjct=1olzA Z-score=9.4

back to top
DSSP  ------------------------------------lLLEEeeellllleeeEEEL----
Query ------------------------------------sPQHLlvggsgwnkiaIINK----   20
ident                                                             
Sbjct fapipritwehrevhlvqfhepdiynysalllsedkdTLYI------gareaVFAVnaln   54
DSSP  lllllleeellllllleeellllllllleeeelllllEEEE------eelleEEEEelle


DSSP  ---LLLE-------------------------------------eEEEEEL---------
Query ---DTKE-------------------------------------iVWEYPL---------   31
ident       |                                                     
Sbjct iseKQHEvywkvsedkkakcaekgkskqteclnyirvlqplsatsLYVCGTnafqpacdh  114
DSSP  eeeEEEEeellllhhhhhhhhhlllllllllllleeeeeelllleEEEEELllllleeee


DSSP  ---------------------LLLLLLlEEEELlLLLEEEEL------lleeeeELLLlL
Query ---------------------EKGWECnSVAATkAGEILFSY------skgakxITRDgR   64
ident                                    ||                       
Sbjct lnltsfkflgknedgkgrcpfDPAHSY-TSVMV-DGELYSGTsynflgsepiisRNSShS  172
DSSP  eelllleelllleelllllllLLLLLE-EEEEE-LLEEEEEEellllllleeeeEELLlL


DSSP  EEEE----eELLLlLEEEEEEELLL-----LLEEEEEELL-----------LEEEEEELL
Query ELWN----iAAPAgCEXQTARILPD-----GNALVAWCGH-----------PSTILEVNX  104
ident  |                 |                                  |  |  
Sbjct PLRTeyaipWLNE-PSFVFADVIRKspgedDRVYFFFTEVsveyefvfrvlIPRIARVCK  231
DSSP  LLLLlllllLLLL-LEEEEEEEELLlllllLEEEEEEEEElllllllllleEEEEEEEEL


DSSP  LL-----------leEEEEEELLL---lllhhHLLLLLEELL-----LLLEEEEELL---
Query KG-----------evLSKTEFETG---ierphAQFRQINKNK-----KGNYLVPLFA---  142
ident                  |                 |                        
Sbjct GDqgglrtlqkkwtsFLKARLICSrpdsglvfNVLRDVFVLRspglkVPVFYALFTPqln  291
DSSP  LLlllllllllllllLEEEEELLEehhhleelLEEEEEEEELlllllLLEEEEEEELlll


DSSP  ---LLEEEEELL------------------------------------------------
Query ---TSEVREIAP------------------------------------------------  151
ident     | |                                                     
Sbjct nvgLSAVCAYNLstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaa  351
DSSP  lllEEEEEEEEHhhhhhhhhhllleeeellllllleeeelllllllllllllllhhhhll


DSSP  ------------------------LLLEE---EEEEL-lLLLLEEEELLL--------LL
Query ------------------------NGQLL---NSVKL-sGTPFSSAFLDN--------GD  175
ident                                                             
Sbjct nytsslnlpdktlqfvkdhplmddSVTPIdnrPRLIKkdVNYTQIVVDRTqaldgtvyDV  411
DSSP  llllhhhllhhhhhhhhhlleeeeEELLHhhlLLEEEelLLEEEEEEEEEellllleeEE


DSSP  EEEELlLLLEEEEELLL--LLLEEEEEEHhhlllLLLLEEEEEEELL---LLLEEEEEEl
Query CLVACgDAHCFVQLNLE--SNRIVRRVNAndiegVQLFFVAQLFPLQ---NGGLYICNWq  230
ident   |   |               |                |  |       |   |     
Sbjct MFVST-DRGALHKAISLehAVHIIEETQL----fQDFEPVQTLLLSSkkgNRFVYAGSN-  465
DSSP  EEEEE-LLLEEEEEEELllLEEEEEEEEL----lLLLLLLLEEEELLlllLLEEEEELL-


DSSP  lllllhhhlllLLEEEELLLL---------------------------------------
Query ghdreagkgkhPQLVEIDSEG---------------------------------------  251
ident               |                                             
Sbjct -----------SGVVQAPLAFcgkhgtcedcvlardpycawspptatcvalhqtespsrg  514
DSSP  -----------LLEEEEELLLhhhlllhhhhhhllllleeeelllleeeelllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  251
ident                                                             
Sbjct liqemsgdasvcpdkskgsyrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespky  574
DSSP  llllllllhhhllllllleeeeeeeelllleeellllllllleeeeeellllllllllll


DSSP  ------------------------leeeeelllllllllleeeeell
Query ------------------------kvvwqlndkvkfgxisticpire  274
ident                                                
Sbjct glmgrknllifnlsegdsgvyqclseervknktvfqvvakhvlevkv  621
DSSP  llllllleeellllhhhleeeeeeeeeelllleeeeeeeeeeeeeel


No 145: Query=mol1A Sbjct=2w5nA Z-score=9.4

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct ------------------------------------------------------amkpag    6
DSSP  ------------------------------------------------------llllll


DSSP  LLLLEEEEEELL----LLLEEEEEEELL--LLLEEEEEEL-----LLEEEEEEL---LLL
Query RDGRELWNIAAP----AGCEXQTARILP--DGNALVAWCG-----HPSTILEVN---XKG  106
ident            |                                              | 
Sbjct KTFSNVEIFDPPtnyrDPQVLYARPLELsdGTLLGTWENYspeppNVWFPIVKSkdgGKT   66
DSSP  LLEEEEEEELLLllllLLLEEEEEEEELllLLEEEEEEELlllllLLLEEEEEElllLLL


DSSP  LEEEEEEELLLLLlhhhLLLLLEELL---------LLLEEEEELL-----LLEEEEELL-
Query EVLSKTEFETGIErphaQFRQINKNK---------KGNYLVPLFA-----TSEVREIAP-  151
ident          |                                               |  
Sbjct WKEISKVKDTQNN-wglRYQPQLYELprafgkypkGTVLCSGSSIpsdlsETLIEVYASr  125
DSSP  LEEEEEELLLLLL-lleEEEEEEEELlllllllllLLEEEEEEELlllllLEEEEEEEEl


DSSP  ----LLLEEEEEELL----------LLLLEEEELLL-LLEEEELLL-------LLEEEEE
Query ----NGQLLNSVKLS----------GTPFSSAFLDN-GDCLVACGD-------AHCFVQL  189
ident            | |                          |                 | 
Sbjct dkgyTWEFVSHVALGgealpnpgltPVWEPFLMTYKeKLILYYSDQrdnathsQKLVHQT  185
DSSP  llllLLEEEEEEEEEllllllllllLEEEEEEEEELlEEEEEEEELlllllllLEEEEEE


DSSP  LLL-LLLEEEE-EEHHhllllllLEEEEEEELL--LLLEEEEEELlllllHHHL-----L
Query NLE-SNRIVRR-VNANdiegvqlFFVAQLFPLQ--NGGLYICNWQghdreAGKG-----K  240
ident                                    |   |                    
Sbjct TTDlKKWSKVVdDTKY--adyyaRPGMPTVAKLpnNEYIYVYEYG----gGPNPpagsdY  239
DSSP  ELLlLLLLLLEeEELL--lllllEEEEEEEEELllLLEEEEEEEE----lLLLLlllllL


DSSP  LLLEEEELL-------LLLEeEEELL-lLLLLLLL-EEEEEL------------------
Query HPQLVEIDS-------EGKVvWQLND-kVKFGXIS-TICPIR------------------  273
ident         |             |           |                         
Sbjct WFPVYYRLSkdpqkflNKAH-HQIVSndGTTPAGSpYVVWTPyggkngtivvscgtrsei  298
DSSP  LLLEEEEEElllllllLLLL-EELLLllLLLLLLLlEEEEELlllllleeeeelllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct ftnqalgdasawkkwdvpqptaytrslltfqkdpdllmimgagilppaggkntvsasvvr  358
DSSP  eeelllllllleeeelllllllllleeeeelleeeeeeeeelllllllllllleeeeeee


DSSP  ------l
Query ------e  274
ident        
Sbjct lsevmks  365
DSSP  hhhhlll


No 146: Query=mol1A Sbjct=1gyhA Z-score=9.3

back to top
DSSP  llleeeeellllleeeeeelllleeeEEEELlllLLLLEEEELLlLLEEEELLL--EEEE
Query spqhllvggsgwnkiaiinkdtkeivWEYPLekgWECNSVAATKaGEILFSYSK--GAKX   58
ident                                                             
Sbjct -------------------------gAKQVD---VHDPVMTREG-DTWYLFSTGpgITIY   31
DSSP  -------------------------lLLLLL---LLLLEEEEEL-LEEEEEELEelLEEE


DSSP  ELL---LLLEEEEEE-------------llLLLEeEEEEeLLLLLEEEEEEL-------L
Query ITR---DGRELWNIA-------------apAGCExQTARiLPDGNALVAWCG-------H   95
ident         |                                  |                
Sbjct SSKdrvNWRYSDRAFateptwakrvspsfdGHLWaPDIY-QHKGLFYLYYSVsafgkntS   90
DSSP  EELlllEEEEEEELLllllllhhhhlllllLEEEeEEEE-EELLEEEEEEEElllllllE


DSSP  LEEEEEE-LLLL-----LEEEEEEELLL--lllhhHLLLLLEELL--LLLEEEEELL-LL
Query PSTILEV-NXKG-----EVLSKTEFETG--ierphAQFRQINKNK--KGNYLVPLFA-TS  144
ident                      |                                      
Sbjct AIGVTVNkTLNPaspdyRWEDKGIVIESvpqrdlwNAIAPAIIADdhGQVWMSFGSFwGG  150
DSSP  EEEEEEElLLLLlllllLLEEEEEEEEElllllllLLLLLEEEELllLLEEEEELLLlLL


DSSP  EEEEEL---LLLLE---EEEEELL----------------LLLLEEEELLLlLEEEELLL
Query EVREIA---PNGQL---LNSVKLS----------------GTPFSSAFLDNgDCLVACGD  182
ident                                                             
Sbjct LKLFKLnddLTRPAepqEWHSIAKlersvlmddsqagsaqIEAPFILRKGD-YYYLFASW  209
DSSP  EEEEELlllLLLLLlllLEEEEELllllllllllllllllEEEEEEEEELL-EEEEEEEE


DSSP  -----------lLEEEEELLllLLEEE----------EEEH-hhllllLLLEeEEEEEll
Query -----------aHCFVQLNLesNRIVR----------RVNA-ndiegvQLFFvAQLFPlq  220
ident                                                             
Sbjct glccrkgdstyhLVVGRSKQvtGPYLDktgrdmnqggGSLLikgnkrwVGLGhNSAYTwd  269
DSSP  lllllhhhllleEEEEEELLllLLLLLlllllhhhllLEEEellllleEEEEeEEEEEel


DSSP  LLLEeeeeellllllhhhlllllEEEELLL-lleeeEELLLLLLLllleeeeell
Query NGGLyicnwqghdreagkgkhpqLVEIDSE-gkvvwQLNDKVKFGxisticpire  274
ident                        |                               
Sbjct GKDY-lvlhayeaadnylqklkiLNLHWDGegwpqvDEKELDSYI-----sqrlk  318
DSSP  LEEE-eeeeeeehhhlleeeeeeEELEELLllleelLLLHHHHLL-----leell


No 147: Query=mol1A Sbjct=3c7gA Z-score=9.2

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct ----------------------------------------------------satsttia    8
DSSP  ----------------------------------------------------llllllll


DSSP  llLLEEEE-EELLllLEEEEEEELLL-LLEEEEEEL-----------------lLEEEEE
Query rdGRELWN-IAAPagCEXQTARILPD-GNALVAWCG-----------------hPSTILE  101
ident          |                                                  
Sbjct khIGNSNPlIDHH--LGADPVALTYNgRVYIYMSSDdyeynsngtikdnsfanlNRVFVI   66
DSSP  llLLLLLLlLLLL--LLEEEEEEEELlEEEEEEELLlleellllleelllllllLLEEEE


DSSP  EL--LLLLEEEEEEELLLLL----------lhhHLLLLLEELL-----LLLEEEEELL-L
Query VN--XKGEVLSKTEFETGIE----------rphAQFRQINKNK-----KGNYLVPLFA-T  143
ident                  |               |        |         |       
Sbjct SSadMVNWTDHGAIPVAGANganggrgiakwagASWAPSIAVKkingkDKFFLYFANSgG  126
DSSP  EEllLLLEEEEEEELLLLLLlllllllllllllLLEEEEEEEEeelleEEEEEEEELLlL


DSSP  LEEEEEL----LLLLEEE--EEELL----------LLLLEEEELLLLLEEEELLL-----
Query SEVREIA----PNGQLLN--SVKLS----------GTPFSSAFLDNGDCLVACGD-----  182
ident       |                                     | |      |      
Sbjct GIGVLTAdspiGPWTDPIgkPLVTPstpgmsgvvwLFDPAVFVDDDGTGYLYAGGgvpgv  186
DSSP  LEEEEEEllllLLEELLLllLLLLLllllllllllLLLLEEEELLLLLEEEEEELlllll


DSSP  ------------LLEEEEELLL-lLLEEEEEEHhhlllLLLLEeEEEEELLLlLEEEEEE
Query ------------AHCFVQLNLE-sNRIVRRVNAndiegVQLFFvAQLFPLQNgGLYICNW  229
ident                   |                      |    |        |    
Sbjct snptqgqwanpkTARVIKLGPDmtSVVGSASTI---daPFMFEdSGLHKYNG-TYYYSYC  242
DSSP  llllhhhhhlllLEEEEEELLLllLEEEEEEEE---llLLEEEeEEEEEELL-EEEEEEE


DSSP  LlLLLLhHHLLL----lLEEEELL-lLLEEEEELlllLLLL-----------lLEEEEEL
Query QgHDREaGKGKH----pQLVEIDS-eGKVVWQLNdkvKFGX-----------iSTICPIR  273
ident                        |  |                                 
Sbjct I-NFGGtHPADKppgeiGYMTSSSpmGPFTYRGH---FLKNpgaffggggnnhHAVFNFK  298
DSSP  E-LLLLlLLLLLlllleEEEEELLllLLLEEEEE---EELLhhhhhlllllllEEEEEEL


DSSP  L-----------------------------------------------------------
Query E-----------------------------------------------------------  274
ident                                                             
Sbjct Newyvvyhaqtvssalfgagkgyrsphinklvhnadgsiqevaanyagvtqisnlnpynr  358
DSSP  Leeeeeeeelhhhhhhhllllllleeeeeellllllllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct veaetfawngriltekstapggpvnnqhvtsiqngdwiavgnadfgaggarsfkanvast  418
DSSP  eelleeleeelleeeelllllllllleeeelllllleeeeeeeellllleeeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct lggkievrldsadgklvgtlnvpstggaqtwreietavsgatgvhkvffvftgtgtgnlf  478
DSSP  lleeeeeeelllllleeeeeeelllleeeeeeeeeeelllllleeeeeeeeellllllll


DSSP  ----------
Query ----------  274
ident           
Sbjct nfdywqftqr  488
DSSP  eeeeeeeeel


No 148: Query=mol1A Sbjct=1lrwA Z-score=9.1

back to top
DSSP  -----------------llleeeeellllleeeeeellLLEEEEEEELLLLLLLLE-EEE
Query -----------------spqhllvggsgwnkiaiinkdTKEIVWEYPLEKGWECNS-VAA   42
ident                                            |                
Sbjct ndqlvelakdpanwvmtgrdynaqnysemtdinkenvkQLRPAWSFSTGVLHGHEGtPLV   60
DSSP  lhhhhhhhllllllllllllllllleelllllllllhhHEEEEEEEELLLLLLLLLlLEE


DSSP  LlLLLEEEELLL--EEEEELL--LLLEEEEEELLLL----------lEEEEEEELLL---
Query TkAGEILFSYSK--GAKXITR--DGRELWNIAAPAG----------cEXQTARILPD---   85
ident                         |  ||                          |    
Sbjct V-GDRMFIHTPFpnTTFALDLnePGKILWQNKPKQNptartvaccdvVNRGLAYWPGddq  119
DSSP  E-LLEEEELLLLllLEEEEELllLLLEEEEELLLLLhhhhhhlllllLLLLLEEELLlll


DSSP  --LLEEEEEELllEEEEEEL-LLLLEEEEEEElLLLLlhhHLLLLLEELLlLLEEEEELL
Query --GNALVAWCGhpSTILEVN-XKGEVLSKTEFeTGIErphAQFRQINKNKkGNYLVPLFA  142
ident                |       ||     |    |             |    ||    
Sbjct vkPLIFRTQLD--GHIVAMDaETGETRWIMEN-SDIKvgsTLTIAPYVIK-DLVLVGSSG  175
DSSP  llLEEEEELLL--LEEEEEElLLLLEEEEEEL-LLHHhllLLLLLLEEEL-LEEEELLLL


DSSP  ----LLEEEEEL----LLLLeEEEEE----------------------------------
Query ----TSEVREIA----PNGQlLNSVK----------------------------------  160
ident                                                             
Sbjct aelgVRGYVTAYdvksGEMR-WRAFAtgpdeelllaedfnapnphygqknlgletwegda  234
DSSP  hhhlLLLEEEEEelllLLEE-EEEELlllhhhhllllllllllhhhllllhhhhlllllh


DSSP  ---lLLLL-LEEEELL-LLLEEEEL--------------llllEEEEELL---lLLLEEE
Query ---lSGTP-FSSAFLD-NGDCLVAC--------------gdahCFVQLNL---eSNRIVR  198
ident      ||     |                                               
Sbjct wkigGGTNwGWYAYDPeVDLFYYGSgnpapwnetmrpgdnkwtMAIWGREattgEAKFAY  294
DSSP  hhhlLLLLlLLLEEELlLLEEEEELlllllllhhhllllllllLEEEEEEllllLEEEEE


DSSP  EE------------------------------------eHHHL-----------------
Query RV------------------------------------nANDI-----------------  205
ident                                                             
Sbjct QKtphdewdyagvnvmmlseqedkqgqmrkllthpdrngIVYTldrtngdlisadkmddt  354
DSSP  ELlllllllllllllleeeeeellllleeeeeeeellllEEEEeelllleeeeeeellll


DSSP  ---------------------------------lllllLEEEEeeellllleeeeeellL
Query ---------------------------------egvqlFFVAQlfplqngglyicnwqgH  232
ident                                                             
Sbjct vnwvkevqldtglpvrdpefgtrmdhkardicpsamgyHNQGH---dsydperkvfmlgI  411
DSSP  llleeeelllllleeelhhhllllllleeeelllllllLLLLL---leeelllleeeeeE


DSSP  LLL------------------------------------hHHLLL---------------
Query DRE------------------------------------aGKGKH---------------  241
ident                                                             
Sbjct NHIcmdwepfmlpyragqffvgatltmypgpkgdrgnasgLGQIKaydaisgemkwekme  471
DSSP  ELEeeeeeellllllllllllleeeeeeelllllllllllLEEEEeeelllleeeeeeee


DSSP  ------lLEEEellllleEEEE--llLLLL------------------LLLLEEEEELL-
Query ------pQLVEidsegkvVWQL--ndKVKF------------------GXISTICPIRE-  274
ident                                                 | |         
Sbjct rfsvwggTMAT-----agGLTFyatlDGFIkardsdtgdllwkfklpsGVIGHPMTYKHd  526
DSSP  lllllllEEEE-----llLEEEeellLLEEeeeellllleeeeeelllLLLLLLEEEEEl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct grqyvaimygvggwpgvglvfdladptaglgsvgafkrlqeftqmgggvmvfsldgespy  586
DSSP  leeeeeeeelllhhhhhhhhlllllllhhhhhhhhlllhhhlllllleeeeeeellllll


DSSP  --------------
Query --------------  274
ident               
Sbjct sdpnvgeyapgept  600
DSSP  llllllllllllll


No 149: Query=mol1A Sbjct=2htvA Z-score=9.1

back to top
DSSP  llleeeeellllleeeeeelLLLEEEEEEE-------lLLLLLLleEEELL-LLLEEEEL
Query spqhllvggsgwnkiaiinkDTKEIVWEYP-------lEKGWECnsVAATK-AGEILFSY   52
ident                                                          |  
Sbjct ------vihyssgkdlcpvkGWAPLSKDNGirigsrgeVFVIRE-pFISCSiNECRTFFL   53
DSSP  ------llllllllllllllLLEEEEELLHhhhlllllLLLLLL-lEEEELlLLEEEEEE


DSSP  L--------------------LEEEEELLLL-----LEEEEEELlllleEEEEEELLL-L
Query S--------------------KGAKXITRDG-----RELWNIAApagceXQTARILPD-G   86
ident                                            |               |
Sbjct TqgallndkhsngtvkdrspfRTLMSCPIGVapspsNSRFESVA-----WSATACSDGpG  108
DSSP  ElllllllhhhllllllllllLEEEEEELLLlllllLLEEEEEL-----LLEEEEELLlL


DSSP  LEEEEEEL---LLEEEEEELlllLEEEEEEeLLLLLLHhhLLLL--lEELLL-LLEEEEE
Query NALVAWCG---HPSTILEVNxkgEVLSKTEfETGIERPhaQFRQ--iNKNKK-GNYLVPL  140
ident        |        |  |        |              |           |    
Sbjct WLTIGITGpdaTAVAVLKYN---GIITDTL-KSWKGNI--MRTQeseCVCQDeFCYTLIT  162
DSSP  EEEEEEELlhhHLEEEEEEL---LEEEEEE-ELLLLLL--LEELlllLEEELlEEEEEEE


DSSP  -----llLLEEEEELL--LLLEEEEEEL--LLLLLEEEELLL-LLEEEELLLL---LEEE
Query -----faTSEVREIAP--NGQLLNSVKL--SGTPFSSAFLDN-GDCLVACGDA---HCFV  187
ident                          |          |          |            
Sbjct dgpsdaqAFYKILKIKkgKIVSVKDVDApgFHFEECSCYPSGeNVECVCRDNWrgsNRPW  222
DSSP  ellllllLEEEEEEEEllEEEEEEEELLllLLLLLLEEEEELlEEEEELLLLLlllLLEE


DSSP  EELL--lLLLEeEEEEHHhlllLLLLE----------------------eEEEEELLL-L
Query QLNL--eSNRIvRRVNANdiegVQLFF----------------------vAQLFPLQN-G  222
ident           |   |       |                                    |
Sbjct IRFNsdlDYQI-GYVCSG----VFGDNprpmdstgscnspinngkgrygvKGFSFRYGdG  277
DSSP  EEELlllLEEE-EELLLL----LLLLLlllllllllllllllllllllllLLLEEEELlE


DSSP  LEEEEeellllLLHHhllllLEEEELLLL-------LEEEE-ELLLLLLLLLLEEEE---
Query GLYICnwqghdREAGkgkhpQLVEIDSEG-------KVVWQ-LNDKVKFGXISTICP---  271
ident                          |  |           |   |       |       
Sbjct VWIGR----tkSLES--rsgFEMVWDANGwvstdkdSNGVQdIIDNDNWSGYSGSFSirg  331
DSSP  EEEEE----llLLLL--leeEEEEEELLLlllllllLLLEEeEEEEEEELLLEEEEEell


DSSP  ------------------------------------------------------ell
Query ------------------------------------------------------ire  274
ident                                                          
Sbjct ettgrnctvpcfwvemirgqpkektiwtsgssiafcgvnsdttgwswpdgallpfdi  388
DSSP  lllllllleeeeeeelleelllllllleelleeeeelllllllllllllllllllll


No 150: Query=mol1A Sbjct=1mdaH Z-score=9.1

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeeLLLLLEEEELL------L
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaaTKAGEILFSYS------K   54
ident                                                             
Sbjct --------------ekskvagsaaaasaaaasdgsscdhgpgAISRRSHITLPayfagtT   46
DSSP  --------------lllllllhhhhhhhllllllllllllllLLLLEEEEEELllllllE


DSSP  EEEEELL-LLLEEEEEELLllLEEEeEEELLLL-LEEEEEEL--------LLEEEEEELL
Query GAKXITR-DGRELWNIAAPagCEXQtARILPDG-NALVAWCG--------HPSTILEVNX  104
ident          |  |             |     |     |                     
Sbjct ENWVSCAgCGVTLGHSLGA--FLSL-AVAGHSGsDFALASTSfarsakgkRTDYVEVFDP  103
DSSP  EEEEEELlLLEEEEEEEEL--LLLE-EEELLLLlLEEEEEEEelllllllEEEEEEEELL


DSSP  L-LLEEEEEEELLLLllHHHL---llLLEEL-LLLLEEEEELL-LLEEEEELL-LLLEeE
Query K-GEVLSKTEFETGIerPHAQ---frQINKN-KKGNYLVPLFA-TSEVREIAP-NGQLlN  157
ident          |                 |         |  ||          |       
Sbjct VtFLPIADIELPDAP--RFSVgprvhIIGNCaSSACLLFFLFGsSAAAGLSVPgASDD-Q  160
DSSP  LlLLEEEEEEELLLL--LLLLlllllLEEELlLLLLEEEEELLlLLEEEEEELlLEEE-E


DSSP  EEELLLLLlEEEELllLLEEEELllLLEEEEELLL--LLLEeEEEEHHhllllLLLEEEE
Query SVKLSGTPfSSAFLdnGDCLVACgdAHCFVQLNLE--SNRIvRRVNANdiegvQLFFVAQ  215
ident   |                              |          | |      |      
Sbjct LTKSASCF-HIHPGaaATHYLGS-cPASLAASDLAaaPAAA-GIVGAQ-ctgaQNCSSQA  216
DSSP  EEELLLLL-LLEEEelLEEELLL-lLLLLEEEELLllLLLL-EELLLL-llllLLLLLLL


DSSP  EEELLlLLEEEEEELlllllhhhllLLLEEEE---lllLLEEeEELLLLL----------
Query LFPLQnGGLYICNWQghdreagkgkHPQLVEI---dseGKVVwQLNDKVK----------  262
ident        |                    |                               
Sbjct AQANY-PGMLVWAVA----------SSILQGDipaagaTMKA-AIDGNESgrkadnfrsa  264
DSSP  EEELL-LLEEEELLL----------LLLEEEEllllllEEEL-LLLLLLLhhhhlleeel


DSSP  ------------------------------------------------llllleeEEELL
Query ------------------------------------------------fgxistiCPIRE  274
ident                                                             
Sbjct gfqmvaklkntdgimiltvehsrsclaaaentssvtasvgqtsgpisnghdsdaiIAAQD  324
DSSP  lllleeeelllleeeeeeeelllllllleeeeeeeellllleeelleeeeeeleeEELLL


DSSP  --------------------------------------------
Query --------------------------------------------  274
ident                                             
Sbjct gasdnyansagtevldiydaasdqdqssveldkgpeslsvqnea  368
DSSP  llleeeeeelllleeeeeelllleeeeelllllllleeelllll


No 151: Query=mol1A Sbjct=2ht5A Z-score=9.0

back to top
DSSP  --------------------------------------------LLLEEEEEL-------
Query --------------------------------------------SPQHLLVGG-------    9
ident                                                             
Sbjct tymnnteaicdakgfapfskdngirigsrghifvirepfvscspIECRTFFLTqgsllnd   60
DSSP  llllllllllllllleeeeellhhhhhlllllllllllleeellLLEEEEEEElllllll


DSSP  ----------llLLEEEEEELLLLE---EEEEEELlllllLLEEEELL--LLLEEEEL--
Query ----------sgWNKIAIINKDTKE---IVWEYPLekgweCNSVAATK--AGEILFSY--   52
ident                                             |               
Sbjct khsngtvkdrspFRTLMSVEVGQSPnvyQARFEAV----aWSATACHDgkKWMTVGVTgp  116
DSSP  hhhlllllllllLLEEEEEELLLLLlllLLEEEEE----lLEEEEEELllLEEEEEEEll


DSSP  --lLEEEEELLlLLEEEEEELL-LLLEEEE--eEELLL-LLEEEEEELL----lEEEEEE
Query --sKGAKXITRdGRELWNIAAP-AGCEXQT--aRILPD-GNALVAWCGH----pSTILEV  102
ident      |      |                              |   |            
Sbjct dskAVAVIHYG-GVPTDVVNSWaGDILRTQessCTCIQgDCYWVMTDGPanrqaQYRIYK  175
DSSP  lllLEEEEEEL-LLEEEEEELLlLLLLEELlllLEEELlEEEEEEEELLlllllEEEEEE


DSSP  LL--LLLEeEEEEELLLLllhhhLLLLLEELLL---LLEEEEELL-LLEEEEELL----L
Query NX--KGEVlSKTEFETGIerphaQFRQINKNKK---GNYLVPLFA-TSEVREIAP----N  152
ident                 |                                           
Sbjct ANqgRIIG-QTDISFNGG-----HIEECSCYPNdgkVECVCRDGWtGTNRPVLVIspdlS  229
DSSP  EEllEEEE-EEEELLLLL-----LLEEEEEEEElleEEEEEELLLlLLLLEEEEEllllL


DSSP  LLEEEEE---ELLL---------------------LLLEEEELLL--LLEEE--ellLLL
Query GQLLNSV---KLSG---------------------TPFSSAFLDN--GDCLV--acgDAH  184
ident                                          |                  
Sbjct YRVGYLCagiPSDTprgedtqftgsctspmgnqgyGVKGFGFRQGtdVWMGRtisrtSRS  289
DSSP  EEEEELLlllLLLLllllhhhllllllllllllllLLLLLEEEELleEEEEElllllLLE


DSSP  EEEEELLLLL--------lEEEE-EEHHhlllllLLEEEEEE----------elllllEE
Query CFVQLNLESN--------rIVRR-VNANdiegvqLFFVAQLF----------plqnggLY  225
ident  |  |                   |                                   
Sbjct GFEILRIKNGwtqtskeqiRKQVvVDNL------NWSGYSGSftlpvelsgkdclvpcFW  343
DSSP  EEEEEEELLLllllllleeEEEEeEEEE------EELLLEEEeeelhhhhllllleeeEE


DSSP  EEEELllLLLHHHLLLLL-EEEE------llLLLEeeeelllllllllleeeeell
Query ICNWQghDREAGKGKHPQ-LVEI------dsEGKVvwqlndkvkfgxisticpire  274
ident          |                                              
Sbjct VEMIR-gKPEEKTIWTSSsSIVMcgvdyevaDWSW-----------hdgailpfdi  387
DSSP  EEEEE-eLLLLLLLLEEEeEEEEelllllllLLLL-----------llllllllll


No 152: Query=mol1A Sbjct=3cpnA Z-score=9.0

back to top
DSSP  --------------------LLLEEEEELLLLLEEEEEE------LLLLEEEEEEELLL-
Query --------------------SPQHLLVGGSGWNKIAIIN------KDTKEIVWEYPLEK-   33
ident                                   |              | |        
Sbjct kilnpiiiqradpxiykhndGYYYFTASVPEYDRIEVRKaktiegLRNAEPVDVWRRHEs   60
DSSP  lllllllllleeeeeeelllLLEEEEEELLLLLEEEEEEelllhhHLLLLLEEEEELLLl


DSSP  ---LLLLLEEEELL---LLLEEEELL-----------LEEEEELL--------LLLEEEE
Query ---GWECNSVAATK---AGEILFSYS-----------KGAKXITR--------DGRELWN   68
ident                  |  | |                   |             |   
Sbjct gexSNLIWAPEIHFingAWYIYFAAApdknieddtfnHRXFVIQNenenpftgNWVEKGR  120
DSSP  lllLEEEEEEEEEEellEEEEEEEEElllllllllllLEEEEEEEllllllllLLEEEEE


DSSP  EEllLLLEEEEEEELL---LLLEEEEEELLleeeeeellllleeeeeeeLLLLllhhhll
Query IAapAGCEXQTARILP---DGNALVAWCGHpstilevnxkgevlsktefETGIerphaqf  125
ident |          | |           |                                  
Sbjct IKtaWESFSLDATIFEhneKLYYVWAQQDI-------------------NIKG------h  155
DSSP  LLllLLLLEEEEEEEEellEEEEEEEELLL-------------------LLLL------l


DSSP  llLEEL---------lllLEEEEElllleeeeellllleeeeeELLL-----LLLEEEEL
Query rqINKN---------kkgNYLVPLfatsevreiapngqllnsvKLSG-----TPFSSAFL  171
ident   |                 |                                    | |
Sbjct snIYIAexenpwtlktkpVXLTKP------------------eLEWEikgfwVNEGPAVL  197
DSSP  leEEEEeeeelleellllEEEELL------------------lLHHHlllllLEEEEEEE


DSSP  LL---LLEEEELLL---LLEEEEELLL----------lLLEEEE-EEHHhlLLLLLleEE
Query DN---GDCLVACGD---AHCFVQLNLE----------sNRIVRR-VNANdiEGVQLffVA  214
ident                    |   |  |                                 
Sbjct KKngkIFITYSASAtdvNYCIGXLTAEensnlldknswTKSQTPvFKTSxeNHQYG--PG  255
DSSP  EElleEEEEEEELLlllLLEEEEEEEElllllllhhhlEELLLLlLLLLllLLLEE--EE


DSSP  EEEELL-----LLLEEEEE--------eLLLLllhhhllLLLEEEELL----------LL
Query QLFPLQ-----NGGLYICN--------wQGHDreagkgkHPQLVEIDS----------EG  251
ident                                |                            
Sbjct HNSFTVsedgkHDVIVYHArnyteikgdPLYD------pNRHTRAQIInwredgtpdfGV  309
DSSP  EEEEEElllllLEEEEEEEellllllllHHHL------lLLEEEEEELeellllleelLL


DSSP  LEeeeeLLLLlllllleeeeell
Query KVvwqlNDKVkfgxisticpire  274
ident                        
Sbjct PE-vdsIETP------------v  319
DSSP  LL-lllLLLL------------l


No 153: Query=mol1A Sbjct=1flgA Z-score=8.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq   60
DSSP  llllhhhhhlhhhlllllllllllllllleelllllllllhhhleeeeeeelllllllll


DSSP  ------lLLEEEEELlLLLEEEEEELLLLEEEEEEELLLL--------lLLLEEEELlLL
Query ------sPQHLLVGGsGWNKIAIINKDTKEIVWEYPLEKG--------wECNSVAATkAG   46
ident             |              |    | |                   |     
Sbjct esqaivsDGVIYVTA-SYSRLFALDAKTGKRLWTYNHRLPddirpccdvVNRGAAIY-GD  118
DSSP  lllleeeLLEEEEEE-LLLEEEEEELLLLLEEEEEELLLLlllllllllLLLLLEEE-LL


DSSP  LEEEELL-LEEEEELL-LLLEEEEEELLL---LLEE-EEEEELL-----LLLEEEEEEL-
Query EILFSYS-KGAKXITR-DGRELWNIAAPA---GCEX-QTARILP-----DGNALVAWCG-   94
ident    |              |   |         |        |                | 
Sbjct KVFFGTLdASVVALNKnTGKVVWKKKFADhgaGYTMtGAPTIVKdgktgKVLLIHGSSGd  178
DSSP  EEEEEELlLEEEEEELlLLLEEEEEELLLhhhLLLLlLLLEEEElllllLEEEEELLLLh


DSSP  ---LLEEEEEEL-LLLLEEEEEEEL-----------------------------------
Query ---HPSTILEVN-XKGEVLSKTEFE-----------------------------------  115
ident                ||      |                                    
Sbjct efgVVGRLFARDpDTGEEIWMRPFVeghmgrlngkdstvtgdvkapswpddrnsptgkve  238
DSSP  hhlLLLEEEEELlLLLLEEEEEELLllleeeelleeeeellllllllllllllllllllh


DSSP  lllllhhhLLLLLEELL-LLLEEEEELL----------------------llEEEEELL-
Query tgierphaQFRQINKNK-KGNYLVPLFA----------------------tsEVREIAP-  151
ident                        |                                    
Sbjct swshgggaPWQSASFDAeTNTIIVGAGNpgpwntwartakggnphdydslytSGQVGVDp  298
DSSP  hhhhllllLLLLLEEELlLLEEEEEELLlllllhhhhlllllllllllllllLEEEEELl


DSSP  ---LLLEEEEE-------------------------------ELLL--------------
Query ---NGQLLNSV-------------------------------KLSG--------------  163
ident                                                             
Sbjct ssgEVKWFYQHtpndawdfsgnnelvlfdykakdgkivkataHADRngffyvvdrsngkl  358
DSSP  lllLEEEEEELlllllllllllllleeeeeellllleeeeeeEELLlleeeeeellllle


DSSP  --------------------------------------llleeeellllleeeeLLLLlE
Query --------------------------------------tpfssafldngdclvaCGDAhC  185
ident                                                             
Sbjct qnafpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggkNWNP-M  417
DSSP  eeeeellllllleeeelllllleeelllllllllllllllllleeellllllllLLLL-L


DSSP  EEEelllllleEEEEE--------------------------------------------
Query FVQlnlesnriVRRVN--------------------------------------------  201
ident                                                             
Sbjct AYS-----qdtGLFYVpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramd  472
DSSP  EEL-----lllLLEEEeeeleeeeeeellllllllllllleeeeeeelllllleeeeeel


DSSP  ---------------------hhHLLLLLLLeeeeeeellllleeeeeelllLLLH----
Query ---------------------anDIEGVQLFfvaqlfplqngglyicnwqghDREA----  236
ident                            |                                
Sbjct pvsgkvvwehkehlplwagvlatAGNLVFTG---------------------TGDGyfka  511
DSSP  llllleeeeeeelllllllleeeLLLEEEEE---------------------LLLLeeee


DSSP  -----------HHLL----llLEEEEllllleEEEEL-----------------------
Query -----------GKGK----hpQLVEIdsegkvVWQLN-----------------------  258
ident                                                             
Sbjct fdaksgkelwkFQTGsgivspPITWE--qdgeQYLGVtvgyggavplwggdmadltrpva  569
DSSP  eellllleeeeEELLllllllLEEEE--elleEEEEEeellllhhhhhllhhhhhhllll


DSSP  lLLLLlllleeeeell
Query dKVKFgxisticpire  274
ident     |           
Sbjct qGGSF---wvfklpsw  582
DSSP  lLLEE---eeeellll


No 154: Query=mol1A Sbjct=1kb0A Z-score=8.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tgpaaqaaaavqrvdgdfiranaartpdwptigvdyaetrysrldqinaanvkdlglaws   60
DSSP  lhhhhhhhhhhhlllhhhhhhhhhlllllllllllllllleelllllllllhhheeeeee


DSSP  ---------------lLLEEEEELLLllEEEEEELLLLEEEEEEELLLL----------L
Query ---------------sPQHLLVGGSGwnKIAIINKDTKEIVWEYPLEKG----------W   35
ident                      |  |       |   |    | |                
Sbjct ynlestrgveatpvvvDGIMYVSASW-sVVHAIDTRTGNRIWTYDPQIDrstgfkgccdV  119
DSSP  eellllllllllleeeLLEEEEELHH-hLEEEEELLLLEEEEEELLLLLhhhhhhllllL


DSSP  LLLEEEELLlLLEEEELLLE-EEEELL-LLLEEEEEELL----LLLEEEE-EEELlLLLE
Query ECNSVAATKaGEILFSYSKG-AKXITR-DGRELWNIAAP----AGCEXQT-ARILpDGNA   88
ident     ||  | |        |         | | |                  |    |  
Sbjct VNRGVALWK-GKVYVGAWDGrLIALDAaTGKEVWHQNTFegqkGSLTITGaPRVF-KGKV  177
DSSP  LLLLLEEEL-LEEEEELLLLeEEEEELlLLLEEEEEELLllllLLLLLLLlLEEE-LLEE


DSSP  EEEEEL----LLEEEEEEL-LLLLEEEEEEEL-------------------------lll
Query LVAWCG----HPSTILEVN-XKGEVLSKTEFE-------------------------tgi  118
ident      |        |       ||                                    
Sbjct IIGNGGaeygVRGYITAYDaETGERKWRWFSVpgdpskpfedesmkraartwdpsgkwwe  237
DSSP  EELLLLllllLLLEEEEEElLLLLEEEEEELLllllllllllhhhhhhhllllhhhlhhh


DSSP  llhhhLLLLLEELL---LLLEEEEE----------------llllEEEEEL----LLLLE
Query erphaQFRQINKNK---KGNYLVPL----------------fatsEVREIA----PNGQL  155
ident                     |                                       
Sbjct aggggTMWDSMTFDaelNTMYVGTGngspwshkvrspkggdnlylASIVALdpdtGKYKW  297
DSSP  hleelLLLLLEEEElllLEEEEELLleelllhhhhllllllllllLEEEEEllllLLEEE


DSSP  EEEEE-----------------------------LLLL----------------------
Query LNSVK-----------------------------LSGT----------------------  164
ident                                                             
Sbjct HYQETpgdnwdytstqpmiladikiagkprkvilHAPKngfffvldrtngkfisaknfvp  357
DSSP  EEELLllllllllllllleeeeeeelleeeeeeeELLLlleeeeeellllleeeeeelll


DSSP  ---------------------lleeeellllleeeELLLllEEEEelllllleEEEEE--
Query ---------------------pfssafldngdclvACGDahCFVQlnlesnriVRRVN--  201
ident                                                             
Sbjct vnwasgydkhgkpigiaaardgskpqdavpgpygaHNWH-pMSFN-----pqtGLVYLpa  411
DSSP  llleeeellllleeelhhhhllllleellllllllLLLL-lLEEE-----lllLEEEEee


DSSP  -----------------------------------------------HHHL---------
Query -----------------------------------------------ANDI---------  205
ident                                                             
Sbjct qnvpvnlmddkkwefnqagpgkpqsgtgwntakffnaeppkskpfgrLLAWdpvaqkaaw  471
DSSP  eellleeeelllllllllllllllhhhllllleeellllllllleeeEEEEelllleeee


DSSP  ----llllLLEEeeeeellllleeeeeelllLLLHH-------------------hllll
Query ----egvqLFFVaqlfplqngglyicnwqghDREAG-------------------kgkhp  242
ident                                                             
Sbjct svehvspwNGGT--------lttagnvvfqgTADGRlvayhaatgeklxeaptgtgvvaa  523
DSSP  eeeellllLLLE--------eeellleeeeeLLLLEeeeeellllleeeeeellllllll


DSSP  LEEEellllleEEEEL------------------lLLLL---------------------
Query QLVEidsegkvVWQLN------------------dKVKF---------------------  263
ident                                                             
Sbjct PSTY--mvdgrQYVSVavgwggvyglaaraterqgPGTVytfvvggkarmpetgqllqgv  581
DSSP  LEEE--eelleEEEEEeelllhhhhhhllllllllLLEEeeeeellllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct kydpakveagtmlyvancvfchgvpgvdrggnipnlgymdasyienlpnfvfkgpamvrg  641
DSSP  lllhhhhhhhhhhhhhhlhhhhlllllllllllllhhhllhhhhhlhhhhhlllllhhhl


DSSP  ------------------lllleeeeell
Query ------------------gxisticpire  274
ident                              
Sbjct mpdftgklsgddveslkafiqgtadairp  670
DSSP  lllllllllllhhhhhhhhhhhhhhhhll


No 155: Query=mol1A Sbjct=1v0zA Z-score=8.6

back to top
DSSP  --------------------------------------------lLLEEEEEL-------
Query --------------------------------------------sPQHLLVGG-------    9
ident                                                             
Sbjct rtflnltkplcevnswhilskdnairigedahilvtrepylscdpQGCRMFALsqgttlr   60
DSSP  lllllllllllllleeeeeeellhhhhhllllleeeeeeeeeeelLEEEEEEEeeeeell


DSSP  -----------lllLEEEEEELLLLE---EEEEEELlllLLLLeEEEL-LLLLEEEEL--
Query -----------sgwNKIAIINKDTKE---IVWEYPLekgWECNsVAAT-KAGEILFSY--   52
ident                                                             
Sbjct grhangtihdrspfRALISWEMGQAPspyNTRVECI---GWSS-TSCHdGMSRMSICMsg  116
DSSP  lhhhllllllllllLEEEEEELLLLLlllLLEEEEE---LLEE-EEEElLLLEEEEEEel


DSSP  ---lLEEEEELLlLLEEEEEELL-LLLEEEE--eEELLLLLEEEEEEL------LLEEEE
Query ---sKGAKXITRdGRELWNIAAP-AGCEXQT--aRILPDGNALVAWCG------HPSTIL  100
ident       |      ||    |                   |   |              | 
Sbjct pnnnASAVVWYG-GRPITEIPSWaGNILRTQeseCVCHKGVCPVVMTDgpannrAATKII  175
DSSP  lhhhLEEEEEEL-LEEEEEEELLlLLLLLLLlllLLLLLLLEEEEEEEllllllLEEEEE


DSSP  EELLlLLEEEEEEELLLlllhhHLLLLLE--elLLLLEEEEELL-LLEEEEEL-----lL
Query EVNXkGEVLSKTEFETGierphAQFRQIN--knKKGNYLVPLFA-TSEVREIA-----pN  152
ident      |      |                                      |        
Sbjct YFKE-GKIQKIEELAGN---aqHIEECSCygagGVIKCICRDNWkGANRPVITidpemmT  231
DSSP  EEEL-LEEEEEEELLLL---llLLEEEEEeeelLEEEEEEELLLlLLLLEEEEeellllE


DSSP  LLEEEEE---ELLL----------------------LLLEEEELLL-LLEEEE----llL
Query GQLLNSV---KLSG----------------------TPFSSAFLDN-GDCLVA----cgD  182
ident                                          ||||     |         
Sbjct HTSKYLCskvLTDTsrpndptngncdapitggspdpGVKGFAFLDGeNSWLGRtiskdsR  291
DSSP  EEEEELLlllLLLLllllllllllllllllllllllLLLLLEELLLlLLEEEEllllllL


DSSP  LLEeeEELLLLL----LEEE--EEEHHhllllLLLEeEEEEEL--------LLLLEEEEE
Query AHCfvQLNLESN----RIVR--RVNANdiegvQLFFvAQLFPL--------QNGGLYICN  228
ident                        |  |                         |   |   
Sbjct SGYemLKVPNAEtdiqSGPIsnQVIVN---nqNWSG-YSGAFIdywankecFNPCFYVEL  347
DSSP  EEEeeEELLLLLllllLLLLeeEEEEE---eeEELL-LEEEEEllllllllLLEEEEEEE


DSSP  EllLLLLHHH---lllLLEEEELLLlleeeeelllllllllleeeeell
Query WqgHDREAGK---gkhPQLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident      |             |                             
Sbjct I--RGRPKESsvlwtsNSIVALCGS-----kkrlgswswhdgaeiiyfe  389
DSSP  E--EELLLLLlllleeEEEEEEEEE-----llllllllllllllhhhhl


No 156: Query=mol1A Sbjct=1yifA Z-score=8.6

back to top
DSSP  --------------------LLLEEEEELLLLL-EEEEEELL---LLEEEEEEE-----L
Query --------------------SPQHLLVGGSGWN-KIAIINKD---TKEIVWEYP-----L   31
ident                           |    |     |           |         |
Sbjct kitnpvlkgfnpdpsicragEDYYIAVSTFEWFpGVQIHHSKdlvNWHLVAHPLqrvsqL   60
DSSP  leellllllllllleeeeelLEEEEEELLLLEElLLEEEEELlllLEEEEELLLlllllL


DSSP  LLL-----LLLLEE-EELL-LLLEE-EELLL----------eEEEELL---LLLEEEEEe
Query EKG-----WECNSV-AATK-AGEIL-FSYSK----------gAKXITR---DGRELWNIa   70
ident                         |     |                             
Sbjct DMKgnpnsGGVWAPcLSYSdGKFWLiYTDVKvvdgawkdchnYLVTCEtinGDWSEPIK-  119
DSSP  LLLlllllLLLLLLeEEEElLEEEEeEEEELlllllllleeeEEEEELlllLLLLLLEE-


DSSP  llllleeeeeeellllleeEEEEllleeeeeellllleeeeeeellllllhhhlLLLLEE
Query apagcexqtarilpdgnalVAWCghpstilevnxkgevlsktefetgierphaqFRQINK  130
ident                                                             
Sbjct -------------------LNSS-------------------------------GFDASL  129
DSSP  -------------------LLLL-------------------------------LLLLEE


DSSP  ----llLLLEEEEEL-------LLLEEEEE-------lLLLLEEEEEEL--LLLLLEEEE
Query ----nkKGNYLVPLF-------ATSEVREI-------aPNGQLLNSVKL--SGTPFSSAF  170
ident       |   |  |                          |                   
Sbjct fhdtdgKKYLLNMLWdhridrhSFGGIVIQeysdkeqkLIGKPKVIFEGtdRKLTEAPHL  189
DSSP  eellllLEEEEEEEElllllllLEEEEEEEeeelllleELLLLEEEELLllLLLLEEEEE


DSSP  LLL---LLEEEELLL---LLEEEEELLL----LLLEE--EEEEHH---hlLLLLLleeeE
Query LDN---GDCLVACGD---AHCFVQLNLE----SNRIV--RRVNAN---diEGVQLffvaQ  215
ident          | | |     |                                 |      
Sbjct YHIgnyYYLLTAEGGtryEHAATIARSAniegPYEVHpdNPILTSwhdpgNPLQK--cgH  247
DSSP  EEElleEEEEEEELLlllLLEEEEEEELllllLLEELllLLLEELlllllLLLEE--eeE


DSSP  EEELL----LLLEEEEE----------ellllLLHHhlLLLLEEEELLL-----------
Query LFPLQ----NGGLYICN----------wqghdREAGkgKHPQLVEIDSE-----------  250
ident     |       |                                               
Sbjct ASIVQthtdEWYLAHLTgrpihpdddsifqqrGYCP--LGRETAIQKLYwkdewpyvvgg  305
DSSP  EEEEEllllLEEEEEEEellllllllllllllLLLL--LLLEEEEEEEEeelleeeelll


DSSP  --LLEEE-----------------------------------------------------
Query --GKVVW-----------------------------------------------------  255
ident   |                                                         
Sbjct keGSLEVdapsipetifeatypevdefedstlninfqtlripftnelgsltqapnhlrlf  365
DSSP  llLLLEElllllllllllllllleelllllllllllleelllllllleellllllleeee


DSSP  ------------eelLLLL-----------------------------------------
Query ------------qlnDKVK-----------------------------------------  262
ident                                                             
Sbjct ghesltstftqafvaRRWQslhfeaetavefypenfqqaaglvnyyntenwtalqvthde  425
DSSP  llllllllllleeeeEELLlleeeeeeeeellllllleeeeeeeeeelleeeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct elgrilelticdnfsfsqplnnkiviprevkyvylrvniekdkyyyfysfnkedwhkidi  485
DSSP  lleeeeeeeeeelleeelllllleellllllleeeeeeeelleeeeeeelllllleeeee


DSSP  -----------------------------------llllleeeeell
Query -----------------------------------fgxisticpire  274
ident                                                
Sbjct aleskklsddyirgggfftgafvgmqcqdtggnhipadfryfrykek  532
DSSP  eeehhhhlllllllllllllleeeeeeeelllllleeeeeeeeeeel


No 157: Query=mol1A Sbjct=1y4wA Z-score=8.5

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct -------------------------------------------------------fnydq    5
DSSP  -------------------------------------------------------lllll


DSSP  llllEEEE-EELLllLEEEEE-EELLL-LLEEEEEEL-------LLEEEEEELL---LLL
Query rdgrELWN-IAAPagCEXQTA-RILPD-GNALVAWCG-------HPSTILEVNX---KGE  107
ident                                |              |            |
Sbjct pyrgQYHFsPQKN--WMNDPNgLLYHNgTYHLFFQYNpggiewgNISWGHAISEdltHWE   63
DSSP  llllLLLLlLLLE--EEEEEEeEEEELlEEEEEEEELlllllllLLEEEEEEELlllLLE


DSSP  EEEEEEELLL----LLLHhhLLLLlEELLL--------------LLEEEEE---------
Query VLSKTEFETG----IERPhaQFRQiNKNKK--------------GNYLVPL---------  140
ident          |           |                                      
Sbjct EKPVALLARGfgsdVTEM--YFSG-SAVADvnntsgfgkdgktpLVAMYTSyypvaqtlp  120
DSSP  EEEEEELLLLllllLLLE--EEEE-EEEELllllllllllllllEEEEEEEeellleell


DSSP  ------llLLEEEEELL-----LLLEE----EEEELL---------LLLLEEEELL----
Query ------faTSEVREIAP-----NGQLL----NSVKLS---------GTPFSSAFLD----  172
ident                                                      |      
Sbjct sgqtvqedQQSQSIAYSlddglTWTTYdaanPVIPNPpspyeaeyqNFRDPFVFWHdesq  180
DSSP  llleelllEEEEEEEEElllllLLEELllllLLLLLLllllhhhllLEEEEEEEEEllll


DSSP  LLLEEEELLLLLEEEEELLL---LLLEEEEEEHHhlllLLLL-EEEE-EEELL-------
Query NGDCLVACGDAHCFVQLNLE---SNRIVRRVNANdiegVQLF-FVAQ-LFPLQ-------  220
ident            |               |                                
Sbjct KWVVVTSIAELHKLAIYTSDnlkDWKLVSEFGPY----NAQGgVWECpGLVKLpldsgns  236
DSSP  EEEEEEEEHHHLEEEEEEELlllLLEEEEEELLL----LLLLlEEEEeEEEEEellllll


DSSP  LLLEEEEEELLLlllHHHL-lllLEEEELL------LLLEEE---------EELLLllLL
Query NGGLYICNWQGHdreAGKG-khpQLVEIDS------EGKVVW---------QLNDKvkFG  264
ident                                                             
Sbjct TKWVITSGLNPG--gPPGTvgsgTQYFVGEfdgttfTPDADTvypgnstanWMDWG--PD  292
DSSP  EEEEEEEEEELL--lLLLLllleEEEEEEEelllleEELLLLlllllllleELLLL--LL


DSSP  LLLEEE------------------------------------EELL--------------
Query XISTIC------------------------------------PIRE--------------  274
ident                                                             
Sbjct FYAAAGynglslndhvhigwmnnwqyganiptypwrsamaipRHMAlktigskatlvqqp  352
DSSP  LEEEEElllllhhhleeeeellllllhhhllllleellllllEEEEeeeelleeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct qeawssisnkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanf  412
DSSP  lllhhhllllllleeeeeeeelleellleelllleeeeeeeelllllleeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct teqtlvgydfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvev  472
DSSP  llleeeeeelllleeeeellllllllllllllleeeeellllllleeeeeeeeelleeee


DSSP  ---------------------------------------------
Query ---------------------------------------------  274
ident                                              
Sbjct fggqgettltaqifpssdavharlastggttedvradiykiastw  517
DSSP  eelllleeeeeelllllllleeeeeeellleeeeeeeeeelllll


No 158: Query=mol1A Sbjct=2d0vA Z-score=8.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ndklielsnsnenwvmpgknydsnnyststqinvdnvkqlkhawsfstgelhghegaplv   60
DSSP  lhhhhhhhllllllllllllllllleelllllllllhhheeeeeeeelllllllllllee


DSSP  lLLEEEEELLLlLEEEEEELLLL-EEEEEEELLLL----------lLLLEEEELLL----
Query sPQHLLVGGSGwNKIAIINKDTK-EIVWEYPLEKG----------wECNSVAATKA----   45
ident       |  |  ||           | |                       |        
Sbjct iGDVMYVHSSFpNKTFALDLNDPgHILWQHSPKQDpaarsvaccdlVNRGLAYWPGddkt  120
DSSP  eLLEEEEELLLlLLEEEEELLEEeEEEEEELLLLLhhhhhhlllllLLLLLEEELLllll


DSSP  -LLEEEELL-LEEEEELL-LLLEEEEE-ELLL--LLEE-EEEEELlLLLEEEEEEL----
Query -GEILFSYS-KGAKXITR-DGRELWNI-AAPA--GCEX-QTARILpDGNALVAWCG----   94
ident    |                | | |         |    |         | |   |    
Sbjct pSLIIKTQLdGHLVALNAkTGEEFWKVeNGDIkvGQTLtQAPYVV-HDLAIVGSSGaelg  179
DSSP  lLEEEEELLlLEEEEEELlLLLEEEEEeLLLHhhLLLLlLLLEEE-LLEEEELLLLhhhl


DSSP  LLEEEEEELL-LLLEEEEEEEL---------------------------------lLLLL
Query HPSTILEVNX-KGEVLSKTEFE---------------------------------tGIER  120
ident         |   ||                                           |  
Sbjct VRGHVTAYNVrTGEQAWRYYATgpdaeigladdfnsanphygqkglgtatwegdawKIGG  239
DSSP  LLLEEEEEELlLLLEEEEEELLllhhhhllllllllllhhhllllhhhhlllhhhhHHLL


DSSP  hhhLLLLLEELL-LLLEEEEELL--------------lleeEEEL----LLLLEEEE---
Query phaQFRQINKNK-KGNYLVPLFA--------------tsevREIA----PNGQLLNS---  158
ident                                                             
Sbjct -gtNWGWYAYDPaANLIYYGSGNpapwnetmrpgdnkwtmtITARdadtGKMKFGYQktp  298
DSSP  -llLLLLLEEELlLLEEEEELLLlllllhhhllllllllleEEEEelllLLEEEEEElll


DSSP  -----------------------------EELL---------------------------
Query -----------------------------VKLS---------------------------  162
ident                                                             
Sbjct hdewdfagvnvimlseqtdktgkkrklltHPDRngivytldrengdlisadklddtvnvf  358
DSSP  lllllllllllleeeeeellllleeeeeeEELLlleeeeeellllleeeeeellllllle


DSSP  ----------------------------------LLLLeeeellllleeeelllllEEEE
Query ----------------------------------GTPFssafldngdclvacgdahCFVQ  188
ident                                                             
Sbjct ktvdlktglpvrdpeygtrmdhkgtdicpsamgyHNQG-----------------hDSYD  401
DSSP  eeelllllleeelhhhllllllleeeelllllllLLLL-----------------lLEEE


DSSP  elllllleEEEEE-----------------------------------------------
Query lnlesnriVRRVN-----------------------------------------------  201
ident                                                             
Sbjct -----pqkQLFFMginhicmdwepfmlpyragqffvgatlwmypgpkgdrqnylglgqik  456
DSSP  -----lllLEEEEeeeleeeeeeellllllllllllleeeeeeelllllllllllleeee


DSSP  ------------------------hhHLLLLLLLeeeeeeellllleeeeeellLLLLH-
Query ------------------------anDIEGVQLFfvaqlfplqngglyicnwqgHDREA-  236
ident                               |                             
Sbjct aynaitneykwqhmerfsvwggtlatAGNLVFYG--------------------TLDGFl  496
DSSP  eelllllleeeeeeelllllllleeeLLLEEEEE--------------------LLLLEe


DSSP  -------------HHLL----llLEEEEllllleEEEE----------------------
Query -------------GKGK----hpQLVEIdsegkvVWQL----------------------  257
ident               |                                             
Sbjct karnsdtgelvwkHKLPsgvigyPMTYE--hkgvQYIAvmsgvggwpgvglvfdlqdpta  554
DSSP  eeeellllleeeeEELLllllllLEEEE--elleEEEEeeellllhhhhhhhhlllllll


DSSP  ---------------llLLLL-----------lllleeeeell
Query ---------------ndKVKF-----------gxisticpire  274
ident                                            
Sbjct glgavgafknlqnytqmGGSLevfsldgknpyddvnvgeyekg  597
DSSP  hhhhhhhlllhhhllllLLEEeeeeellllhhhllllllllll


No 159: Query=mol1A Sbjct=1a4gA Z-score=8.3

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct -----------------------------------------------epewtyprlscqg   13
DSSP  -----------------------------------------------lllllllllllll


DSSP  LLLLEEEEEE-----------lLLLLEEEEEEELLLlLEEEEEELLL-------------
Query RDGRELWNIA-----------aPAGCEXQTARILPDgNALVAWCGHP-------------   96
ident         |             |           |          |              
Sbjct STFQKALLISphrfgeargnsaPLIIREPFIACGPK-ECKHFALTHYaaqpggyyngtre   72
DSSP  LLEEEEEEELhhhhllllllllLEEEEEEEEEELLL-LEEEEEEEEEeelllllllllll


DSSP  -------EEEEEEllllLEEE----EEEELLllllhhHLLLLLEELLLlLEEEEELL---
Query -------STILEVnxkgEVLS----KTEFETgierphAQFRQINKNKKgNYLVPLFA---  142
ident                                      |                      
Sbjct drnklrhLISVKL----GKIPtvenSIFHMA------AWSGSACHDGR-EWTYIGVDgpd  121
DSSP  lllllleEEEEEL----LLLLllllLEEEEE------LLLEEEEELLL-LEEEEEEElll


DSSP  ---LLEEEEElllllEEEEEELL------LLLL--eEEELlLLLEEEELLL-------lL
Query ---TSEVREIapngqLLNSVKLS------GTPF--sSAFLdNGDCLVACGD-------aH  184
ident                                           |||     |         
Sbjct snaLIKIKYG-----EAYTDTYHsyanniLRTQesaCNCI-GGDCYLMITDgsasgiskC  175
DSSP  lllEEEEEEL-----LEEEEEEEllllllLEELlllLEEE-LLEEEEEEELllllllllL


DSSP  EEEEELLllLLEEEEEEhhhLLLLL-LLEEEEEEELLLLLEEEEEELLllLLHHhlllLL
Query CFVQLNLesNRIVRRVNandIEGVQ-LFFVAQLFPLQNGGLYICNWQGhdREAGkgkhPQ  243
ident  |        ||          |              |                      
Sbjct RFLKIRE--GRIIKEIF---PTGRVeHTEECTCGFASNKTIECACRDN--SYTA----KR  224
DSSP  EEEEEEL--LEEEEEEL---LEELLlLLEEEEEEELLLLEEEEEEELL--LLLL----LL


DSSP  EEEELL----LLLEeEEELLlLLLLL------------------------LLEEEEELL-
Query LVEIDS----EGKVvWQLNDkVKFGX------------------------ISTICPIRE-  274
ident                                                          |  
Sbjct PFVKLNvetdTAEI-RLMCT-ETYLDtprpddgsitgpcesngdkgrggiKGGFVHQRMa  282
DSSP  EEEEEEllllEEEE-EELLL-LLLLLllllllllllllllllllllllllLLLEEEEELl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct skigrwysrtmsktermgmelyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdk  342
DSSP  lleeeeeeellllllleeeeeeeeellllllllllleeeeeeeeeeeellleeeeeeell


DSSP  ------------------------------------------------
Query ------------------------------------------------  274
ident                                                 
Sbjct kcdvpcigiemvhdggkktwhsaataiyclmgsgqllwdtvtgvdmal  390
DSSP  lleeeeeeeeeeelllllllleeeeeeeeellllllllllllllllll


No 160: Query=mol1A Sbjct=3kstA Z-score=8.3

back to top
DSSP  ----------------llLEEEEELLLLL------EEEEEELllLEEEEEE-ELLL----
Query ----------------spQHLLVGGSGWN------KIAIINKdtKEIVWEY-PLEK----   33
ident                         | |                 |    |   |      
Sbjct svetnylpiadpyvxfynNKYYAYGTGGTtagegfACFSSDD-lKNWKREGqALSAtdsy   59
DSSP  leeellllleeeeeeeelLEEEEEEELLLlllleeEEEEELL-lLEEEEEEeEEEHhhll


DSSP  --LLLL-LEEEELL-lLLEEEE-----llleEEEELlllleeeEEELLLlleeeeeeell
Query --GWEC-NSVAATK-aGEILFS-----yskgAKXITrdgrelwNIAAPAgcexqtarilp   84
ident          |                     |   |                        
Sbjct gtWGFWaPEVYYVEskKKFYLFysaeehicvATSTT--pegpfRQEVKQ-----------  106
DSSP  llLLLEeEEEEEELllLEEEEEeeelleeeeEEELL--lllllLLLLLL-----------


DSSP  llleeeeEELLLeeeeeellllleeeeeeellllllhhHLLLLLEELL--LLLEEEEELL
Query dgnalvaWCGHPstilevnxkgevlsktefetgierphAQFRQINKNK--KGNYLVPLFA  142
ident                                                      ||     
Sbjct -------PIWSE--------------------------KSIDTSLFIDddGTPYLYFVRF  133
DSSP  -------LLLLL--------------------------LLEEEEEEELllLLEEEEEEEE


DSSP  L--LEEEEELL-------LLLEEEEEELL----------LLLLEEEELL-LLLEEEELLL
Query T--SEVREIAP-------NGQLLNSVKLS----------GTPFSSAFLD-NGDCLVACGD  182
ident |                     ||                    |         |     
Sbjct TdgNVIWVAQXtddlxsiKTETLNQCIKAevswellqgkVAEGPSLLKKnGVYYLIYSAN  193
DSSP  LllEEEEEEELlllllllLHHHLEEEELLllhhhlllllLEEEEEEEEElLEEEEEEEEL


DSSP  L-----LEEEEELLL----LLLEE--EEEEH-hhllLLLLLeEEEEEELL--LLLEEEEE
Query A-----HCFVQLNLE----SNRIV--RRVNA-ndieGVQLFfVAQLFPLQ--NGGLYICN  228
ident                                     |                   ||  
Sbjct HyenkgYGVGYATSDtpxgPWVKYskNPLLQgdaatGLVGT-GHGAPFQCkdGSWKYIFH  252
DSSP  LlllllLEEEEEEELllllLLEELllLLLLLlllllLLLLL-EEEEEEELllLLEEEEEE


DSSP  ELlllLLHHhlllLLEEEELL-------lLLEEEEELLlllllllleeeeell
Query WQghdREAGkgkhPQLVEIDS-------eGKVVWQLNDkvkfgxisticpire  274
ident       |                                              
Sbjct AHwsaAEIQ--prTSYIKDFAisdqgvvtISGTVIKPR------------vlk  291
DSSP  ELlllLLLL--llEEEEEEEEellllleeEEEEEELLE------------eel


No 161: Query=mol1A Sbjct=1ingA Z-score=8.2

back to top
DSSP  --------------------------------------------llLEEEEElLLLL---
Query --------------------------------------------spQHLLVGgSGWN---   13
ident                                                       |     
Sbjct veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvKCYQFA-LGQGttl   59
DSSP  lllllllllllllleeeeeeellhhhhhlllllllllleeeeelllLEEEEE-ELLLlll


DSSP  ----------------EEEEEELLLLE--eEEEEELlllLLLLeEEEL-LLLLEEEEL--
Query ----------------KIAIINKDTKE--iVWEYPLekgWECNsVAAT-KAGEILFSY--   52
ident                                                             
Sbjct dnkhsndtvhdriphrTLLMNELGVPFhlgTRQVCI---AWSS-SSCHdGKAWLHVCItg  115
DSSP  llhhhlllllllllllEEEEEELLLLLlllLEEEEE---LLLE-EEEElLLLEEEEEEee


DSSP  ---lLEEEEELLlLLEEEEEELL-LLLEEEE--eEELLLLLEEEEEEL------LLEEEE
Query ---sKGAKXITRdGRELWNIAAP-AGCEXQT--aRILPDGNALVAWCG------HPSTIL  100
ident       |  |   ||    |                   |   |              ||
Sbjct ddknATASFIYD-GRLVDSIGSWsQNILRTQeseCVCINGTCTVVMTDgsasgrADTRIL  174
DSSP  llllEEEEEEEL-LEEEEEEELLlLLLLLLLlllLEEELLEEEEEEEEllllllLEEEEE


DSSP  EELL-LLLEeEEEEEllllllhhHLLLLlEELL--llLEEEEELL-LLEEEEEL-----l
Query EVNX-KGEVlSKTEFetgierphAQFRQiNKNK--kgNYLVPLFA-TSEVREIA-----p  151
ident      |                                         |            
Sbjct FIEEgKIVH-ISPLA----gsaqHVEECsCYPRypgvRCICRDNWkGSNRPVVDinmedy  229
DSSP  EELLlLEEE-EEELL----llllLLLLLeEEEElleeEEELLLLLlLLLLEEEEeellll


DSSP  LLLEEEE---eELLL----------------------LLLEEEELLL-LLEEEE------
Query NGQLLNS---vKLSG----------------------TPFSSAFLDN-GDCLVA------  179
ident                                           ||                
Sbjct SIDSSYVcsglVGDTprnddrssnsncrdpnnergtqGVKGWAFDNGnDLWMGRtiskdl  289
DSSP  LEEEEELllllLLLLllllllllllllllllllllllLLLLEEEEELlEEEEEEllllll


DSSP  -llllleeeeeLLLLL-LEEE---EEEHHhllllLLLEEEEEEELLL----LLEEEEEEL
Query -cgdahcfvqlNLESN-RIVR---RVNANdiegvQLFFVAQLFPLQN----GGLYICNWQ  230
ident                          |                |                 
Sbjct rsgyetfkvigGWSTPnSKSQinrQVIVD---sdNRSGYSGIFSVEGksciNRCFYVELI  346
DSSP  leeeeeeeellLLLLLlLLLEeeeEEEEE---eeEELLLEEEEEEELllleEEEEEEEEE


DSSP  lLLLLHHH----lllLLEEEELLLlleeeeelllllllllleeeeell
Query gHDREAGK----gkhPQLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident    |              |                             
Sbjct -RGRKQETrvwwtsnSIVVFCGTS-----gtygtgswpdganinfmpi  388
DSSP  -EELLLLLlllleeeEEEEEEEEL-----lllllllllllllllllll


No 162: Query=mol1A Sbjct=2exhA Z-score=8.2

back to top
DSSP  --------------------LLLEEEEELLLLL-EEEEEELL---LLEEEEEEE-----L
Query --------------------SPQHLLVGGSGWN-KIAIINKD---TKEIVWEYP-----L   31
ident                           |    |     |           |         |
Sbjct kiknpiltgfhpdpsicrvgDDYYIAVSTFEWFpGVRIYHSKdlkNWRLVARPLnrlsqL   60
DSSP  leellllllllllleeeeelLEEEEEELLLLEElLLEEEEELlllLLEEEELLLlllllL


DSSP  LLL-----LLLLEE-EELL-LLLEE-EELLL----------eEEEELL---LLLEEEEEe
Query EKG-----WECNSV-AATK-AGEIL-FSYSK----------gAKXITR---DGRELWNIa   70
ident                         |     |                             
Sbjct NMIgnpdsGGVWAPhLSYSdGKFWLiYTDVKvvegqwkdghnYLVTCDtidGAWSDPIY-  119
DSSP  LLLlllllLLLLLLeEEEElLEEEEeEEEELlllllllleeeEEEEELlllLLLLLLEE-


DSSP  llllleeeeeeellllleeEEEEllleeeeeellllleeeeeeellllllhhhlLLLLEE
Query apagcexqtarilpdgnalVAWCghpstilevnxkgevlsktefetgierphaqFRQINK  130
ident                                                             
Sbjct -------------------LNSS-------------------------------GFDPSL  129
DSSP  -------------------LLLL-------------------------------LLLLEE


DSSP  LLL----LLEEEEEL-------LLLEEEEEL-------LLLLEEEEEEL--LLLLLEEEE
Query NKK----GNYLVPLF-------ATSEVREIA-------PNGQLLNSVKL--SGTPFSSAF  170
ident                                         |      |            
Sbjct FHDedgrKYLVNMYWdhrvdhhPFYGIVLQEysveqkkLVGEPKIIFKGtdLRITEGPHL  189
DSSP  EELllllEEEEEEEElllllllLEEEEEEEEeelllleEEEEEEEEELLllLLLLEEEEE


DSSP  LLL---LLEEEEL---lllLEEEEELLL----LLLEE---eEEEHH--hlLLLLLleeeE
Query LDN---GDCLVAC---gdaHCFVQLNLE----SNRIV---rRVNAN--diEGVQLffvaQ  215
ident          | |       |                                 |      
Sbjct YKIngyYYLLTAEggtrynHAATIARSTslygPYEVHpdnpLLTSWpyprNPLQK--agH  247
DSSP  EEElleEEEEEEEllllllLEEEEEEELllllLLEELllllLEELLllllLLLEE--eeE


DSSP  EEELL----LLLEEEEEellllllHHHL--------------LLLLEEEELLL-------
Query LFPLQ----NGGLYICNwqghdreAGKG--------------KHPQLVEIDSE-------  250
ident             |                                       |       
Sbjct ASIVHthtdEWFLVHLT------gRPLPregqpllehrgycpLGRETAIQRLEwkdgwpy  301
DSSP  EEEEEllllLEEEEEEE------eLLLLllllllllllllllLLEEEEEEEEEellllee


DSSP  ------LLEE--------------------------------------------------
Query ------GKVV--------------------------------------------------  254
ident                                                             
Sbjct vvggngPSLEidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpgh  361
DSSP  elllllLLLEelllllllllllllllleelllllllllllleelllllllleelllllll


DSSP  ---------------eeelLLLL-------------------------------------
Query ---------------wqlnDKVK-------------------------------------  262
ident                                                             
Sbjct lrlygresltsrftqafvaRRWQhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlqi  421
DSSP  eeeellllllllllleeeeEELLlleeeeeeeeeelllllleeeeeeeeeelleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct twheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmnw  481
DSSP  eeellleeeeeeeeeelleeellllllleellllllleeeeeeeelleeeeeeellllle


DSSP  ----------------------------------------llllleeeeell
Query ----------------------------------------fgxisticpire  274
ident                                                     
Sbjct idlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel  533
DSSP  eelllleehhhhlhhhlllllllllleeeeeeeelllllleeeeeeeeeeel


No 163: Query=mol1A Sbjct=1ncaN Z-score=8.1

back to top
DSSP  ---------------------------------------------llLEEEEEL------
Query ---------------------------------------------spQHLLVGG------    9
ident                                                             
Sbjct irdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdECRFYALsqgtti   60
DSSP  llllllllllllllleeeeeeellhhhhlllllleeeeeeeeeelllLEEEEEEeeeeel


DSSP  ------------llllEEEEEELLLLE---EEEEEELLllllllEEEEL-LLLLEEEEL-
Query ------------sgwnKIAIINKDTKE---IVWEYPLEkgwecnSVAAT-KAGEILFSY-   52
ident                                             |               
Sbjct rgkhsngtihdrsqyrALISWPLSSPPtvyNSRVECIG----wsSTSCHdGKTRMSICIs  116
DSSP  llhhhlllllllllllEEEEEELLLLLlllLLEEEEEL----leEEEEElLLLEEEEEEe


DSSP  -----lLEEEEELllLLEEEEEELL-LLLEEEE--eEELLLLLEEEEEEL------LLEE
Query -----sKGAKXITrdGRELWNIAAP-AGCEXQT--aRILPDGNALVAWCG------HPST   98
ident                 |    |                   |   |              
Sbjct gpnnnaSAVIWYN--RRPVTEINTWaRNILRTQeseCVCHNGVCPVVFTDgsatgpAETR  174
DSSP  llllllEEEEEEL--LEEEEEEELLlLLLLEELlllLLLLLLEEEEEEEEelllllEEEE


DSSP  EEEELLlLLEEEEEEE--LLLLllhhhLLLLLE-elLLLLEEEEELL--LLEEEEE----
Query ILEVNXkGEVLSKTEF--ETGIerphaQFRQIN-knKKGNYLVPLFA--TSEVREI----  149
ident |      |  |                                       |    |    
Sbjct IYYFKE-GKILKWEPLagTAKH-----IEECSCygeRAEITCTCRDNwqGSNRPVIridp  228
DSSP  EEEEEL-LEEEEEEELllLLLL-----LLLLEEeeeLLEEEEELLLLllLLLLEEEeeel


DSSP  -llLLLEeEEEE---LLLL-----------------------lLEEEELlLLLEEEEL--
Query -apNGQLlNSVK---LSGT-----------------------pFSSAFLdNGDCLVAC--  180
ident                |                             |              
Sbjct vamTHTS-QYICspvLTDNprpndptvgkcndpypgnnnngvkGFSYLD-GVNTWLGRti  286
DSSP  lllEEEE-EELLlllLLLLllllllllllllllllllllllllLLEELL-HHHLEEEEll


DSSP  ----lllLEEEEELL---LLLLEE-EEEEHhhllllLLLEEEEEEEL-----lLLLEEEE
Query ----gdaHCFVQLNL---ESNRIV-RRVNAndiegvQLFFVAQLFPL-----qNGGLYIC  227
ident                                             |               
Sbjct siasrsgYEMLKVPNaltDDKSKPtQGQTI--vlntDWSGYSGSFMDywaegeCYRACFY  344
DSSP  llllleeEEEEELLLlllLLLLLLlEEEEE--eeeeEELLLEEEEELllllllLLLEEEE


DSSP  EELLlLLLHHH-----lllLLEEEELLLlleeeeelllllllllleeeeell
Query NWQGhDREAGK-----gkhPQLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident                           |                         
Sbjct VELI-RGRPKEdkvwwtsnSIVSMCSST------eflgqwdwpdgakieyfl  389
DSSP  EEEE-EELLLLllllleeeEEEEEEEEL------lllllllllllllhhhhl


No 164: Query=mol1A Sbjct=1xksA Z-score=8.1

back to top
DSSP  ------lLLEE-----------eeellllLEEEeeelllleeeeeeelllllllleEEEL
Query ------sPQHL-----------lvggsgwNKIAiinkdtkeivweyplekgwecnsVAAT   43
ident                                                             
Sbjct esvnydvKTFGsslpvkvmealtlaevddQLTI-----------------------NIDE   37
DSSP  lllleeeEELLllllhhhhhhhhhlllllLEEE-----------------------EELL


DSSP  LLL--------------------------------leeeelllEEEEEL-lLLLEEEEEE
Query KAG--------------------------------eilfsyskGAKXIT-rDGRELWNIA   70
ident                                                            |
Sbjct GGWaclvckekliiwkialspitklsvckelqlppsdfhwsadLVALSYssTQAVAVMVA   97
DSSP  LLEeeeeelleeeeeellllllhhhlleeeeelllllllllhhHEEEEEllLLLEEEEEE


DSSP  LLL---------------------LLEEEEEeelllllEEEEEELllEEEEEEL-lllLE
Query APA---------------------GCEXQTArilpdgnALVAWCGhpSTILEVN-xkgEV  108
ident                                                  |          
Sbjct TREgsirywpslagedtyteafvdKTYSFLT--avqggSFILSSSgsQLIRLIPessgKI  155
DSSP  LLLleeeeellllllllleeeellLLEEEEE--eelllEEEEEELllLEEEEEEllllLE


DSSP  EEEeEELLLLLlhhHLLLLLEEL-LLLLEEEEELllLEEEEELL---LLLEEEEEELL--
Query LSKtEFETGIErphAQFRQINKN-KKGNYLVPLFatSEVREIAP---NGQLLNSVKLS--  162
ident                                     |                |      
Sbjct HQHiLPQGQGM-sdLTLSSVLWDrERSSFYSLTS--SNISKWELddsSEKHAYSWDINra  212
DSSP  EEEeLLLLLLL-llLLEEEEEEElLLLEEEEEEL--LEEEEEEElllLEEEEEEEEHHhh


DSSP  ------------------------LLLLEEEELLLlLEEEEL----------llllEEEE
Query ------------------------GTPFSSAFLDNgDCLVAC----------gdahCFVQ  188
ident                                                             
Sbjct lkenitdaiwgsesnyeaikegvnIRYLDLKQNCD-GLVILAaawhsadnpcliyySLIT  271
DSSP  hhhhhhhhhhlllllhhhhhllleEEEEEEEEELL-EEEEEEeeelllllllleeeEEEE


DSSP  ELLL--LLLE-EEEEEhhhLLLLL------lLEEEeEEELL--LLLEEEEEellllllhh
Query LNLE--SNRI-VRRVNandIEGVQ------lFFVAqLFPLQ--NGGLYICNwqghdreag  237
ident            |                        |      |   |  |         
Sbjct IEDNgcQMSDaVTVEV---TQYNPpfqsedlILCQ-LTVPNfsNQTAYLYN---------  318
DSSP  ELLLllLLLLlEEEEE---LLLLLllllhhhLLLE-EELLLllLLEEEEEL---------


DSSP  hlllLLEEEEL------LLLLEeEEELLL-LLLLLLleEEEEL-----------------
Query kgkhPQLVEID------SEGKVvWQLNDK-VKFGXIstICPIR-----------------  273
ident                  |                                          
Sbjct ---eSAVYVCStgtgkfSLPQE-KIVFNAqGDSVLG--AGACGgvpiifsrnsglvsits  372
DSSP  ---lLEEEEEEllllllLLLLE-EEELLHhHLLEEE--EEEELleeeeeellleeeeeee


DSSP  -l
Query -e  274
ident   
Sbjct re  374
DSSP  ll


No 165: Query=mol1A Sbjct=3hxrA Z-score=8.0

back to top
DSSP  ------------------------------------------LLLEEEEEllLLLEEEEE
Query ------------------------------------------SPQHLLVGgsGWNKIAII   18
ident                                           |                 
Sbjct sxaclsridanllqyyekpepnntvdlyvsgseysnclllsnSEYICYHFssRSTLLTFY   60
DSSP  lllleeeeeeelllllllllllleeeelllllleeeeeelllLLEEEEEEllLLLEEEEE


DSSP  ELLLL--eeEEEEELLLLL--LLLEEEELLL---LLEEEEL-lLEEEEELLL--------
Query NKDTK--eiVWEYPLEKGW--ECNSVAATKA---GEILFSY-sKGAKXITRD--------   62
ident               |                                             
Sbjct PLSDAyhgkTINIHLPNASxnQRYTLTIQEVeqqLLVNVILkdGSFLTLQLPlsflfssa  120
DSSP  ELLLLllllEEEEELLLLLllLLLLEEEEELlleEEEEEELllLLEEEEEEEhhhhhlll


DSSP  -----lLEEEEEE-LLLLLEEEEEEELLLLLEEEEEELllEEEEEELlllleEEEEEELL
Query -----gRELWNIA-APAGCEXQTARILPDGNALVAWCGhpSTILEVNxkgevLSKTEFET  116
ident                                  |                    |     
Sbjct ntlngeWFHLQNPyDFTVRVPHFLFYVSPQFSVVFLED-gGLLGLKK-----YLKSLTRF  174
DSSP  llllllLLLLLLLlLLLLLLLLEEEEELLLEEEEELLL-lLEEEELL-----LLLLLLLL


DSSP  L-lllhhHLLLLLEELLLLLEEEEELlLLEEEEELL-LLLEEEEEELL------lllLEE
Query G-ierphAQFRQINKNKKGNYLVPLFaTSEVREIAP-NGQLLNSVKLS------gtpFSS  168
ident                       |                 |                   
Sbjct FsrssdyDSVISCKLFHERYLIVLTQ-NCHLKIWDLtSFTLIQDYDXVsqsdsdpvgEYL  233
DSSP  LllllllLLEEEEEEELLLEEEEEEL-LLLEELLLLlLLLLLLLLLLLlllllllllLLE


DSSP  EELLlLLEEEE-lllllEEEEELLlLLLEeEEEE-----------------------hhh
Query AFLDnGDCLVA-cgdahCFVQLNLeSNRIvRRVN-----------------------and  204
ident                   |              |                          
Sbjct SLYN-NTLVTLlplengLFQXGTT-FQNN-IPTNlsasaiwsivdlvltrplelnveasy  290
DSSP  EEEL-LEEEEEelllllEEEEELL-LLLL-LLLLllllllleeeeeeeelllllllllll


DSSP  lllLLLLeeeeeeellllleeeeeelllllLHHHL-------------------------
Query iegVQLFfvaqlfplqngglyicnwqghdrEAGKG-------------------------  239
ident      |                                                      
Sbjct lnlIVLW----------------------kSGTASklqilnvndesfknyewiesvnksl  328
DSSP  eeeEEEE----------------------eELLEEeeeeeeelhhhhlleeeellllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  239
ident                                                             
Sbjct vdlqsehdldivtkdvergfcnlksrygtqiferaqqilsenkiixahnedeeylanlet  388
DSSP  hhhhhhlllllllllhhhhhhhhhhhllhhhhhhhhhhhhhllllllllllhhhhhhhhh


DSSP  ---------LLLLEEEELlLLLEeEEELlLLLL---------------------------
Query ---------KHPQLVEIDsEGKVvWQLNdKVKF---------------------------  263
ident                                                             
Sbjct ilrdvktafNEASSITLYgDEII-LVNC-FQPYnhslyklnttvenwfynxhseelfkyl  446
DSSP  hhhhhhhhhLLEEEEEEElLLEE-EEEE-LLLLeeeeeeellhhhhhhhllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct rtlngfastlsndvlrsiskkfldiitgelpdsxttvekftdifknclenqfeitnlkil  506
DSSP  hhhhhhhllllhhhhhhhhhhhhhhhhllllllllhhhhhhhhhhhhllllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct fdelnsfdipvvlndlinnqxkpdfisaikfdgftsiisleslhqllsihyritlqvllt  566
DSSP  hhhhllllhhhhhhhhhhlllllllllllllllhhhhhhhhhhhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct fvlfdldteifgqhistlldlhykqflllnlyrqdkcllaevllkdssefsfgvkffnyg  626
DSSP  hhhllllllllhhhhhhhhhhhhhhhhhhhhhhllhhhhhhhhhhhllllllllllllhh


DSSP  -----------------------lllleeeeell
Query -----------------------gxisticpire  274
ident                                   
Sbjct qliayidslnsnvynasitensffxtffrsyiie  660
DSSP  hhhhhhhhhhhhhhllllllllhhhhhhhhhhhl


No 166: Query=mol1A Sbjct=1uv4A Z-score=8.0

back to top
DSSP  -------------------LLLEEEEELLL-LLEEEEEELL---LLEEEEEEE-------
Query -------------------SPQHLLVGGSG-WNKIAIINKD---TKEIVWEYP-------   30
ident                    |    |  |                                
Sbjct afwgasnellhdptmikegSSWYALGTGLTeERGLRVLKSSdakNWTVQKSIFttplsww   60
DSSP  leeeeeeeelllleeeeelLEEEEEEELLLlLLLEEEEEELlllLLEEEEEELllllhhh


DSSP  ---lLLLL-lLLEEEELL---LLLEEEELL------LEEEEELL------LLLEEEE-EE
Query ---lEKGW-eCNSVAATK---AGEILFSYS------KGAKXITR------DGRELWN-IA   70
ident                            | |                            | 
Sbjct snyvPNYGqnQWAPDIQYyngKYWLYYSVSsfgsntSAIGLASStsissgGWKDEGLvIR  120
DSSP  hhllLLLLllLEEEEEEEellEEEEEEEELllllllEEEEEEEEllllllLLEEEEEeEE


DSSP  LLL--LLEEEEEEELL----LLLEEEEEELlLEEEEEEL----LLLLEEEEE-eELLLLL
Query APA--GCEXQTARILP----DGNALVAWCGhPSTILEVN----XKGEVLSKT-eFETGIE  119
ident                                    |        |               
Sbjct STSsnNYNAIDPELTFdkdgNPWLAFGSFW-SGIKLTKLdkstMKPTGSLYSiaARPNNG  179
DSSP  ELLllLLLLLLLEEEEllllLEEEEELLLL-LLEEEEEEllllLLEEEEEEEeeLLLLLL


DSSP  lhhhLLLLLEELL------------------------------LLLEeeeelllleeeee
Query rphaQFRQINKNK------------------------------KGNYlvplfatsevrei  149
ident                                                             
Sbjct ---gALEAPTLTYqngyyylmvsfdkccdgvnstykiaygrskSITG-------------  223
DSSP  ---lLEEEEEEEEelleeeeeeeeelllllllleeeeeeeeelLLLL-------------


DSSP  llllleEEEE---------ELLLllleeeellllleeeellLLLEeeeelllllleeeee
Query apngqlLNSV---------KLSGtpfssafldngdclvacgDAHCfvqlnlesnrivrrv  200
ident                                          |                  
Sbjct -----pYLDKsgksmleggGTIL------------------DSGN---------------  245
DSSP  -----lLLLLllllhhhllLEEE------------------ELLL---------------


DSSP  ehhhllllLLLEEEEEEELLLLLEEEEEellllllHHHLLLLLEEEELLLlleeeeelll
Query nandiegvQLFFVAQLFPLQNGGLYICNwqghdreAGKGKHPQLVEIDSEgkvvwqlndk  260
ident         |              |           |     | |   |            
Sbjct -------dQWKGPGGQDIVNGNILVRHA-----ydANDNGIPKLLINDLN----------  283
DSSP  -------lLEEEEEEEEEELLLEEEEEE-----eeLLLLLEEEEEEEELL----------


DSSP  llllllleeeeell
Query vkfgxisticpire  274
ident               
Sbjct ------wssgwpsy  291
DSSP  ------llllllll


No 167: Query=mol1A Sbjct=1uypA Z-score=7.9

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllEEEEEEL-LLLLEEE-EEEELlLLLEEEEEELL---------LEEEEEELL-LLLE
Query rdgrELWNIAA-PAGCEXQ-TARILpDGNALVAWCGH---------PSTILEVNX-KGEV  108
ident                            |                                
Sbjct -lfkPNYHFFPiTGWMNDPnGLIFW-KGKYHMFYQYNprkpewgniCWGHAVSDDlVHWR   58
DSSP  -lllLLLLLLLlLEEEEEEeEEEEE-LLEEEEEEEEElllllllllEEEEEEELLlLLLE


DSSP  eEEEEELLLLLLhhHLLLLLEELL--LLLEEEEELL--------LLEEEEELL----LLL
Query lSKTEFETGIERphAQFRQINKNK--KGNYLVPLFA--------TSEVREIAP----NGQ  154
ident           |     |      |  |                                 
Sbjct hLPVALYPDDET-hGVFSGSAVEKdgKMFLVYTYYRdpthnkgeKETQCVVMSenglDFV  117
DSSP  eEEEEELLLLLL-eEEEEEEEEEEllEEEEEEEEEEllllllllEEEEEEEEEllllLLE


DSSP  EE---EEEELL------LLLLEEEELLL-LLEEEELLL-----lLEEEEELLL--LLLEE
Query LL---NSVKLS------GTPFSSAFLDN-GDCLVACGD-----aHCFVQLNLE--SNRIV  197
ident                            |     |                          
Sbjct KYdgnPVISKPpeegthAFRDPKVNRSNgEWRMVLGSGkdekigRVLLYTSDDlfHWKYE  177
DSSP  ELlllLLLLLLlllleeEEEEEEEEEELlEEEEEEEEEellleeEEEEEEELLllLEEEE


DSSP  EEEEHhhllllllLEEEEEEELL-LLLEEEEEELLLlllhhhllllLEEEELLL----LL
Query RRVNAndiegvqlFFVAQLFPLQ-NGGLYICNWQGHdreagkgkhpQLVEIDSE----GK  252
ident                              |                 |            
Sbjct GAIFE---dettkEIECPDLVRIgEKDILIYSITST--------nsVLFSMGELkegkLN  226
DSSP  EEEEE---ellllLEEEEEEEEElLEEEEEEEELLL--------leEEEEEEEEelleEE


DSSP  EEEEELlllLLLLLLEEE------------------------------------------
Query VVWQLNdkvKFGXISTIC------------------------------------------  270
ident |                                                           
Sbjct VEKRGLldhGTDFYAAQTffgtdrvvvigwlqswlrtglyptkregwngvmslprelyve  286
DSSP  EEEEEElllLLLLEEEEElllllleeeeeellllllhhhllhhhhleelllllleeeeee


DSSP  ----EELL----------------------------------------------------
Query ----PIRE----------------------------------------------------  274
ident                                                             
Sbjct nnelKVKPvdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevv  346
DSSP  lleeEEEElhhhhhheeeeeeeellleeeellllllleeeeeeeeeeeeeeeelllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct itksrdelivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihp  406
DSSP  eeeelleeeeelllllllllleeeeelllllleeeeeeeelleeeeeellleeeeeelll


DSSP  --------------------------
Query --------------------------  274
ident                           
Sbjct envynilsvksnqvklevfeleniwl  432
DSSP  llllleeeeeeeeeeeeeeeelllll


No 168: Query=mol1A Sbjct=2oajA Z-score=7.9

back to top
DSSP  --------------------------llLEEEEELlLLLEEEEEElLLLEEeEEEELLLL
Query --------------------------spQHLLVGGsGWNKIAIINkDTKEIvWEYPLEKG   34
ident                               |           |             ||  
Sbjct knkifslaetnkygmsskpiaaafdftqNLLAIAT-VTGEVHIYG-QQQVE-VVIKLEDR   57
DSSP  lllleeeeeeeeeelllleeeeeeelllLEEEEEE-LLLEEEEEL-LLLLE-EEEELLLL


DSSP  LLLLEEEELLLLLEEEELL-LEEEEELL-LLLEEEEEELLllLEEEeeEELL-LLLEEEE
Query WECNSVAATKAGEILFSYS-KGAKXITR-DGRELWNIAAPagCEXQtaRILP-DGNALVA   91
ident          |                       |     |                 |  
Sbjct SAIKEMRFVKGIYLVVINAkDTVYVLSLySQKVLTTVFVP--GKITsiDTDAsLDWMLIG  115
DSSP  LLEEEEEEELLLEEEEEELlLEEEEEELlLLLEEEEEELL--LLEEeeELLLlLLEEEEE


DSSP  EEllLEEEEEELL-LLLEE-EEEEELL----llllhhhllllLEELL----LLLEeeeel
Query WCghPSTILEVNX-KGEVL-SKTEFET----gierphaqfrqINKNK----KGNYlvplf  141
ident                      |                    |  |              
Sbjct LQ--NGSMIVYDIdRDQLSsFKLDNLQkssffpaarlspivsIQWNPrdigTVLI-----  168
DSSP  EL--LLLEEEEELlLLEEEeEEELLHHhhhllllllllllleEEEELleeeEEEE-----


DSSP  llleeeEELL-----------------------------llleeEEEE------------
Query atsevrEIAP-----------------------------ngqllNSVK------------  160
ident                                                             
Sbjct -syeyvTLTYslveneikqsfiyelppfapggdfsektnekrtpKVIQslyhpnslhiit  227
DSSP  -ellllEEEEelllleeeeeelllllllllllllllllllllllLEEEeeellllleeee


DSSP  -------------------------------------------lLLLLleEEELLL----
Query -------------------------------------------lSGTPfsSAFLDN----  173
ident                                                             
Sbjct ihednslvfwdansghmimartvfeteinvpqpdyirdsstnaaKISK--VYWMCEnnpe  285
DSSP  eelllleeeeellllleeeeelllllllllllllllllllllllEEEE--EEEEELllll


DSSP  -LLEEEeLLLL------LEEEEEL------------------llllleeeeEEHHhlllL
Query -GDCLVaCGDA------HCFVQLN------------------lesnrivrrVNANdiegV  208
ident     |                                                       
Sbjct yTSLLI-SHKSisrgdnQSLTMIDlgytprysitsyegmknyyanpkqmkiFPLP----T  340
DSSP  eEEEEE-EEELllllllLLEEEEEeeelllhhhllhhhhhhhhhllleeeeELLL----L


DSSP  LLLeEEEEEELL-----------LLLEEEEEELlllllhhhllllLEEEELL-LLLEEE-
Query QLFfVAQLFPLQ-----------NGGLYICNWQghdreagkgkhpQLVEIDS-EGKVVW-  255
ident          |              |                             |     
Sbjct NVP-IVNILPIPrqspyfagchnPGLILLILGN-----------gEIETMLYpSGIFTDk  388
DSSP  LLL-EEEEEELLllllhhhhlllLLEEEEEELL-----------lLEEEEELlLLLEELl


DSSP  ------eELLL-------------------------------------------------
Query ------qLNDK-------------------------------------------------  260
ident        |                                                    
Sbjct aslfpqnLSWLrplattsmaasvpnklwlgalsaaqnkdyllkggvrtkrqklpaeygta  448
DSSP  hhhllhhHLLLllleeeeeeeeeehhhhhhhhhllllllllllllllllllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  260
ident                                                             
Sbjct fitghsngsvriydashgdiqdnasfevnlsrtlnkakelavdkisfaaetlelavsiet  508
DSSP  eeeeellleeeeeellllllllllleeeehhhhlllllllleeeeeeelllleeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  260
ident                                                             
Sbjct gdvvlfkyevnqffrrfslnntngvlvdvrdraptgvrqgfmpstavhankgktsainns  568
DSSP  lleeeeeeeellllllllhhhlllleeelhhhlllllleeeeeeeeelllllleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  260
ident                                                             
Sbjct nigfvgiayaagslmlidrrgpaiiymenireisgaqsacvtciefvimeygddgyssil  628
DSSP  llleeeeeellleeeeeelllleeeeeeehhhlllllllleeeeeeeeeelllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  260
ident                                                             
Sbjct mvcgtdmgevitykilpasggkfdvqlmditnvtskgpihkidafsketkssclatipkm  688
DSSP  eeeeellleeeeeeeeelhhhleeeeeeeeeelllllllleeeeeellllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  260
ident                                                             
Sbjct qnlskglcipgivlitgfddirlitlgksksthkgfkyplaatglsyistveknndrknl  748
DSSP  hhhhhllllleeeeeellleeeeelllllleeeeelllleeeeeeeeeeeellllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  260
ident                                                             
Sbjct tviitleinghlrvftipdfkeqmsehipfpiaakyitessvlrngdiairvsefqaslf  808
DSSP  eeeeeeellleeeeeellllleeeeeellllllhhhhllleellllleeeelllleeeee


DSSP  -----------------------------------------------------lllllll
Query -----------------------------------------------------vkfgxis  267
ident                                                             
Sbjct stvkeqdtlapvsdtlyingiripyrpqvnslqwargtvyctpaqlnellggvnrpasky  868
DSSP  eeelllllllllllllllllllllllllllllllllllllllhhhhhhhhhlllllllll


DSSP  eeeeell
Query ticpire  274
ident        
Sbjct kesiiae  875
DSSP  hhhhhll


No 169: Query=mol1A Sbjct=3c5mB Z-score=7.7

back to top
DSSP  llleeeeellllleeeeeellllEEEEEEE--lLLLLLLL--EEEELLLL-LEEE----e
Query spqhllvggsgwnkiaiinkdtkEIVWEYP--lEKGWECN--SVAATKAG-EILF----s   51
ident                          |                    |  |   ||     
Sbjct ----akgdvitlnfetfvdsdtqVKVTRLTptdIICHRNYfyQKCFTQDGkKLLFagdfd   56
DSSP  ----lllleeelleeeeelllllLEEEELLlllLLEELLLllLLLLLLLLlEEEEeelll


DSSP  llLEEEEELLLLLEEEEEELLLLLEE-EEEEeLLLLLEEEEEELLLEEEEEELllLLEEE
Query ysKGAKXITRDGRELWNIAAPAGCEX-QTARiLPDGNALVAWCGHPSTILEVNxkGEVLS  110
ident                       |           |  |                      
Sbjct gnRNYYLLNLETQQAVQLTEGKGDNTfGGFI-STDERAFFYVKNELNLXKVDL--ETLEE  113
DSSP  llLEEEEEELLLLEEEELLLLLLLLLlLLEE-LLLLLEEEEEELLLEEEEEEL--LLLLE


DSSP  EEEELLLlllhhHLLLLLEELLlLLEEEEELL-----------------------lLEEE
Query KTEFETGierphAQFRQINKNKkGNYLVPLFA-----------------------tSEVR  147
ident                           ||                                
Sbjct QVIYTVD-eewkGYGTWVANSD-CTKLVGIEIlkrdwqpltswekfaefyhtnptcRLIK  171
DSSP  EEEEELL-lleeEEEEEEELLL-LLEEEEEEEehhhllllllhhhhhhhhhlllleEEEE


DSSP  EELLLLlEEEEEE---lLLLLLEEEELllLLEEEeLLLL--------LEEEEELlllLLE
Query EIAPNGqLLNSVK---lSGTPFSSAFLdnGDCLVaCGDA--------HCFVQLNlesNRI  196
ident      |  |                                                   
Sbjct VDIETG-ELEVIHqdtaWLGHPIYRPF-dDSTVG-FCHEgphdlvdaRXWLVNE---DGS  225
DSSP  EELLLL-LEEEEEeellLEEEEEEELL-eEEEEE-EEELllllllllLLEEEEL---LLL


DSSP  EEEEEHHHllllLLLEEeEEEELllLLEEeeeellllLLHH----------------hLL
Query VRRVNANDiegvQLFFVaQLFPLqnGGLYicnwqghdREAG----------------kGK  240
ident   |                  |                                      
Sbjct NVRKIKEHaegeSCTHE-FWIPD-gSAXAyvsyfkgqTDRViykanpetleneevxvxPP  283
DSSP  LLEELLLLllleEEEEE-EELLL-lLLEEeeeeelllLLEEeeeelllllleeeeeelLL


DSSP  LLLEEEellllleEEEELLLL---------------------------------------
Query HPQLVEidsegkvVWQLNDKV---------------------------------------  261
ident    |                                                        
Sbjct CSHLXS--nfdgsLXVGDGCDapvniendpflyvlntkaksaqklckhstswdvldgdrq  341
DSSP  EEEEEE--lllllEEEEEELLllllllllleeeeeellllllleeeelllllllllllll


DSSP  llLLLLeEEEEL-------------------------l
Query kfGXIStICPIR-------------------------e  274
ident                                       
Sbjct itHPHP-SFTPNddgvlftsdfegvpaiyiadvpesyk  378
DSSP  llLLLL-EELLLlleeeeeelllllleeeeeellllll


No 170: Query=mol1A Sbjct=3cu9A Z-score=7.7

back to top
DSSP  -------------------------------lLLEEEEELLLLL-EEEEEELllLEEEEE
Query -------------------------------sPQHLLVGGSGWN-KIAIINKdtKEIVWE   28
ident                                      |   |    |             
Sbjct vhfhpfgnvnfyemdwslkgdlwahdpviakeGSRWYVFHTGSGiQIKTSED-gVHWENM   59
DSSP  llllllllllhhhllllleellllllleeeeeLLEEEEEELEELlEEEEELL-lLEEEEE


DSSP  EEL---------------lLLLLLLEeeellllleeeellleeeeellllleeeeeelll
Query YPL---------------eKGWECNSvaatkageilfsyskgakxitrdgrelwniaapa   73
ident                                                             
Sbjct GWVfpslpdwykqyvpekdEDHLWAP----------------------------------   85
DSSP  EELlllllllhhhhlllllLLEEEEE----------------------------------


DSSP  lleeeEEEELlLLLEEEEEE--------------llleeeeeellLLLEeEEEEELlLLL
Query gcexqTARILpDGNALVAWC--------------ghpstilevnxKGEVlSKTEFEtGIE  119
ident             |                                               
Sbjct -----DICFY-NGIYYLYYSvstfgkntsviglatnqtldprdpdYEWKdMGPVIH-STA  138
DSSP  -----EEEEE-LLEEEEEEEellllllleeeeeeeelllllllllLLLEeEEEEEE-ELL


DSSP  L-hhHLLLLLEELL---LLLEEEEELLLlEEEEELLL--------lLEEEEEELL-----
Query R-phAQFRQINKNK---KGNYLVPLFATsEVREIAPN--------gQLLNSVKLS-----  162
ident                          |       |              |           
Sbjct SdnyNAIDPNVVFDqegQPWLSFGSFWS-GIQLIQLDtetmkpaaqAELLTIASRgeepn  197
DSSP  LlllLLLLLEEEELlllLEEEEELLLLL-LEEEEELLlllllllllLLLEEEELLlllll


DSSP  LLLLEEEELLL-LLEEEELLLL---------LEEEEELLL--LLLEE-----------EE
Query GTPFSSAFLDN-GDCLVACGDA---------HCFVQLNLE--SNRIV-----------RR  199
ident           |    |    |             |                         
Sbjct AIEAPFIVCRNgYYYLFVSFDFccrgiestyKIAVGRSKDitGPYVDkngvsmmqgggTI  257
DSSP  LEEEEEEEEELlEEEEEEEELLlllhhhlllEEEEEEELLllLLLLLlllllhhhlllEE


DSSP  EEHHhlllLLLLeEEEEEELL-LLLEEEEEELlllllHHHL--LLLLEEEELL-------
Query VNANdiegVQLFfVAQLFPLQ-NGGLYICNWQghdreAGKG--KHPQLVEIDS-------  249
ident                                                             
Sbjct LDEG-ndrWIGP-GHCAVYFSgVSAILVNHAY-----DALKngEPTLQIRPLYwddegwp  310
DSSP  EELL-lllEEEE-EEEEEEEElLEEEEEEEEE-----ELLLllEEEEEEEEEEellllle


DSSP  LLLEeeeelllllllllleeeeell
Query EGKVvwqlndkvkfgxisticpire  274
ident    |                     
Sbjct YLSV---------------------  314
DSSP  EELL---------------------


No 171: Query=mol1A Sbjct=2aepA Z-score=7.6

back to top
DSSP  ---------------------------------------------LLLEEEEE-------
Query ---------------------------------------------SPQHLLVG-------    8
ident                                                             
Sbjct aeyrnwskpqckitgfapfskdnsirlsaggdiwvtrepyvscdpDKCYQFALgqgttln   60
DSSP  lllllllllllllleeeeeeellhhhhhllllleeeeeeeeeellLLEEEEEEeeeeell


DSSP  ----------llllLEEEEEELLLLEE--EEEEELllllLLLEEEEL-LLLLEEEEL---
Query ----------gsgwNKIAIINKDTKEI--VWEYPLekgwECNSVAAT-KAGEILFSY---   52
ident                                           |                 
Sbjct nrhsndtvhdrtpyRTLLMNELGVPFHlgTKQVCI----AWSSSSCHdGKAWLHVCVtgh  116
DSSP  lhhhllllllllllLEEEEEELLLLLLllLEEEEE----LLEEEEEElLLLEEEEEEell


DSSP  --lLEEEEELLlLLEEEEEELL-LLLEEEE--eEELLLLLEEEEEEL------LLEEEEE
Query --sKGAKXITRdGRELWNIAAP-AGCEXQT--aRILPDGNALVAWCG------HPSTILE  101
ident      |  |   ||    |                   |   |              || 
Sbjct denATASFIYD-GRLVDSIGSWsKKILRTQeseCVCINGTCTVVMTDgsasgrADTKILF  175
DSSP  lllLEEEEEEL-LEEEEEEELLlLLLLLLLlllLEEELLEEEEEEEEelllllEEEEEEE


DSSP  ELLlLLEEEEEEELLLlllhhHLLLLLEELLL-LLEE-EEELL-LLEEEEELL-----LL
Query VNXkGEVLSKTEFETGierphAQFRQINKNKK-GNYL-VPLFA-TSEVREIAP-----NG  153
ident     |                            |           |              
Sbjct IEE-GKIVHISPLSGS---aqHVEECSCYPRYpGVRCvCRDNWkGSNRPIVDInvkdySI  231
DSSP  EEL-LEEEEEEELLLL---llLLEEEEEEEELlEEEEeEELLLlLLLLEEEEElllllLE


DSSP  LEeEEEE---LLLL-----------------------LLEEEEllllleeeellllleee
Query QLlNSVK---LSGT-----------------------PFSSAFldngdclvacgdahcfv  187
ident      |       |                           ||                 
Sbjct VS-SYVCsglVGDTprkndssssshclnpnneegghgVKGWAF-----------------  273
DSSP  EE-EELLlllLLLLlllllllllllllllllllllllLLLLEE-----------------


DSSP  eeLLLLLLEeeEEEH--------------------------hHLLLL--LLLEeEEEE--
Query qlNLESNRIvrRVNA--------------------------nDIEGV--QLFFvAQLF--  217
ident            |                                                
Sbjct --DDGNDVWmgRTISekfrsgyetfkviegwskpnsklqinrQVIVDrgNRSG-YSGIfs  330
DSSP  --EELLEEEeeELLLlllleeeeeeeellllllllllleeeeEEEEEeeEELL-LEEEee


DSSP  ----elllllEEEEEELllLLLHHHL--llLLEEEE------llLLLEeeeellllllll
Query ----plqnggLYICNWQghDREAGKG--khPQLVEI------dsEGKVvwqlndkvkfgx  265
ident            |                     |           |              
Sbjct vegkscinrcFYVELIR-gRKQETEVwwtsNSIVVFcgtsgtygTGSW----------pd  379
DSSP  eelllleeeeEEEEEEE-eLLLLLLLlleeEEEEEEeeelllllLLLL----------ll


DSSP  lleeeeell
Query isticpire  274
ident          
Sbjct gadinlmpi  388
DSSP  lllhhhlll


No 172: Query=mol1A Sbjct=1k3iA Z-score=7.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ipegslqflslrasapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangd   60
DSSP  lllllhhhlllllllllleelllllleeeellllllllhhhhlllllllleelllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pkpphtytidmkttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfad  120
DSSP  lllleeeeeeeeeeeeeeeeeeelllllllllllleeeeeeelllllllllleeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sttkysnfetrparyvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlp  180
DSSP  llleeeeeeeeeeeeeeeeelllllllllleeleeeeeelllllllllllleeeeeeell


DSSP  ----------lLLEEEEE----------llllleeeEEEL---LLLEEEE--eEELLlLL
Query ----------sPQHLLVG----------gsgwnkiaIINK---DTKEIVW--eYPLEkGW   35
ident                |                                            
Sbjct ivpaaaaieptSGRVLMWssyrndafggspggitltSSWDpstGIVSDRTvtvTKHD-MF  239
DSSP  lllleeeeellLLEEEEEeelllllllllllleeeeEEELlllLLLLLLEeeeLLLL-LL


DSSP  LLleEEELLLLLEEE-ellleeeeELLL-----LLEE-------------------eEEE
Query ECnsVAATKAGEILF-syskgakxITRD-----GREL-------------------wNIA   70
ident           | |              |                                
Sbjct XP-gISMDGNGQIVVtggndakktSLYDsssdsWIPGpdmqvargyqssatmsdgrvFTI  298
DSSP  LL-eEEELLLLLEEEellllllleEEEEhhhleEEELlllllllllleeeellllleEEE


DSSP  LLL-----------------------------------------LLEEEEeeelllllee
Query APA-----------------------------------------GCEXQTarilpdgnal   89
ident                                                             
Sbjct GGSwsggvfekngevyspssktwtslpnakvnpmltadkqglyrSDNHAW----------  348
DSSP  LLLllllllllleeeeelllleeeeelllllhhhllllllhhhlLLLLLL----------


DSSP  eeeellleeEEEEllllLEEEEE---------------------------eeLLLLllhh
Query vawcghpstILEVnxkgEVLSKT---------------------------efETGIerph  122
ident                                                             
Sbjct ---------LFGW---kKGSVFQagpstamnwyytsgsgdvksagkrqsnrgVAPD----  392
DSSP  ---------EEEL---hHHLEEEllllleeeeeellllleeeeeeeleelleELLL----


DSSP  HLLLLLEELL--LLLEEEEELL--------LLEEEEELL-----LLLEEEE--EELLLLL
Query AQFRQINKNK--KGNYLVPLFA--------TSEVREIAP-----NGQLLNS--VKLSGTP  165
ident |           ||  |             |     |                       
Sbjct AMCGNAVMYDavKGKILTFGGSpdyqdsdaTTNAHIITLgepgtSPNTVFAsnGLYFART  452
DSSP  LLLLEEEEEEllLLEEEEELLLllllllllLLLEEEEELlllllLLEEEELllLLLLLLL


DSSP  -LEEEELLLLLEEEELLL-----------LLEEEEELLLLLLEEEEEEHhhllllLLLEE
Query -FSSAFLDNGDCLVACGD-----------AHCFVQLNLESNRIVRRVNAndiegvQLFFV  213
ident    |  |  |      |                     |                    |
Sbjct fHTSVVLPDGSTFITGGQrrgipfedstpVFTPEIYVPEQDTFYKQNPN------SIVRV  506
DSSP  lLEEEELLLLLEEEELLLlllllllllllLLLLEEEEHHHLEEEELLLL------LLLLL


DSSP  --EEEEELLLLLEEEEEELL-llLLHHhllLLLEEEELLL--------------------
Query --AQLFPLQNGGLYICNWQG-hdREAGkgkHPQLVEIDSE--------------------  250
ident        |  |                   |                             
Sbjct yhSISLLLPDGRVFNGGGGLcgdCTTN---HFDAQIFTPNylynsngnlatrpkitrtst  563
DSSP  llEEEEELLLLLEEEEELLLlllLLLL---LLEEEEEELHhhlllllllllllleeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  250
ident                                                             
Sbjct qsvkvggritistdssiskaslirygtathtvntdqrripltltnnggnsysfqvpsdsg  623
DSSP  leeellleeeeeellllleeeeeelleeelllllllleeelleeeeelleeeeellllll


DSSP  ----lleeeeelllllllllleeeeell
Query ----gkvvwqlndkvkfgxisticpire  274
ident                             
Sbjct valpgywmlfvmnsagvpsvastirvtq  651
DSSP  lllleeeeeeeellllllllleeeeeel


No 173: Query=mol1A Sbjct=1y7bA Z-score=7.6

back to top
DSSP  -------------------llLEEEEELLL----lLEEEEEELL-LLEEEEEEELL----
Query -------------------spQHLLVGGSG----wNKIAIINKD-TKEIVWEYPLE----   32
ident                             |             ||         ||     
Sbjct sliknpilrgfnpdpsicradTDYYIATSTfewfpGVQIHHSKDlVNWHLVAHPLNrtsl   60
DSSP  leeellllllllllleeeeelLEEEEEELLlleelLLEEEEELLlLLLEEEELLLLllll


DSSP  --------lLLLL-LEEEELLLlLEEEELLL-------------EEEEELL-LLLEeEEE
Query --------kGWEC-NSVAATKAgEILFSYSK-------------GAKXITR-DGRElWNI   69
ident          |                  |                       ||      
Sbjct ldmkgnpnsGGIWaPDLSYHDG-KFWLIYTDvkvtdgmwkdchnYLTTCESvDGVW-SDP  118
DSSP  lllllllllLEELlLEEEEELL-EEEEEEEEellllllllleeeEEEEELLlLLLL-LLL


DSSP  ELlllleeeeeeellllleeeEEELlleeeeeellllleeeeeeellllllhhhLLLLL-
Query AApagcexqtarilpdgnalvAWCGhpstilevnxkgevlsktefetgierphaQFRQI-  128
ident                                                        |    
Sbjct IT-------------------LNGS-----------------------------GFDASl  130
DSSP  EE-------------------LLLL-----------------------------LLLLEe


DSSP  EELLL-LLEEEEE--------lLLLEEEEEL-------lLLLEEEEEEL---LLLLLEEE
Query NKNKK-GNYLVPL--------fATSEVREIA-------pNGQLLNSVKL---SGTPFSSA  169
ident         |||                             |      |      |     
Sbjct FHDNDgKKYLVNMywdqrtynhNFYGIVLQEysdkekklIGKAKIIYKGtdiKYTEGPHI  190
DSSP  EELLLlLEEEEEEeelllllllLEEEEEEEEeelllleeEEEEEEEELLlllLLLEEEEE


DSSP  E-LLLLLEEEELLLL-----LEEEEELLL--LLLEEE---EEEHH---hlllLLLLeEEE
Query F-LDNGDCLVACGDA-----HCFVQLNLE--SNRIVR---RVNAN---diegVQLFfVAQ  215
ident         |              |                             |      
Sbjct YhIGDYYYLFTAEGGttyehSETVARSKNidGPYEIDpeyPLLTSwhdprnsLQKC-GHA  249
DSSP  EeELLEEEEEEEELLlllllEEEEEEELLllLLLEELlllLLEELlllllllLEEE-EEE


DSSP  EEELL--LLLEEEEEellllllHHHL----------------LLLLEEEELL------LL
Query LFPLQ--NGGLYICNwqghdreAGKG----------------KHPQLVEIDS------EG  251
ident                                                             
Sbjct SLVHThtDEWYLAHL------vGRPLpvgnqpvleqrgycplGRETSIQRIEwvdnwpRV  303
DSSP  EEEELllLLEEEEEE------eELLLllllllllllllllllLLEEEEEEEEeelleeEE


DSSP  LE----------------------------------------------------------
Query KV----------------------------------------------------------  253
ident                                                             
Sbjct VGgkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkakkgnl  363
DSSP  LLlllllleeellllllllllllllleellllllllllleeelllllllleellllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  253
ident                                                             
Sbjct rlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwstiqvt  423
DSSP  eeellllllllllleeeeeelllleeeeeeeeellllllleeeeeeeeeelleeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  253
ident                                                             
Sbjct wnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdginws  483
DSSP  eellleeeeeeeeeelleeellllllleellllllleeeeeeeelleeeeeeelllllle


DSSP  ------------------------------eeeelllllllllleeeeell
Query ------------------------------vwqlndkvkfgxisticpire  274
ident                                                    
Sbjct kvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykee  534
DSSP  eeeeeeehhhhlllllllllllllleeeeeeeelllllleeeeeeeeeeel


No 174: Query=mol1A Sbjct=1su3B Z-score=7.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vdlvqkylekyynlksgpvveklkqmqeffglkvtgkpdaetlkvmkqprcgvpdvaprw   60
DSSP  lhhhhhhhhhhllllllhhhhhhhhhhhhllllllllllhhhhhhhhlllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrgdhr  120
DSSP  llleeeeeellllllllhhhhhhhhhhhhhhhhllllleeeellllllleeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct dnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslglshs  180
DSSP  lllllllllllleeelllllllllleeeelllllllllllllhhhhhhhhhhhhhlllll


DSSP  --------------------------------llleeeeelllLLEEEEEE--lllleee
Query --------------------------------spqhllvggsgWNKIAIIN--kdtkeiv   26
ident                                                |            
Sbjct tdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpigpQTPKACDSkltfdaitt  240
DSSP  llllllllllllllllllllhhhhhhhhhhhllllllllllllLLLLLLLLllllleeee


DSSP  eeeelllllLLLEEEELLLLL-EEEELLleeeeellllleeeeeellllleeeeeeelll
Query weyplekgwECNSVAATKAGE-ILFSYSkgakxitrdgrelwniaapagcexqtarilpd   85
ident                                                             
Sbjct irgevmffkDRFYMRTNPFYPeVELNFI--------------------------------  268
DSSP  elleeeeeeLLEEEELLLLLLlLEEEEH--------------------------------


DSSP  lleeeEEELlleeeeeellllleeeeeeellllllhHHLLLLLEELL-LLLEEEEELllL
Query gnalvAWCGhpstilevnxkgevlsktefetgierpHAQFRQINKNK-KGNYLVPLFatS  144
ident       |                                                     
Sbjct ---svFWPQ--------------------------lPNGLEAAYEFAdRDEVRFFKG--N  297
DSSP  ---hhLLLL--------------------------lLLLLLEEEEEHhHLEEEEEEL--L


DSSP  EEEEELL--lLLEE-EEEE-------lLLLLLEEEELL-LLLEEEELllLLEEEEELLLL
Query EVREIAP--nGQLL-NSVK-------lSGTPFSSAFLD-NGDCLVACgdAHCFVQLNLES  193
ident                                         |        |          
Sbjct KYWAVQGqnvLHGYpKDIYssfgfprtVKHIDAALSEEnTGKTYFFV--ANKYWRYDEYK  355
DSSP  EEEEEELleeLLLLlEEHHhhhlllllLLLLLEEEELLlLLEEEEEE--LLEEEEEELLL


DSSP  LLEE--EEEE-HHHLLLLLLLeEEEEEELLlLLEEEEEEllllllhhhllllLEEEELLL
Query NRIV--RRVN-ANDIEGVQLFfVAQLFPLQnGGLYICNWqghdreagkgkhpQLVEIDSE  250
ident            | |  |     |   |    |  |                      |  
Sbjct RSMDpgYPKMiAHDFPGIGHK-VDAVFMKD-GFFYFFHG------------tRQYKFDPK  401
DSSP  LEELllLLEEhHHHLLLLLLL-LLEEEEEL-LEEEEEEL------------lEEEEEELL


DSSP  -LLEEEEELllllllllleeEEELl
Query -GKVVWQLNdkvkfgxistiCPIRe  274
ident                          
Sbjct tKRILTLQK---------anSWFN-  416
DSSP  lLEEEEEEE---------llLLLL-


No 175: Query=mol1A Sbjct=2ac1A Z-score=7.5

back to top
DSSP  ---------------------------LLLEEEEE------llLLLEEEEEELL---LLE
Query ---------------------------SPQHLLVG------gsGWNKIAIINKD---TKE   24
ident                               ||           |    |           
Sbjct nqpyrtgfhfqppknwmndpngpmiykGIYHLFYQwnpkgavwGNIVWAHSTSTdliNWD   60
DSSP  lllllllllllllleeeeeeeeeeeelLEEEEEEEelllllllLLLEEEEEEELlllLLE


DSSP  EEEE-EELLL---LLLLLEEEELL----LLLEEEELL-----LEEEEELLL---------
Query IVWE-YPLEK---GWECNSVAATK----AGEILFSYS-----KGAKXITRD---------   62
ident                 | |  ||        ||                           
Sbjct PHPPaIFPSApfdINGCWSGSATIlpngKPVILYTGIdpknqQVQNIAEPKnlsdpylre  120
DSSP  EEEEeELLLLhhhLLLEEEEEEEEllllLEEEEEEEElllllEEEEEEEELlllllllll


DSSP  LLEE---eEEELL----LLLE-EEEEEELLL--------lleeeeeellleeEEEELLLL
Query GREL---wNIAAP----AGCE-XQTARILPD--------gnalvawcghpstILEVNXKG  106
ident           |                                                 
Sbjct WKKSplnpLMAPDavngINASsFRDPTTAWLgqdkkwrviigskihrrglaiTYTSKDFL  180
DSSP  EEELllllLLLLLllllLLLLlEELLLLLEEllllleeeeeeeeelleeeeeEEEELLLL


DSSP  LEeEEEEEllllllhhhllllleellllLEEEeelLLLEeeeellllleeeeeelllllL
Query EVlSKTEFetgierphaqfrqinknkkgNYLVplfATSEvreiapngqllnsvklsgtpF  166
ident     |                                |                      
Sbjct KW-EKSPE--------------------PLHY--dDGSG------------------mwE  199
DSSP  LL-EELLL--------------------LLEE--eELLL------------------leE


DSSP  EEEELLL---------------------LLEEEELLLLLEEEEELL-----------LLL
Query SSAFLDN---------------------GDCLVACGDAHCFVQLNL-----------ESN  194
ident    |                                |                       
Sbjct CPDFFPVtrfgsngvetssfgepneilkHVLKISLDDTKHDYYTIGtydrvkdkfvpDNG  259
DSSP  EEEEEEEelllllllllllllllllleeEEEEEEELLLLEEEEEEEeeelllleeeeLLL


DSSP  LE----EEEEEHHhllllllleEEEEEEL-----LLLLEEEEEELllLLLHHHL----LL
Query RI----VRRVNANdiegvqlffVAQLFPL-----QNGGLYICNWQghDREAGKG----KH  241
ident         |                             |                     
Sbjct FKmdgtAPRYDYG--------kYYASKTFfdsakNRRILWGWTNE--SSSVEDDvekgWS  309
DSSP  LLllllLLLLLLL--------lLEEEEEEeelllLEEEEEEEELL--LLLHHHHhhhlEE


DSSP  LLE-EEEL----------LLLL--------------------------------------
Query PQL-VEID----------SEGK--------------------------------------  252
ident                                                             
Sbjct GIQtIPRKiwldrsgkqlIQWPvreverlrtkqvknlrnkvlksgsrlevygvtaaqadv  369
DSSP  LEElLLEEeeelllllleEEEElhhhhhhllllleeeeeeeellleeeellllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  252
ident                                                             
Sbjct evlfkvrdlekadviepswtdpqlicskmnvsvksglgpfglmvlasknleeytsvyfri  429
DSSP  eeeeelllhhhleelllllllhhhhhhhlllllllleeeeeeeeeellllllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  252
ident                                                             
Sbjct fkarqnsnkyvvlmcsdqsrsslkedndkttygafvdinphqplslralidhsvvesfgg  489
DSSP  eellllllleeeeeeeelllllllllllllleeeeellllllleeeeeeeelleeeeeel


DSSP  --------------------------eeeeelllllllllleeeeell
Query --------------------------vvwqlndkvkfgxisticpire  274
ident                                                 
Sbjct kgracitsrvypklaigksshlfafnygyqsvdvlnlnawsmnsaqis  537
DSSP  llleeeeeelllllllhhhleeeeeellllleeeeeeeeeelllllll


No 176: Query=mol1A Sbjct=1st8A Z-score=7.3

back to top
DSSP  ----------------------------LLLEEEEEL--------lLLLEEEEEELL---
Query ----------------------------SPQHLLVGG--------sGWNKIAIINKD---   21
ident                                                             
Sbjct qieqpyrtgyhfqppsnwmndpngpmlyQGVYHFFYQynpyaatfgDVIIWGHAVSYdlv   60
DSSP  lllllllllllllllleeeeeeeeeeeeLLEEEEEEEeelllllllLLLEEEEEEELlll


DSSP  -lLEEEEEEEL----LLLLLLLEEEELL---LLLEEEEL-----lLEEEEELLL------
Query -tKEIVWEYPL----EKGWECNSVAATK---AGEILFSY-----sKGAKXITRD------   62
ident                         |          |                        
Sbjct nwIHLDPAIYPtqeaDSKSCWSGSATILpgnIPAMLYTGsdsksrQVQDLAWPKnlsdpf  120
DSSP  leEELLLLLLLllhhHLLEEEEEEEEEElllEEEEEEEEelllllEEEEEEEELllllll


DSSP  ---LLEE---eEEEL----LLLLEEEEEEELLL---LLEEEEEELL---lEEEEEEL--L
Query ---GREL---wNIAA----PAGCEXQTARILPD---GNALVAWCGH---pSTILEVN--X  104
ident             |         |                 |            |      
Sbjct lreWVKHpknpLITPpegvKDDCFRDPSTAWLGpdgVWRIVVGGDRdnngMAFLYQStdF  180
DSSP  lllEEELllllLLLLllllLLLLEELLLLLEELlllLEEEEEEEEElleeEEEEEEEllL


DSSP  LLLEEE-EEEELLLLLLHhhLLLLLEELL----------------LLLEEEEEL-LLLEE
Query KGEVLS-KTEFETGIERPhaQFRQINKNK----------------KGNYLVPLF-ATSEV  146
ident                                                      |      
Sbjct VNWKRYdQPLSSADATGT--WECPDFYPVplnstngldtsvyggsVRHVMKAGFeGHDWY  238
DSSP  LLLEELlLLLEEELLLLL--LEEEEEEEEelllllllllllllllEEEEEEEEElLEEEE


DSSP  EEELL-----LLLEEE---------EEELL---LLLLEEEE------------------l
Query REIAP-----NGQLLN---------SVKLS---GTPFSSAF------------------l  171
ident           |    |                      | |                   
Sbjct TIGTYspdreNFLPQNglsltgstlDLRYDygqFYASKSFFddaknrrvlwawvpetdsq  298
DSSP  EEEEEellllEEEELLlllllllllLEELLlllLEEEEEEEelllleeeeeeeelllllh


DSSP  lllleeeellllleeeEELLLL---LLEEEE-----------------------------
Query dngdclvacgdahcfvQLNLES---NRIVRR-----------------------------  199
ident                  |         |                                
Sbjct addiekgwaglqsfprALWIDRngkQLIQWPveeieelrqnqvnlqnknlkpgsvleihg  358
DSSP  hhhhhhleeleellleEEEELLlllLEEEEElhhhhhheeeeeeeeeeeellleeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  199
ident                                                             
Sbjct iaasqadvtisfkleglkeaevldttlvdpqalcnergassrgalgpfgllamaskdlke  418
DSSP  lllleeeeeeeeeellhhhleelllllllhhhhhhhllllllllllleeeeeeellllll


DSSP  --------------------------------------------------eehHHLLLLL
Query --------------------------------------------------vnaNDIEGVQ  209
ident                                                             
Sbjct qsaiffrvfqnqlgrysvlmcsdlsrstvrsnidttsygafvdidprseeislRNLIDHS  478
DSSP  leeeeeeeeellllleeeeeeeelllllllllllllleeeeelllllllleeeEEEEELL


DSSP  L------leeeeeeellllleeeeeellllllhhhllllleeeellllLEEEEELlllll
Query L------ffvaqlfplqngglyicnwqghdreagkgkhpqlveidsegKVVWQLNdkvkf  263
ident                                                             
Sbjct IiesfgaggktcitsriypkfvnneeahlfvfnngtqnvkisemsawsMKNAKFV-----  533
DSSP  EeeeeehhhleeeeeellllhhhlllleeeeeellllleeeeeeeeeeELLLLEE-----


DSSP  lllleeeeell
Query gxisticpire  274
ident            
Sbjct -------vdqs  537
DSSP  -------elll


No 177: Query=mol1A Sbjct=1bpoB Z-score=7.2

back to top
DSSP  llleeeeellllleeeeeellLLEEEEEEE----LLLLL---LLLEEEELllllEEEELL
Query spqhllvggsgwnkiaiinkdTKEIVWEYP----LEKGW---ECNSVAATkageILFSYS   53
ident                                                             
Sbjct ---------------maqilpIRFQEHLQLqnlgINPANigfSTLTMESD----KFICIR   41
DSSP  ---------------llllllEEEEEEEEHhhhlLLLLLlllLLEEEEEL----LEEEEE


DSSP  L-------EEEEELLLLLEEEEEELLllLEEEEEEELlllLEEEEEELL-LEEEEEELll
Query K-------GAKXITRDGRELWNIAAPagCEXQTARILpdgNALVAWCGH-PSTILEVNxk  105
ident                |                            |        |      
Sbjct EkvgeqaqVVIIDMNDPSNPIRRPIS--ADSAIMNPA---SKVIALKAGkTLQIFNIE--   94
DSSP  ElllllleEEEEELLLLLLLEEEELL--LLEEEELLL---LLLEEEEELlEEEEEELL--


DSSP  lLEEEEEEELLLLllhhHLLLLLEELLllLEEEEELLLLEEEEELLLLLEEEEEELL---
Query gEVLSKTEFETGIerphAQFRQINKNKkgNYLVPLFATSEVREIAPNGQLLNSVKLS---  162
ident                              |                              
Sbjct -MKSKMKAHTMTD----DVTFWKWISL--NTVALVTDNAVYHWSMEGESQPVKMFDRhss  147
DSSP  -LLEEEEEEELLL----LLLEEEEEEL--LEEEEELLLEEEEEELLLLLLLLLLEELlhh


DSSP  ---llllEEEELLLLLEEEELLL--------lLEEEEELLlllLEEEEEEHhhlllllll
Query ---gtpfSSAFLDNGDCLVACGD--------aHCFVQLNLesnRIVRRVNAndiegvqlf  211
ident                  |   |                     | |              
Sbjct lagcqiiNYRTDAKQKWLLLTGIsaqqnrvvgAMQLYSVD---RKVSQPIEghaasfaqf  204
DSSP  hllleeeEEEELLLLLEEEEEEEeeelleeeeEEEEEELL---LLLEEEEElleeeeeee


DSSP  eeeeeeelLLLLEE--------------------------eeeellllllhHHLLLLLEE
Query fvaqlfplQNGGLY--------------------------icnwqghdreaGKGKHPQLV  245
ident                                                         |   
Sbjct kmegnaeeSTLFCFavrgqaggklhiievgtpptgnqpfpkkavdvffppeAQNDFPVAM  264
DSSP  llllllllEEEEEEeeeelleeeeeeeellllllllllllleeeellllllLLLLLEEEE


DSSP  EellllleEEEELLL-------------------LLLLLLlEEEEELL------------
Query EidsegkvVWQLNDK-------------------VKFGXIsTICPIRE------------  274
ident         |                                   |               
Sbjct QisekhdvVFLITKYgyihlydletgtciymnriSGETIF-VTAPHEAtagiigvnrkgq  323
DSSP  EeelllleEEEEELLleeeeeellllleeeeeelLLLLEE-EEEEELLlleeeeeellle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct vlsvcveeeniipyitnvlqnpdlalrmavrnnlagaeelfarkfnalfaqgnyseaakv  383
DSSP  eeeeeellllhhhhhhhllllhhhhhhhhhhhlllllhhhhhhhhhhhhhlllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct aanapkgilrtpdtirrfqsvpaqpgqtspllqyfgilldqgqlnkyeslelcrpvlqqg  443
DSSP  hhhlhhhllllhhhhhhhhllllllllllhhhhhhhhhhhhlllllhhhhhhhhhhhhll


DSSP  --------------------------------------------------
Query --------------------------------------------------  274
ident                                                   
Sbjct rkqllekwlkedklecseelgdlvksvdptlalsvylranvpnkviqcfa  493
DSSP  lhhhhhhhhhlllllllhhhhhhhhlllhhhhhhhhllllllhhhhhlll


No 178: Query=mol1A Sbjct=3c2uA Z-score=7.2

back to top
DSSP  --------------------lLLEEEEELLL---lLEEEEEELL-LLEEEEEEELLLL--
Query --------------------sPQHLLVGGSG---wNKIAIINKD-TKEIVWEYPLEKG--   34
ident                                           ||         ||     
Sbjct mniqnpvlkgfnpdpsivragDDYYIATSTFewfpGVQIHHSKDlVHWHLVAHPLSTTef   60
DSSP  lleellllllllllleeeeelLEEEEEELLLleelLLEEEEELLlLLLEEEELLLLLLll


DSSP  ----------LLLLE-EEELLlLLEE-------------eelllEEEEELL-lLLEEEEE
Query ----------WECNS-VAATKaGEIL-------------fsyskGAKXITR-dGRELWNI   69
ident                       |                              |     |
Sbjct ldmkgnpdsgGIWAPdLSYAD-GKFWliytdvkvvdgmwkdchnYLTTAEDikGPWSKPI  119
DSSP  llllllllllEELLLeEEEEL-LEEEeeeeeellllllllleeeEEEEELLllLLLLLLE


DSSP  EllllleeeeeeellllleeeEEELlleeeeeellllleeeeeeellllllhhhLLLLLE
Query AapagcexqtarilpdgnalvAWCGhpstilevnxkgevlsktefetgierphaQFRQIN  129
ident                                                        |    
Sbjct L--------------------LNGA-----------------------------GFDASL  130
DSSP  E--------------------EELL-----------------------------LLLLEE


DSSP  ELL---LLLEEEEE-------lLLLEEEEEL-------LLLLEEEEEEL---LLLLLEEE
Query KNK---KGNYLVPL-------fATSEVREIA-------PNGQLLNSVKL---SGTPFSSA  169
ident       |                                 |      |      |     
Sbjct FHDpsgKKYLVNMYwdqrvyhhNFYGIALQEysvaeekLIGKPEIIYKGtdiAYTEGPHL  190
DSSP  EELlllLEEEEEEEelllllllLEEEEEEEEeelllleELLLLEEEELLlllLLLEEEEE


DSSP  ELLL-LLEEEELLLL-----LEEEEELLL-lLLEEE----EEEH---hhlllLLLLeEEE
Query FLDN-GDCLVACGDA-----HCFVQLNLE-sNRIVR----RVNA---ndiegVQLFfVAQ  215
ident    |    |                                            |      
Sbjct YYINdMYYLMTAEGGttyqhSETIARSKTihGPYEIqpdyPLLSawkevhnpLQKC-GHA  249
DSSP  EEELlEEEEEEEELLlllllEEEEEEELLllLLLEEllllLLLLllllllllLEEE-EEE


DSSP  EEELL--LLLEEEEEellllllHHHL-------------------LLLLEEEELLL----
Query LFPLQ--NGGLYICNwqghdreAGKG-------------------KHPQLVEIDSE----  250
ident                                                             
Sbjct SLVETqnGQWYLAHL------tGRPLpapagfpsrereqhafcplGRETAIQKIEWqdgw  303
DSSP  EEEELllLLEEEEEE------eELLLllllllllllhhhhlllllLLEEEEEEEEEelle


DSSP  -LLEE-------------------------------------------------------
Query -GKVV-------------------------------------------------------  254
ident    |                                                        
Sbjct pVVVGgqqgsleveapdlpqqewaptyeerddfdkdtlninfqtlripfsehlgsltarp  363
DSSP  eEELLlllllleelllllllllllllllleellllllllllleeelllllllleelllll


DSSP  ------------------eeelllLLLL--------------------------------
Query ------------------wqlndkVKFG--------------------------------  264
ident                           |                                 
Sbjct gflrlygreslqskftqahiarrwQSFNfdagtsvefspnsfqqmagltcyyntenwssi  423
DSSP  lleeeellllllllllleeeeeelLLLEeeeeeeeellllllleeeeeeeeeelleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct hvtwneekgriidlvtadngtfsmplagaeipipdevktvhfkvsvrgriyqyaysfdge  483
DSSP  eeeeellleeeeeeeeeelleeellllllleellllllleeeeeeeelleeeeeeellll


DSSP  ---------------------------------------------llleeeeell
Query ---------------------------------------------xisticpire  274
ident                                                        
Sbjct tfhtlpielpswklsddyvrgggfftgafvginaiditgtalpadfdyftykeld  538
DSSP  lleelllleehhhllllllllllllllleeeeeeeelllllleeeeeeeeeeell


No 179: Query=mol1A Sbjct=2zuyA Z-score=7.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pkkrqmeyltrgliavqteqgvfvswrflgtdhettafhlyrdgkritrdpiaestnfld   60
DSSP  llleeellllllleeeeelleeeeellllllllllleeeeeelleelllllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qngtadsvyqvaavnkgreeklskkarvwqenvlevplakpeggvtpdgkpytysandas  120
DSSP  llllllleeeeeeeelleelllllleeeellleeeeelllllleellllleeleeeeeee


DSSP  -------LLLEEEEEL-------------lllLEEEEEELlLLEEEEEEELLLLL----l
Query -------SPQHLLVGG-------------sgwNKIAIINKdTKEIVWEYPLEKGW----e   36
ident                                   |           |   |         
Sbjct vgdidgdGEYEMILKWdpsnskdnahdgytgeVLIDAYKL-DGTFLWRINLGRNIragah  179
DSSP  eelllllLLLEEEEEEeellllllllllllllLEEEEELL-LLLEEEEEELLLLLlllll


DSSP  LLEEEELL-----LLLEEEEL-----------------------------lLEEEEELL-
Query CNSVAATK-----AGEILFSY-----------------------------sKGAKXITR-   61
ident                ||                                           
Sbjct YTQFMVYDldgdgKAEIAMKTadgttdgkghiigdeqadfrneqgrilsgpEYLTVFKGe  239
DSSP  LLLLEEELlllllLLEEEEEEllllllllllllllllllllllllllllllLEEEEEELl


DSSP  LLLEEEE--EELLL-------------LLEEeEEEELLL---LLEEEEEEL-LLEEEEEE
Query DGRELWN--IAAPA-------------GCEXqTARILPD---GNALVAWCG-HPSTILEV  102
ident  |  |       |                    |             |            
Sbjct TGEALTTveYEPPRgkledwgdgygnrMDRF-LAGTAYLdgePSLVMARGYyTRTVLVAY  298
DSSP  LLLEEEEeeLLLLLllhhhhlllllllLLLE-EEEEELLlllLEEEEEELLlLLLEEEEE


DSSP  LL---LLLEEEEEEE-------LLLLllhhhLLLLLEELLL-----LLEEEEelllleEE
Query NX---KGEVLSKTEF-------ETGIerphaQFRQINKNKK-----GNYLVPlfatseVR  147
ident                         |                                   
Sbjct DFrngRLKKRWVFDSnqpgheaYAGQ-----GNHSLSVADVdgdgkDEIIYG------AM  347
DSSP  EEellEEEEEEEEELlllllhhHLLL-----LLLLLEEELLlllllLEEEEL------LE


DSSP  EEL--LLLLEEEeeellLLLLeeeellllleeeellllleeeeELLLL------------
Query EIA--PNGQLLNsvklsGTPFssafldngdclvacgdahcfvqLNLES------------  193
ident        |         |                           |              
Sbjct AVDhdGTGLYST-glghGDAM--------------------hvGDLDPsrkglevfqvhe  386
DSSP  EELllLLEEEEL-llllLLLE--------------------eeELLLLllllleeeeell


DSSP  -------------------------------lLEEE------------------------
Query -------------------------------nRIVR------------------------  198
ident                                                             
Sbjct datkpyglslrdagtgeilwgvhagtdvgrgmAAHIdpsykgslvwgidppgndgmsygl  446
DSSP  llllllleeeeellllleeeeellllllleeeEELLllllllleeeeelllllllleeee


DSSP  ---------------------------EEEH-----------------------hhLLLL
Query ---------------------------RVNA-----------------------ndIEGV  208
ident                            |                            |   
Sbjct ftskgekisdkapssanfaiwwdgdlvRELLdhdwdgtigrpkiekwdaengclktIFQP  506
DSSP  eelllleeelllllllleeelllllllLEEEeeeelllleeeeeeeeelllleeeeEELL


DSSP  -------lLLEEeeEEEL---LLLLEEEeeellllllhhhllllleeeellllleeeEEL
Query -------qLFFVaqLFPL---QNGGLYIcnwqghdreagkgkhpqlveidsegkvvwQLN  258
ident               |            |                                
Sbjct agvlsnngTKGNpvLQANlfgDWREEVI-----------------------------WRT  537
DSSP  lleelllhHHLLllEEELlllLLLLEEE-----------------------------EEE


DSSP  LLLLL--------------------------------------------------lllle
Query DKVKF--------------------------------------------------gxist  268
ident                                                             
Sbjct EDSSAlriyttthltrhcfytlmhdpvyrlgiawqntaynqpphtsfylgtgmkkppkpa  597
DSSP  LLLLEeeeellllllllllllhhhlllhhhhhhhllllllllllllllllllllllllll


DSSP  eeeell
Query icpire  274
ident       
Sbjct lyiags  603
DSSP  eeelll


No 180: Query=mol1A Sbjct=1yrzA Z-score=7.0

back to top
DSSP  ------------------llLEEEEELLL-----lLEEEEEELllLEEEEEEE-LLLL--
Query ------------------spQHLLVGGSG-----wNKIAIINKdtKEIVWEYP-LEKG--   34
ident                            |         |       |        |     
Sbjct riqnpilpgfhpdpsivrvgDDYYIATSTfewfpgVRIHHSRD-lKHWRFVSSpLTRTsq   59
DSSP  leellllllllllleeeeelLEEEEEELLlleellLEEEEELL-lLLLEEEELlLLLLll


DSSP  ----------lLLLE-EEELlLLLE-------------eeelllEEEEELLlLLEEEEEE
Query ----------wECNS-VAATkAGEI-------------lfsyskGAKXITRdGRELWNIA   70
ident                       |                                     
Sbjct ldmkgnmnsggIWAPcLSYH-DGTFyliytdvkqwhgafkdahnYLVTAQNiEGPWSDPI  118
DSSP  lllllllllleELLLeEEEE-LLEEeeeeeeeeelllllleeeeEEEEELLlLLLLLLLE


DSSP  LlllleeeeeeellllleeeEEELlleeeeeellllleeeeeeellllllhhhLLLLLEE
Query ApagcexqtarilpdgnalvAWCGhpstilevnxkgevlsktefetgierphaQFRQINK  130
ident                                                       |     
Sbjct Y-------------------LNSS-----------------------------GFDPSLF  130
DSSP  E-------------------LLLL-----------------------------LLLLEEE


DSSP  LL---LLLEEEEE-------lLLLEEEEEL-------LLLLEEEEEEL---LLLLLEEEE
Query NK---KGNYLVPL-------fATSEVREIA-------PNGQLLNSVKL---SGTPFSSAF  170
ident                                        |   |  |      |      
Sbjct HDddgRKWLVNMIwdyrkgnhPFAGIILQEyseaeqkLVGPVKNIYKGtdiQLTEGPHLY  190
DSSP  ELlllLEEEEEEEelllllllLEEEEEEEEeelllleEEEEEEEEELLlllLLLEEEEEE


DSSP  LLL-LLEEEELLLL-----LEEEEELLL-lLLEEE---EEEH---hhllllllLEEEEEE
Query LDN-GDCLVACGDA-----HCFVQLNLE-sNRIVR---RVNA---ndiegvqlFFVAQLF  217
ident        |                                                    
Sbjct KKDgYYYLLVAEGGteyehAATLARSQSidGPYETdpsYPLVtstgqpelalqKAGHGSL  250
DSSP  EELlEEEEEEEELLlllllEEEEEEELLllLLLEElllLLLEellllllllleEEEEEEE


DSSP  ELL--LLLEEEEEEL--lllLLHHhLLLLLEEEELLL------LLEE-------------
Query PLQ--NGGLYICNWQ--ghdREAGkGKHPQLVEIDSE------GKVV-------------  254
ident                                                             
Sbjct VETqnGEWYLAHLCGrplkgKYCT-LGRETAIQKVNWtedgwlRIEDggnhplrevtapd  309
DSSP  EELllLLEEEEEEEElllllLLLL-LLLEEEEEEEEEllllleEELLllllllleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  254
ident                                                             
Sbjct lpehpfekepelddfdapqlhhqwntlripadpswcsleerpghlrlrgmesltsvhsqs  369
DSSP  llllllllllleellllllllllleeelllllllleellllllleeeellllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  254
ident                                                             
Sbjct lvarrqqsfhcevetkleyqpesfqhmaglviyydtedhvylhvtwheekgkclqiiqtk  429
DSSP  eeeeelllleeeeeeeeellllllleeeeeeeeeelleeeeeeeeeellleeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  254
ident                                                             
Sbjct ggnydellaspiplaeekavylkgrihretmhlyfkqegeaewqpvgptidvthmsddsa  489
DSSP  lleeeellllleelllllleeeeeeeelleeeeeeeelllllleeeeeeeehhhllllll


DSSP  -------------eeelllllllllleeeeell
Query -------------wqlndkvkfgxisticpire  274
ident                                  
Sbjct kqvrftgtfvgmatqdlsgtkkpadfdyfryke  522
DSSP  lllllllleeeeeeeelllllleeeeeeeeeel


No 181: Query=mol1A Sbjct=1w18B Z-score=6.8

back to top
DSSP  --------------------------------------llleeeeellllleeeeeelll
Query --------------------------------------spqhllvggsgwnkiaiinkdt   22
ident                                                             
Sbjct agvpgfplpsihtqqaydpqsdftarwtradalqikahsdatvaagqnslpaqltmpnip   60
DSSP  lllllllllllllllllllllllleellhhhhhhhhhhlllllllllllllhhhllllll


DSSP  LEEEEEEELLllLLLLEEE-------ELLL--LLEEEEL---------------lLEEEE
Query KEIVWEYPLEkgWECNSVA-------ATKA--GEILFSY---------------sKGAKX   58
ident        |    |                    |  |                       
Sbjct ADFPVINPDV--WVWDTWTlidkhadQFSYngWEVIFCLtadpnagygfddrhvhARIGF  118
DSSP  LLLLLLLLLL--EEEEEEEeelllllLEEEllEEEEEEEeelllllllhhhlhhhLEEEE


DSSP  ELL-------------LLLEEEEEEL-------------lLLLEEEEEEELLLL----le
Query ITR-------------DGRELWNIAA-------------pAGCEXQTARILPDG----na   88
ident   |                                        |      |         
Sbjct FYRragipasrrpvngGWTYGGHLFPdgasaqvyagqtytNQAEWSGSSRLMQIhgntvs  178
DSSP  EEEellllhhhlllllLLEEEEELLLlllllhhhllllllEEEEEEEEEEELLLllleee


DSSP  eeEEEL---------------LLEEEEEELL--------LLLEEE-EEEELLL-------
Query lvAWCG---------------HPSTILEVNX--------KGEVLS-KTEFETG-------  117
ident                         |                                   
Sbjct vfYTDVafnrdanannitppqAIITQTLGRIhadfnhvwFTGFTAhTPLLQPDgvlyqng  238
DSSP  eeEEEEeelllllllllllleEEEEEEEEEEeelllleeEEEEEEeEEEELLLlllllll


DSSP  -lllhhHLLLlLEELLL------LLEEEEELL----------------------------
Query -ierphAQFRqINKNKK------GNYLVPLFA----------------------------  142
ident                                                             
Sbjct aqneffNFRD-PFTFEDpkhpgvNYMVFEGNTagqrgvancteadlgfrpndpnaetlqe  297
DSSP  llllllLLEE-EEEEELllllllEEEEEEEELllllllllllhhhhlllllllllllhhh


DSSP  ---------lLEEEEELL------LLLEEEEEELL----LLLLE-EEELL-LLLEEEELL
Query ---------tSEVREIAP------NGQLLNSVKLS----GTPFS-SAFLD-NGDCLVACG  181
ident                             |                   |           
Sbjct vldsgayyqkANIGLAIAtdstlsKWKFLSPLISAncvnDQTERpQVYLHnGKYYIFTIS  357
DSSP  hhhllhhhleEEEEEEELllllllLLLEEEEEEEEelllLLLEEeEEEEElLEEEEEEEE


DSSP  L-----------lLEEEEELLL-LLLEEE-----EEEHhhllllllleeeeeeellllle
Query D-----------aHCFVQLNLE-SNRIVR-----RVNAndiegvqlffvaqlfplqnggl  224
ident                                                             
Sbjct HrttfaagvdgpdGVYGFVGDGiRSDFQPmnygsGLTM----------------------  395
DSSP  LhhhlllllllllEEEEEEELLlLLLLEElllllLEEE----------------------


DSSP  eeeeellllLLHH--------HLLLLLEeeellllleeeeelllllllLLLE--------
Query yicnwqghdREAG--------KGKHPQLveidsegkvvwqlndkvkfgXIST--------  268
ident            ||                                     |         
Sbjct --gnptdlnTAAGtdfdpspdQNPRAFQ--------------------SYSHyvmpgglv  433
DSSP  --ellllllLLLLllllllllLLLLLEE--------------------EEEEeellllee


DSSP  ------------------------------------------eeEELL------------
Query ------------------------------------------icPIRE------------  274
ident                                                             
Sbjct esfidtvenrrggtlaptvrvriaqnasavdlrygngglggygdIPANradvniagfiqd  493
DSSP  eeeeeelllleeeeellleeeeeelleeeellllllllllllllLLLLeeellhhhhhll


No 182: Query=mol1A Sbjct=3kciA Z-score=6.8

back to top
DSSP  --------LLLE--------------------------------EEEEllLLLEEEEEE-
Query --------SPQH--------------------------------LLVGgsGWNKIAIIN-   19
ident                                             |        |      
Sbjct tiygwghnHRGQlggiegakvkvptpcealatlrpvqliggeqtLFAV-tADGKLYATGy   59
DSSP  leeeeeelLLLLllllllleeeeeeelhhhhhlleeeeeeelleEEEE-eLLLLEEEEEl


DSSP  ----------llllEEEEEE--ELLLlllllEEEE-lllLLEEEEL-lLEEEEEL-----
Query ----------kdtkEIVWEY--PLEKgwecnSVAA-tkaGEILFSY-sKGAKXIT-----   60
ident                                 ||        |                 
Sbjct gaggrlgiggtesvSTPTLLesIQHV--fikKVAVnsggKHCLALSseGEVYSWGeaedg  117
DSSP  lhhhllllllllleEEEEELhhHLLL--leeEEEEllllLEEEEEEllLLEEEEEllhhh


DSSP  --------lLLLEEEE--EELLlllEEEEEEELLlLLEEEEEELllEEEEEEL-------
Query --------rDGRELWN--IAAPagcEXQTARILPdGNALVAWCGhpSTILEVN-------  103
ident            |             |                                  
Sbjct klghgnrspCDRPRVIesLRGI---EVVDVAAGG-AHSACVTAA--GDLYTWGkgrygrl  171
DSSP  lllllllllEEEEEELhhHLLL---LEEEEEELL-LEEEEEELL--LLEEEEEllhhhll


DSSP  -----lllLEEEEE--EELLllllhhhlllLLEE--lllllEEEEELlLLEEEEEL----
Query -----xkgEVLSKT--EFETgierphaqfrQINK--nkkgnYLVPLFaTSEVREIA----  150
ident                                           |        |        
Sbjct ghsdsedqLKPKLVeaLQGH--------rvVDIAcgsgdaqTLCLTD-DDTVWSWGdgdy  222
DSSP  llllllleEEEEELhhHLLL--------leEEEEellllleEEEEEL-LLEEEEEEllhh


DSSP  --------lllleEEEE---ELLLlllEEEELLlLLEEEELlLLLEEEEELL--------
Query --------pngqlLNSV---KLSGtpfSSAFLDnGDCLVACgDAHCFVQLNL--------  191
ident                        |                                    
Sbjct gklgrggsdgckvPMKIdslTGLG-vvKVECGS-QFSVALT-KSGAVYTWGKgdyhrlgh  279
DSSP  hllllllllleeeEEELhhhLLLL-eeEEEEEL-LEEEEEE-LLLLEEEEELlhhhllll


DSSP  ----llLLEEEEE-EHHHlllllLLEEeeEEELLlLLEEEeeellllllhhhllllleeE
Query ----esNRIVRRV-NANDiegvqLFFVaqLFPLQnGGLYIcnwqghdreagkgkhpqlvE  246
ident        |                                                    
Sbjct gsddhvRRPRQVQgLQGK-----KVIA--IATGS-LHCVC-------------ctedgeV  318
DSSP  llllleEEEEELHhHLLL-----LEEE--EEELL-LEEEE-------------eellllE


DSSP  ELL-----------------LLLEE------------------EEELLlllllllleeee
Query IDS-----------------EGKVV------------------WQLNDkvkfgxisticp  271
ident                         |                                   
Sbjct YTWgdndegqlgdgttnaiqRPRLVaalqgkkvnrvacgsahtLAWST------------  366
DSSP  EEEelllllllllllllleeEEEELhhhlllllleeeeelleeEEELL------------


DSSP  ell
Query ire  274
ident    
Sbjct ---  366
DSSP  ---


No 183: Query=mol1A Sbjct=1fblA Z-score=6.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi   60
DSSP  leelllllllllleeeeeellllllllhhhhhhhhhhhhhhhhllllleeeeelllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe  120
DSSP  eeeeellllllllllllllllleeelllllllllleeeelllllllllllllhhhhhhhh


DSSP  -------------------llleeeeellllleeeeeelllleeeeeeelLLLLLL----
Query -------------------spqhllvggsgwnkiaiinkdtkeivweyplEKGWEC----   37
ident                                                             
Sbjct lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpSGPQTPqvcd  180
DSSP  hhhhlleellllllllllllllllllllllhhhhhhhhhhhlllllllllLLLLLLllll


DSSP  ---------------------lEEEELLLL-LEEEEllleeeeellllleeeeeelllll
Query ---------------------nSVAATKAG-EILFSyskgakxitrdgrelwniaapagc   75
ident                                |                            
Sbjct skltfdaittlrgelmffkdrfYMRTNSFYpEVELN------------------------  216
DSSP  lllllleeeeelleeeeeelleEEEELLLLlLLEEE------------------------


DSSP  eeeeeeellllleeEEEEllleeeeeellllleeeeeeellllllhHHLLllleELLL-L
Query exqtarilpdgnalVAWCghpstilevnxkgevlsktefetgierpHAQFrqinKNKK-G  134
ident                                                             
Sbjct --------------FISV----------------------fwpqvpNGLQ-aayEIADrD  239
DSSP  --------------EHHH----------------------hlllllLLLL-eeeEELLlL


DSSP  LEEEEEllLLEEEEELLlLLEE-EEEEL---------LLLLlEEEEL-LLLLEEEELllL
Query NYLVPLfaTSEVREIAPnGQLL-NSVKL---------SGTPfSSAFL-DNGDCLVACgdA  183
ident                     |                        |  | |        |
Sbjct EVRFFK--GNKYWAVRGqDVLYgYPKDIhrsfgfpstVKNIdAAVFEeDTGKTYFFV--A  295
DSSP  EEEEEE--LLEEEEEELlEELLlLLEEHhhhhlllllLLLLlEEEEElLLLEEEEEE--L


DSSP  LEEEEELLLLLLEE---eEEEHHHLLLLLLLeEEEEEELLlLLEEEEEEllllllhhhll
Query HCFVQLNLESNRIV---rRVNANDIEGVQLFfVAQLFPLQnGGLYICNWqghdreagkgk  240
ident |                    |    |     |   |    | ||               
Sbjct HECWRYDEYKQSMDtgypKMIAEEFPGIGNK-VDAVFQKD-GFLYFFHG-----------  342
DSSP  LEEEEEELLLLEELllllEEHHHHLLLLLLL-LLEEEEEL-LEEEEEEL-----------


DSSP  llLEEEELL-LLLEEEEELllllllllleeeEELL
Query hpQLVEIDS-EGKVVWQLNdkvkfgxisticPIRE  274
ident        |                           
Sbjct -tRQYQFDFkTKRILTLQK---------ansWFNC  367
DSSP  -lEEEEEELlLLEEEEEEE---------llhHHLL


No 184: Query=mol1A Sbjct=1yr2A Z-score=6.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ppypaspqvplvedhfgekvsdpwrwleadvrtdakvaawvqaqsaytaaylkqlperaa   60
DSSP  llllllllllleeeelleeeelllhhhhllllllhhhhhhhhhhhhhhhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lekrmkalidyerfglpqrrgasvfyswnsglmnqsqllvrpadapvgtkgrvlldpntw  120
DSSP  hhhhhhhhlllleellleeelleeeeeeellllllleeeeeellllllllleeeelhhhl


DSSP  -----------llLEEEEE----llLLLEEEEEELLLLEEE-EEEELllllLLLEEEELL
Query -----------spQHLLVG----gsGWNKIAIINKDTKEIV-WEYPLekgwECNSVAATK   44
ident                |          |                |            |   
Sbjct ataldawaasddgRLLAYSvqdggsDWRTVKFVGVADGKPLaDELKW---vKFSGLAWLG  177
DSSP  leeeeeeeellllLEEEEEeeelllLEEEEEEEELLLLLEEeEEEEE---eELLLLEELL


DSSP  LLLEEEEL-------lLEEEEELLLL---LEEEEEEL--LLLLEEeEEEELLLL-LEEEE
Query AGEILFSY-------sKGAKXITRDG---RELWNIAA--PAGCEXqTARILPDG-NALVA   91
ident     | |                            |           |    ||      
Sbjct NDALLYSRfaeplnynQTVWLHRLGTpqsADQPVFATpeLPKRGH-GASVSSDGrWVVIT  236
DSSP  LLEEEEEEllllllllLEEEEEELLLlhhHLEEEELLllLLLLEE-EEEELLLLlEEEEE


DSSP  EEL---lLEEEEEELL----LLLEEEEE-EELLllllhhhllllLEELL-lLLEEEEE-l
Query WCG---hPSTILEVNX----KGEVLSKT-EFETgierphaqfrqINKNK-kGNYLVPL-f  141
ident          |           | |                               |    
Sbjct SSEgtdpVNTVHVARVtngkIGPVTALIpDLKA--------qwdFVDGVgdQLWFVSGdg  288
DSSP  EELllllLLEEEEEEEelleELLLEEEElLLLL--------leeEEEEEllEEEEEELll


DSSP  LLLEEEEELL--------llleeeeeELLLllleEEELLlLLEEEE---llllleeeeel
Query ATSEVREIAP--------ngqllnsvKLSGtpfsSAFLDnGDCLVA---cgdahcfvqln  190
ident |                                                           
Sbjct APLKKIVRVDlsgstprfdtvvpeskDNLE---sVGIAG-NRLFASyihdaksqvlafdl  344
DSSP  LLLLEEEEEElllllleeeeeellllLEEE---eEEEEL-LEEEEEeeelleeeeeeeel


DSSP  LLLLLEEE--------------------eEEHHhllllllleeeeeeellllleeeeeel
Query LESNRIVR--------------------rVNANdiegvqlffvaqlfplqngglyicnwq  230
ident                                                             
Sbjct DGKPAGAVslpgigsasglsgrpgdrhayLSFS---------------------------  377
DSSP  LLLEEEELlllllleeeeeellllllleeEEEE---------------------------


DSSP  lllllhhhllllleeeelLLLLE-------------------------------------
Query ghdreagkgkhpqlveidSEGKV-------------------------------------  253
ident                                                             
Sbjct -sftqpatvlaldpatakTTPWEpvhltfdpadfrveqvfypskdgtkvpmfivrrkdak  436
DSSP  -elleeeeeeeeelllleEEELLlllllllhhheeeeeeeeellllleeeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  253
ident                                                             
Sbjct gplptllygyggfnvaltpwfsagfmtwidsggafalanlrgggeygdawhdagrrdkkq  496
DSSP  lllleeeellllllllllllllhhhhhhhlllleeeeellllllllhhhhhhlllhhhlh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  253
ident                                                             
Sbjct nvfddfiaagewliangvtprhglaieggsngglligavtnqrpdlfaaaspavgvmdml  556
DSSP  hhhhhhhhhhhhhhhlllllllleeeeeelhhhhhhhhhhhhlhhhlleeeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  253
ident                                                             
Sbjct rfdqftagrywvddygypekeadwrvlrryspyhnvrsgvdypailvttadtddrvvpgh  616
DSSP  lhhhlllhhhhhhhhlllllhhhhhhhhlllhhhllllllllleeeeeelllllllllhh


DSSP  -------------------------------------------eeeelllllllllleee
Query -------------------------------------------vwqlndkvkfgxistic  270
ident                                                             
Sbjct sfkytaalqtaaigpkphliriepidkqieetadvqaflahftgltprpwssvdklaaal  676
DSSP  hhhhhhhhhhllllllleeeeellhhhhhhhhhhhhhhhhhhhllllllllhhhhhhhhh


DSSP  eell
Query pire  274
ident     
Sbjct ehhh  680
DSSP  hlll


No 185: Query=mol1A Sbjct=2bwrA Z-score=6.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct svvvisqalpvptripgvadlvgfgnggvyiirnslliqvvkvinnfgydaggwrvekhv   60
DSSP  llleeellllllllllllleeeeeelleeeeelllllllleeeellllllllllllllle


DSSP  ------------------------------------------llleeeeelllLLEEEEE
Query ------------------------------------------spqhllvggsgWNKIAII   18
ident                                                         |   
Sbjct rlladttgdnqsdvvgfgengvwistnngnntfvdppkmvlanfayaaggwrvEKHIRFM  120
DSSP  eeeelllllllleeeeelllleeeelllllllllllleeeellllllllllllLLLEEEE


DSSP  EL----LLLEEeEEEE------------------------------LLLLLLLleEEEL-
Query NK----DTKEIvWEYP------------------------------LEKGWECnsVAAT-   43
ident           |                                              |  
Sbjct ADlrktGRADI-VGFGdggiyisrnngggqfapaqlalnnfgyaqgWRLDRHL-rFLADv  178
DSSP  ELllllLLLEE-EEELllleeeellllllllllleeeellllhhhlLLLLLLE-eEEELl


DSSP  ---LLLLEEEELlleEEEELL-----LLLEEEEEE--------LLLLLEEEeEEEL---L
Query ---KAGEILFSYskgAKXITR-----DGRELWNIA--------APAGCEXQtARIL---P   84
ident                                                             
Sbjct tgdGLLDVVGFGenqVYIARNsgngtFQPAQAVVNnfcigaggWTISAHPR-VVADltgD  237
DSSP  lllLLLEEEEELlllEEEELLlllllLLLLEEEELllllllllLLLLLLLE-EEELlllL


DSSP  LLLEEEEEeLLLEEEEEEL---LLLLEeEEEEELL----LLLLHHHLLLlLEEL---LLL
Query DGNALVAWcGHPSTILEVN---XKGEVlSKTEFET----GIERPHAQFRqINKN---KKG  134
ident          |        |                       |     |        || 
Sbjct RKADILGF-GVAGVYTSLNngnGTFGA-VNLVLKDfgvnSGWRVEKHVR-CVSSltnKKV  294
DSSP  LLLEEEEE-LLLLEEEELLlllLLLLL-LEEEELLllhhHLLLLLLLEE-EEELlllLLL


DSSP  LEEEEELLLLEEEEEL---LLLLEEEEEELLLL----------lLEEEE-LLLLLEEEEL
Query NYLVPLFATSEVREIA---PNGQLLNSVKLSGT----------pFSSAF-LDNGDCLVAC  180
ident                            |                         |      
Sbjct GDIIGFGDAGVYVALNngnGTFGPVKRVIDNFGynqgwrvdkhpRFVVDlTGDGCADIVG  354
DSSP  LEEEEELLLLEEEELLlllLLLLLLEEEELLLLhhhllllllllEEEELlLLLLLLEEEE


DSSP  LL--lLEEEEELLLlLLEEEEEEHHhlllLLLL--------eeeeEEELLLLleeeeeel
Query GD--aHCFVQLNLEsNRIVRRVNANdiegVQLF--------fvaqLFPLQNGglyicnwq  230
ident                                                             
Sbjct FGensVWACMNKGD-GTFGPIMKLI----DDMTvskgwtlqktvrYAANLYL--------  401
DSSP  ELlllEEEEEELLL-LLEEEEEEEE----LLLLhhhlllhhhleeEEELLLL--------


DSSP  lllllhhhllllleeeellllleeeeelllllllllleeeeell
Query ghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                             
Sbjct --------------------------------------------  401
DSSP  --------------------------------------------


No 186: Query=mol1A Sbjct=1vkdA Z-score=6.4

back to top
DSSP  ------------------------------------------------------LLLEEE
Query ------------------------------------------------------SPQHLL    6
ident                                                             
Sbjct hxkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpynGEFVGV   60
DSSP  lllllllllllllllllllllllleeelllllllllllllleeeeeeeeeeeelLEEEEE


DSSP  EE---llLLLEEEEEELL---LLEEE-EEEE-------llllLLLLEEEELL---LLLEE
Query VG---gsGWNKIAIINKD---TKEIV-WEYP-------lekgWECNSVAATK---AGEIL   49
ident                        ||   |                      |      | 
Sbjct FRidhknTRPFLHFGRSKdgiNWEIEpEEIQwvdvngepfqpSYAYDPRVVKiedTYYIT  120
DSSP  EEeeellLLEEEEEEEELlllLLEELlLLLLeelllllllllLLEEEEEEEEellEEEEE


DSSP  EELL---LEEEEELL----LLLEEE-EEELllllEEEEEEELLLL-----LEEEEEEL--
Query FSYS---KGAKXITR----DGRELW-NIAApagcEXQTARILPDG-----NALVAWCG--   94
ident |                      |                  |         |       
Sbjct FCTDdhgPTIGVGXTkdfkTFVRLPnAYVP----FNRNGVLFPRKingkyVXLNRPSDng  176
DSSP  EEEElllEEEEEEEEllllLEEEELlLLLL----LEEEEEELLLLlllleEEEEEELLll


DSSP  ---lleeEEEEL-LLLLEEEEEeellllllhhhllllleellllLEEEEelllleeeeel
Query ---hpstILEVN-XKGEVLSKTefetgierphaqfrqinknkkgNYLVPlfatsevreia  150
ident         |                                     |             
Sbjct htpfgdiFLSESpDXIHWGNHR----------------------FVLGR-----------  203
DSSP  lllllleEEEEElLLLLLEEEE----------------------EEELL-----------


DSSP  lllleeeEEELL------------lllleeeellllleeeellLLLEEEEE--------l
Query pngqllnSVKLS------------gtpfssafldngdclvacgDAHCFVQL--------n  190
ident        |                                       |            
Sbjct ------sSYNWWenlkigagpypietsegwlliyhgvtltcngYVYSFGAAlldlddpsk  257
DSSP  ------lLLLHHhlleeeelllleeelleeeeeeeeeeeelleEEEEEEEEeelllllll


DSSP  lLLLLEEEeEEHHhllLLLL------LEEEEEEELL-----LLLEEEEEELlllllhhhl
Query lESNRIVRrVNANdieGVQL------FFVAQLFPLQ-----NGGLYICNWQghdreagkg  239
ident                             |     |          |              
Sbjct vLYRSRYYlLTPE---EEYEtvgfvpNVVFPCAALCdadtgRVAIYYGAAD---------  305
DSSP  eEEELLLLlLLLL---LHHHhlllllLLEEEEEEEElllllEEEEEEEELL---------


DSSP  llLLEEEELLLlleeeeelllllllllleeeeell
Query khPQLVEIDSEgkvvwqlndkvkfgxisticpire  274
ident                                    
Sbjct --THVALAFGY-----------ideivdfvkrnsx  327
DSSP  --LEEEEEEEE-----------hhhhhhhhhhlll


No 187: Query=mol1A Sbjct=3beqA Z-score=6.3

back to top
DSSP  --------------------------------------------llLEEEEEL-------
Query --------------------------------------------spQHLLVGG-------    9
ident                                                             
Sbjct viltgnsslcpisgwaiyskdngirigskgdvfvirepfiscshleCRTFFLTqgallnd   60
DSSP  llllllllllllleeeeeeellhhhhhllllleeeeeeeeeellllEEEEEEEeeeelll


DSSP  ----------lLLLEEEEEELLLLE---EEEEEELllllLLLEEEEL-LLLLEEEEL---
Query ----------sGWNKIAIINKDTKE---IVWEYPLekgwECNSVAAT-KAGEILFSY---   52
ident                                             |     |         
Sbjct khsngtvkdrsPYRTLMSCPVGEAPspyNSRFESV----AWSASACHdGMGWLTIGIsgp  116
DSSP  hhhllllllllLLLEEEEEELLLLLlllLLEEEEE----LLEEEEEElLLLEEEEEEell


DSSP  ---lLEEEEELlllLEEEEEELLLL--lEEEE--eeeLLLLLEeeEEEL------llEEE
Query ---sKGAKXITrdgRELWNIAAPAG--cEXQT--ariLPDGNAlvAWCG------hpSTI   99
ident                                         |                  |
Sbjct dngaVAVLKYN---GIITDTIKSWRnniLRTQesecaCVNGSCftIMTDgpsngqasYKI  173
DSSP  llllEEEEEEL---LEEEEEEELLLlllLLLLlllleEELLEEeeEEEEllllllleEEE


DSSP  EEELLlLLEEEEEEELLLLllhhHLLLL-LEELLlLLEEEEELL-----lLEEEEELLLL
Query LEVNXkGEVLSKTEFETGIerphAQFRQ-INKNKkGNYLVPLFA-----tSEVREIAPNG  153
ident |     | |    |                     |                      | 
Sbjct LKIEK-GKVTKSIELNAPN---yHYEECsCYPDT-GKVMCVCRDnwhgsnRPWVSFDQNL  228
DSSP  EEEEL-LEEEEEEELLLLL---lLLEEEeEEEEL-LEEEEEEELllllllLEEEEELLLL


DSSP  LEeEEEELL------lllleeeellllleeeellllleeeEELLLLlLEEEEEEHH----
Query QLlNSVKLS------gtpfssafldngdclvacgdahcfvQLNLESnRIVRRVNAN----  203
ident                                                             
Sbjct DY-QIGYICsgvfgdnprpndgtgscgpvssngangikgfSFRYDN-GVWIGRTKStssr  286
DSSP  LE-EEEELLlllllllllllllllllllllllllllllllEEEELL-EEEEEELLLllll


DSSP  -------------------------hlLLLLLlEEEEEE---------elllllEEEEEE
Query -------------------------diEGVQLfFVAQLF---------plqnggLYICNW  229
ident                                       |                     
Sbjct sgfemiwdpngwtetdssfsvrqdivaITDWS-GYSGSFvqhpeltgldcmrpcFWVELI  345
DSSP  eeeeeeeelllllllllllleeeeeeeEEEEL-LLEEEEeelhhhhllllleeeEEEEEE


DSSP  lllLLLHHHL--llLLEEE-------elLLLLEeeeelllllllllleeeeell
Query qghDREAGKG--khPQLVE-------idSEGKVvwqlndkvkfgxisticpire  274
ident                                                       
Sbjct --rGQPKENTiwtsGSSISfcgvnsdtvGWSWP------------dgaelpfsi  385
DSSP  --eELLLLLLlleeEEEEEeeeelllllLLLLL------------lllllllll


No 188: Query=mol1A Sbjct=1tl2A Z-score=6.2

back to top
DSSP  -lllEEEEELllLLEEEEEELL----LLEE--EEEEELllllllleeeellllleeEELL
Query -spqHLLVGGsgWNKIAIINKD----TKEI--VWEYPLekgwecnsvaatkageilFSYS   53
ident      |        |                                             
Sbjct ggesMLRGVY--QDKFYQGTYPqnknDNWLarATLIGK-----------------gGWSN   41
DSSP  llllLEEEEE--LLEEEEELLLllllLLHHhhLEEEEL-----------------lLLLL


DSSP  leeeeellllleeeeeellllleEEEEEELLLLLEEEEEellleEEEEELL---------
Query kgakxitrdgrelwniaapagceXQTARILPDGNALVAWcghpsTILEVNX---------  104
ident                               | |                           
Sbjct -----------------------FKFLFLSPGGELYGVL----nDKIYKGTppthdndnw   74
DSSP  -----------------------LLEEEELLLLLEEEEE----lLEEEEELllllllllh


DSSP  --LLLEEEEEEellllllhhhllllLEELL---LLLEEEEelllleEEEELL--------
Query --KGEVLSKTEfetgierphaqfrqINKNK---KGNYLVPlfatseVREIAP--------  151
ident                                                             
Sbjct mgRAKKIGNGG---------wnqfqFLFFDpngYLYAVSK------DKLYKAsppqsdtd  119
DSSP  hhHLEEEELLL---------hhhllEEEELlllLEEEEEL------LEEEEEllllllll


DSSP  ----LLLEEEEEElllLLLEEEELLLLLEEEELllLLEEEEELL-----LLLL--EEEEE
Query ----NGQLLNSVKlsgTPFSSAFLDNGDCLVACgdAHCFVQLNL-----ESNR--IVRRV  200
ident           |           |  ||           |                     
Sbjct nwiaRATEVGSGG-wsGFKFLFFHPNGYLYAVH--GQQFYKALPpvsnqDNWLarATKIG  176
DSSP  lhhhHLEEEELLL-hhHEEEEEELLLLLEEEEE--LLEEEEELLlllllLLHHhhLEEEE


DSSP  EHhhlllllLLEEEEEEELLLLLEEEEEellllllhhhllLLLEEEELL--------llL
Query NAndiegvqLFFVAQLFPLQNGGLYICNwqghdreagkgkHPQLVEIDS--------egK  252
ident                ||    | |                     |              
Sbjct QG------gWDTFKFLFFSSVGTLFGVQ------------GGKFYEDYPpsyaydnwlaR  218
DSSP  LL------lHHHEEEEEELLLLLEEEEE------------LLEEEEELLlllllllhhhH


DSSP  EEEEELLLlllllllEEEEell
Query VVWQLNDKvkfgxisTICPire  274
ident      |                
Sbjct AKLIGNGG--wddfrFLFF---  235
DSSP  LEEEEELL--hhheeEEEL---


No 189: Query=mol1A Sbjct=1w6sC Z-score=6.1

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeellllleeeeEEELlllleeeeeellleeeeeELLLLL--------eeeEE
Query rdgrelwniaapagcexqtARILpdgnalvawcghpstileVNXKGE--------vlsKT  112
ident                                                             
Sbjct ---ndklvelsksddnwvmPGKN-------------ydsnnFSDLKQinkgnvkqlrpAW   44
DSSP  ---lhhhhhhhllllllllLLLL-------------lllllEELLLLlllllhhheeeEE


DSSP  EELLLLLlhHHLLLLLEELlLLLEEEEELLLLEEEEELL--LLLEEEEEELLL-------
Query EFETGIErpHAQFRQINKNkKGNYLVPLFATSEVREIAP--NGQLLNSVKLSG-------  163
ident  | ||                |                    |  |   |          
Sbjct TFSTGLL--NGHEGAPLVV-DGKMYIHTSFPNNTFALGLddPGTILWQDKPKQnpaarav  101
DSSP  EEELLLL--LLLLLLLEEE-LLEEEEELLLLLLEEEEELllLLLEEEEELLLLlhhhhhh


DSSP  -----llLEEEELLL-----LLEEEELlLLLEEEEELLLLLLEEEEEEHhhllllllLEE
Query -----tpFSSAFLDN-----GDCLVACgDAHCFVQLNLESNRIVRRVNAndiegvqlFFV  213
ident           |            |           || |    |  |             
Sbjct accdlvnRGLAYWPGdgktpALILKTQ-LDGNVAALNAETGETVWKVEN-sdikvgsTLT  159
DSSP  lllllllLLLEEELLlllllLEEEEEL-LLLEEEEEELLLLLEEEEEEL-llhhhllLLL


DSSP  EEEEELLlLLEEEEEELLlLLLHhhllLLLEEEEL-lLLLEEEEELLLL-----------
Query AQLFPLQnGGLYICNWQGhDREAgkgkHPQLVEID-sEGKVVWQLNDKV-----------  261
ident             |                 |   |   |  ||                 
Sbjct IAPYVVK-DKVIIGSSGA-ELGV----RGYLTAYDvkTGEQVWRAYATGpdkdlllasdf  213
DSSP  LLLEEEL-LEEEELLLLH-HHLL----LLEEEEEEllLLLEEEEEELLLlhhhhllllll


DSSP  ------------------------llLLLLEEEEELL-----------------------
Query ------------------------kfGXISTICPIRE-----------------------  274
ident                           |                                 
Sbjct niknphygqkglgtgtwegdawkiggGTNWGWYAYDPgtnliyfgtgnpapwnetmrpgd  273
DSSP  llllhhhllllhhhhlllhhhhhhllLLLLLLLEEELllleeeeellllllllhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct nkwtmtifgrdadtgeakfgyqktphdewdyagvnvmmlseqkdkdgkarkllthpdrng  333
DSSP  llllleeeeeellllleeeeeellllllllllllllleeeeeellllleeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct ivytldrtdgalvsanklddtvnvfksvdlktgqpvrdpeygtrmdhlakdicpsamgyh  393
DSSP  eeeeeellllleeeeeellllllleeeelllllleeelhhhllllllleeeellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct nqghdsydpkrelffmginhicmdwepfmlpykagqffvgatlnmypgpkgdrqnyeglg  453
DSSP  llllleeelllleeeeeeeleeeeeeellllllllllllleeeeeeelllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct qikaynaitgdykwekmerfavwggtmatagdlvfygtldgylkardsdtgdllwkfkip  513
DSSP  eeeeelllllleeeeeeelllllllleeellleeeeelllleeeeeellllleeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct sgaigypmtythkgtqyvaiyygvggwpgvglvfdladptaglgavgafkklanytqmgg  573
DSSP  llllllleeeeelleeeeeeeellllhhhhhhhllllllllhhhhhhhlllhhhllllll


DSSP  -----------------------
Query -----------------------  274
ident                        
Sbjct gvvvfsldgkgpyddpnvgewks  596
DSSP  eeeeeeellllllllllllllll


No 190: Query=mol1A Sbjct=1a12A Z-score=6.1

back to top
DSSP  llleeeeellllleeeeeelllleeeeeEELL----------------------------
Query spqhllvggsgwnkiaiinkdtkeivweYPLE----------------------------   32
ident                                                             
Sbjct --------------kkvkvshrshstepGLVLtlgqgdvgqlglgenvmerkkpalvsip   46
DSSP  --------------llllllllllllllLEEEeeeellllllllllllleeeeeeeelll


DSSP  -LLLLLlEEEELlllleEEELL----LEEEEE-----------llLLLE-EEEEE-lLLL
Query -KGWECnSVAATkageiLFSYS----KGAKXI-----------trDGRE-LWNIA-aPAG   74
ident                                               | |           
Sbjct eDVVQA-EAGGM-----HTVCLsksgQVYSFGcndegalgrdtsvEGSEmVPGKVelQEK  100
DSSP  lLEEEE-EELLL-----EEEEEelllLEEEEElllllllllllllLLHHhLLEELllLLL


DSSP  LEEEEEEElllllEEEEEEL--LLEEEEEE-----------llllLEEEEEEELLLLLlh
Query CEXQTARIlpdgnALVAWCG--HPSTILEV-----------nxkgEVLSKTEFETGIErp  121
ident      |          |                                           
Sbjct VVQVSAGD-----SHTAALTddGRVFLWGSfrdnngvigllepmkKSMVPVQVQLDVP--  153
DSSP  EEEEEELL-----LEEEEEEllLLEEEEELeeelleeeellllllLEEEEEEELLLLL--


DSSP  hHLLLLLEELllllEEEEElLLLEEEEE-----------------------llllLEEEE
Query hAQFRQINKNkkgnYLVPLfATSEVREI-----------------------apngQLLNS  158
ident                || | |                                       
Sbjct -VVKVASGND----HLVMLtADGDLYTLgcgeqgqlgrvpelfanrggrqglerlLVPKC  208
DSSP  -EEEEEELLL----EEEEEeLLLLEEEEellllllllllhhhlllllhhhhhhhhHLLEE


DSSP  EE----------LLLLLlEEEElllllEEEELL--lLLEEEEE----------lllllLE
Query VK----------LSGTPfSSAFldngdCLVACG--dAHCFVQL----------nlesnRI  196
ident |                                    |                     |
Sbjct VMlksrgsrghvRFQDA-FCGA-----YFTFAIsheGHVYGFGlsnyhqlgtpgtescFI  262
DSSP  LLllllllllllLEEEE-EEEL-----LEEEEEellLLEEEEElllllllllllllleEE


DSSP  EEEE-EHHHllllLLLEEEEEEELllllEEEEEELlllllhhhllLLLEEEEL-------
Query VRRV-NANDiegvQLFFVAQLFPLqnggLYICNWQghdreagkgkHPQLVEID-------  248
ident                                |                            
Sbjct PQNLtSFKN--stKSWVGFSGGQH----HTVCMDS----------EGKAYSLGraeygrl  306
DSSP  EEELhHHLL--llLLEEEEEELLL----EEEEEEL----------LLLEEEEEllhhhll


DSSP  -------LLLLEeEEELLLlLLLLLLEEEE------------------------------
Query -------SEGKVvWQLNDKvKFGXISTICP------------------------------  271
ident                                                             
Sbjct glgegaeEKSIP-TLISRL-PAVSSVACGAsvgyavtkdgrvfawgmgtnyqlgtgqded  364
DSSP  lllllllLEEEE-EELLLL-LLEEEEEELLleeeeeelllleeeeellllllllllllll


DSSP  ----------------------------------ell
Query ----------------------------------ire  274
ident                                      
Sbjct awspvemmgkqlenrvvlsvssggqhtvllvkdkeqs  401
DSSP  eeeeeelllllllleeeeeeeellleeeeeeeellll


No 191: Query=mol1A Sbjct=2biwA Z-score=6.1

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeELLL---------llllleeeelllllEEEE
Query spqhllvggsgwnkiaiinkdtkeivweyPLEK---------gwecnsvaatkageILFS   51
ident                                                             
Sbjct ------------------qrsyspqdwlrGYQSqpqewdywvedvegsippdlqgtLYRN   42
DSSP  ------------------lllllhhhhhhLLLLlllleeeellleeellllllleeEEEL


DSSP  LL-----------------LEEEEELLL---lLEEEeEELLLL-----------------
Query YS-----------------KGAKXITRD---gRELWnIAAPAG-----------------   74
ident                                                             
Sbjct GPglleigdrplkhpfdgdGMVTAFKFPgdgrVHFQsKFVRTQgyveeqkagkmiyrgvf  102
DSSP  LLllleelleelllhhhllLEEEEEEELllllLEEEeEELLLHhhhhhhhhlllllllll


DSSP  -------------------LEEEEEEellllleeeEEELLLEeeeeellLLLE--eeeEE
Query -------------------CEXQTARilpdgnalvAWCGHPStilevnxKGEV--lskTE  113
ident                                     | |                     
Sbjct gsqpaggwlktifdlrlknIANTNIT-ywgdrllaLWEGGQP---hrlePSNLatiglDD  158
DSSP  lllllllhhhhllllllllLLLLEEE-eelleeeeELLLLLL---eeelLLLLleeeeLL


DSSP  EL--LLLLlhhHLLLLLEELLL-------LLEEEEELL-----LLEEEEELLLLLEEEEE
Query FE--TGIErphAQFRQINKNKK-------GNYLVPLFA-----TSEVREIAPNGQLLNSV  159
ident                                |           |    |  | | ||   
Sbjct LGgiLAEG--qPLSAHPRIDPAstfdggqPCYVTFSIKsslssTLTLLELDPQGKLLRQK  216
DSSP  LLllLLLL--lLLLLLLEEELLlllllllLEEEEEEEEelleeEEEEEEELLLLLEEEEE


DSSP  E----llLLLLEEEELLlLLEEEEL-------------------------lllLEEEEEL
Query K----lsGTPFSSAFLDnGDCLVAC-------------------------gdaHCFVQLN  190
ident              |                                              
Sbjct TetfpgfAFIHDFAITP-HYAIFLQnnvtlnglpylfglrgagecvqfhpdkpAQIILVP  275
DSSP  EeeeellLLLLLLEELL-LEEEEEElleeellhhhhlllllhhhheeelllllEEEEEEE


DSSP  LLLlLEEEEEEHhhllllLLLEEEEE-EELLL---LLEEEEEELlLLLL-----------
Query LESnRIVRRVNAndiegvQLFFVAQL-FPLQN---GGLYICNWQgHDRE-----------  235
ident         |         |  ||              |                      
Sbjct RDG-GEIKRIPV------QAGFVFHHaNAFEEngkIILDSICYN-SLPQvdtdgdfrstn  327
DSSP  LLL-LLLEEEEE------LLLEEEEEeEEEEElleEEEEEEEEL-LLLLllllllhhhll


DSSP  hhHLLLLLEEEELLL-----LLEEEEELllllLLLLlEEEEE------------------
Query agKGKHPQLVEIDSE-----GKVVWQLNdkvkFGXIsTICPI------------------  272
ident        ||                                                   
Sbjct fdNLDPGQLWRFTIDpaaatVEKQLMVS----RCCE-FPVVHpqqvgrpyryvymgaahh  382
DSSP  hhHLLLLEEEEEEEElllleEEEEEEEL----LLEE-EEELLhhhlllllleeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct stgnaplqailkvdlesgtetlrsfaphgfagepifvprpggvaeddgwllcliykadlh  442
DSSP  lllllllleeeeeelllleeeeeelllleelllleeeellllllllleeeeeeeeellll


DSSP  -----------------------------------ll
Query -----------------------------------re  274
ident                                      
Sbjct rselvildaqditapaiatlklkhhipyplhgswaqt  479
DSSP  eeeeeeeellllllllleeeelllllllllleeeeel


No 192: Query=mol1A Sbjct=2z8rA Z-score=5.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aarqmealnrglvavktdggifvswrflgtenasvlfnvyrdgqklnaapvkttnyvdkn   60
DSSP  lleelllllllleeeeelleeeeellllllllllleeeeeelleellllllllleeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gsagstytvravvngteqpasekasvwaqpyhsvpldkpaggttpkgesytysandasvg  120
DSSP  llllleeeeeeeelleelllllleeeellleeeeelllllleellllleeleeeeeeeee


DSSP  ---------------------------------------------llleeeeelllllee
Query ---------------------------------------------spqhllvggsgwnki   15
ident                                                             
Sbjct dvdgdgqyelilkwdpsnskdnsqdgytgdvlidaykldgtklwrinlgkniragahytq  180
DSSP  lllllllleeeeeeeellllllllllllllleeeeellllleeeeeelllllllllllll


DSSP  EEEEL----lLLEEE---------------------------------------------
Query AIINK----dTKEIV---------------------------------------------   26
ident             |                                               
Sbjct FMVYDldgdgKAEVAmktadgtkdgtgkvignanadyrneqgrvlsgpeyltvfqgstgk  240
DSSP  LEEELlllllLLEEEeeellllllllllllllllllllllllllllllleeeeeelllll


DSSP  ----------------------------------------EEEELLLL------------
Query ----------------------------------------WEYPLEKG------------   34
ident                                                             
Sbjct elvtanfepargnvsdwgdsygnrvdrflagiayldgqrpSLIMTRGYyaktmlvaynfr  300
DSSP  eeeeeelllllllhhhhllllllhhhleeeeeelllllllEEEEEELLlllleeeeeeee


DSSP  -----------------------LLLLEEEEL---lLLLEEEELllEEEEELllLLEEEE
Query -----------------------WECNSVAAT---kAGEILFSYskGAKXITrdGRELWN   68
ident                           |   |                             
Sbjct dgklsklwtldssksgneafagqGNHNLSIADvdgdGKDEIIFG--SMAVDH--DGKGMY  356
DSSP  lleeeeeeeeellllllhhhlllLLLLLEEELllllLLLEEEEL--LEEELL--LLLEEE


DSSP  EELLllLEEEEEEEL---lLLLEEEEEEL------LLEEEEEElllLLEEEEEEELLLlL
Query IAAPagCEXQTARIL---pDGNALVAWCG------HPSTILEVnxkGEVLSKTEFETGiE  119
ident                         |                                |  
Sbjct STGL-gHGDALHTGDldpgRPGLEVFQVHedknakYGLSFRDA---ATGKILWGVYAG-K  411
DSSP  ELLL-lLLLLEEEELllllLLLLEEEEELllllllLLEEEEEL---LLLLEEEEELLL-L


DSSP  LHHhllLLLEEL----LLLLEEEEELllleeEEELLLLLEEE-EEELlllLLEEEE-lLL
Query RPHaqfRQINKN----KKGNYLVPLFatsevREIAPNGQLLN-SVKLsgtPFSSAF-lDN  173
ident       |           |                  |      |               
Sbjct DVG---RGMAADidprYPGQEVWANG-----SLYSAKGVKIGsGVPS--sTNFGIWwdGD  461
DSSP  LLL---LLEEELllllLLLLEEEELL-----EEELLLLLLLLlLLLL--lLLEEELllLL


DSSP  LLEEEELllLLEEEEELLLLLLEEEEEEHHhlllLLLLE-----eeeeEELLL---LLEE
Query GDCLVACgdAHCFVQLNLESNRIVRRVNANdiegVQLFF-----vaqlFPLQN---GGLY  225
ident                             |                               
Sbjct LLREQLD--SNRIDKWDYQNGVSKNMLTAS----GAAANngtkatptlQADLLgdwREEV  515
DSSP  LLLEEEE--LLEEEEEELLLLEEEEEEELL----LEELLlhhhlllleEELLLlllLLEE


DSSP  EeeellllllhhhLLLLleEEELLLlleeeeelllllllllleEEEE-------------
Query IcnwqghdreagkGKHPqlVEIDSEgkvvwqlndkvkfgxistICPI-------------  272
ident                                                             
Sbjct V-------wrtedSSAL--RIYTTTiptehrlytlmhdpvyrlGIAWqniaynqpphtsf  566
DSSP  E-------eeellLLEE--EEELLLlllllllllhhhlhhhhhHHHHlllllllllllll


DSSP  ---------------ll
Query ---------------re  274
ident                  
Sbjct flgdgmaeqpkpnmytp  583
DSSP  llllllllllllleell


No 193: Query=mol1A Sbjct=1itvA Z-score=5.6

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeEEELLlllEEEEEEELLLlLEEEEEELlleEEEEELL---LLLE---eeeeEE
Query rdgrelwNIAAPagcEXQTARILPDgNALVAWCGhpsTILEVNX---KGEV---lsktEF  114
ident                                  |                          
Sbjct -----ddACNVN---IFDAIAEIGN-QLYLFKDG---KYWRFSEgrgSRPQgpfliadKW   48
DSSP  -----llHHHLL---LLLEEEEELL-EEEEEELL---EEEEELLlllLLLEeeeehhhHL


DSSP  LLllllhhhLLLLLEELL-LLLEEEEELllLEEEEELLLlLEEEEEEL--------LLLL
Query ETgierphaQFRQINKNK-KGNYLVPLFatSEVREIAPNgQLLNSVKL--------SGTP  165
ident                                 |         |    |            
Sbjct PA----lprKLDSVFEEPlSKKLFFFSG--RQVWVYTGA-SVLGPRRLdklglgadVAQV  101
DSSP  LL----lllLLLEEEELLlLLLEEEEEL--LEEEEEELL-EEEEEEEHhhhlllllLLLL


DSSP  LEEEELLLLLEEEELLllLEEEEELLLLLLEE--EEEEhhhllllllleeeeeeelllll
Query FSSAFLDNGDCLVACGdaHCFVQLNLESNRIV--RRVNandiegvqlffvaqlfplqngg  223
ident         |  |   |                                            
Sbjct TGALRSGRGKMLLFSG--RRLWRFDVKAQMVDprSASE----------------------  137
DSSP  LEEEELLLLEEEEEEL--LEEEEEELLLLEELhhHLEE----------------------


DSSP  eeeeeellllllhhhlllLLEEeellllleeeeelllllllLLLE---------------
Query lyicnwqghdreagkgkhPQLVeidsegkvvwqlndkvkfgXIST---------------  268
ident                   |                                         
Sbjct -------------vdrmfPGVP-------------------LDTHdvfqfrekayfcqdr  165
DSSP  -------------hhhhlLLLL-------------------LLLLeeeeelleeeeeell


DSSP  --EEEE----------------------ll
Query --ICPI----------------------re  274
ident                               
Sbjct fyWRVSsrselnqvdqvgyvtydilqcped  195
DSSP  eeEEEElllllleeeeeeelllllllllll


No 194: Query=mol1A Sbjct=2ecfA Z-score=5.2

back to top
DSSP  -----llleeeeelllllEEEEEelllleeEEEE--------------------------
Query -----spqhllvggsgwnKIAIInkdtkeiVWEY--------------------------   29
ident                               |                             
Sbjct kltleaitgplplsgptlMKPKV-apdgsrVTFLrgkdsdrnqldlwsydigsgqtrllv   59
DSSP  lllhhhhlllllllllllEEEEE-llllleEEEEellllllleeeeeeeellllleeeee


DSSP  ---elllllllleEEEL-LLLLEEEELLLEEEEELLLLL---EEEEEElLLLLEEEEeEE
Query ---plekgwecnsVAAT-KAGEILFSYSKGAKXITRDGR---ELWNIAaPAGCEXQTaRI   82
ident                    |   ||                          |        
Sbjct dskvvlamtgivdYQWSpDAQRLLFPLGGELYLYDLKQEgkaAVRQLThGEGFATDA-KL  118
DSSP  lhhhlllleelllLEELlLLLEEEEEELLEEEEEELLLLlllLLLLLLlLLLLEEEE-EE


DSSP  LLLLLEEEEEELLlEEEEEELllLLEEEEEEELlLLLLhhHLLL-------------lLE
Query LPDGNALVAWCGHpSTILEVNxkGEVLSKTEFEtGIERphAQFR-------------qIN  129
ident  | |       |                                                
Sbjct SPKGGFVSFIRGR-NLWVIDL--ASGRQMQLTA-DGSTtiGNGIaefvadeemdrhtgYW  174
DSSP  LLLLLEEEEEELL-EEEEEEL--LLLEEEELLL-LLLLleEELLllhhhhhhllllllEE


DSSP  ELLL-LLEEEEELL--------------------------------lLEEEEELL--LLL
Query KNKK-GNYLVPLFA--------------------------------tSEVREIAP--NGQ  154
ident                                                     | |    |
Sbjct WAPDdSAIAYARIDespvpvqkryevyadrtdvieqrypaagdanvqVKLGVISPaeQAQ  234
DSSP  ELLLlLLEEEEEEEllllleeeeeeelllleeeeeeellllllllleEEEEEELLllLLL


DSSP  EeEEEELL----lllleEEELLlLLEEEE---lllllEEEE-ELLLLLLEEE------ee
Query LlNSVKLS----gtpfsSAFLDnGDCLVA---cgdahCFVQ-LNLESNRIVR------rv  200
ident       |              |                      | ||            
Sbjct T-QWIDLGkeqdiylarVNWRDpQHLSFQrqsrdqkkLDLVeVTLASNQQRVlahetspt  293
DSSP  L-EEELLLlllleeeeeEEEEElLEEEEEeeelllleEEEEeEELLLLLEEEeeeeelll


DSSP  eHHHLlllllleeeeeeELLLlleeeeeellllllhhhllllleeeelLLLL--------
Query nANDIegvqlffvaqlfPLQNgglyicnwqghdreagkgkhpqlveidSEGK--------  252
ident                                                             
Sbjct wVPLH---------nslRFLD----------------------dgsilWSSErtgfqhly  322
DSSP  lLLLL---------lllEELL----------------------llleeEEELllllleee


DSSP  -------------------EEEE-------------------------------------
Query -------------------VVWQ-------------------------------------  256
ident                                                             
Sbjct ridskgkaaalthgnwsvdELLAvdekaglayfragiesaresqiyavplqggqpqrlsk  382
DSSP  eellllleeellllllleeEEEEeelllleeeeeelllllllleeeeeelllllleelll


DSSP  ---------------ELLLL----------------------------------------
Query ---------------LNDKV----------------------------------------  261
ident                  |                                          
Sbjct apgmhsasfarnasvYVDSWsnnstppqielfrangekiatlvendladpkhpyaryrea  442
DSSP  llleeeeeellllleEEEEEeelleeeeeeeeelllleeellllllllllllllhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  261
ident                                                             
Sbjct qrpvefgtltaadgktplnysvikpagfdpakrypvavyvyggpasqtvtdswpgrgdhl  502
DSSP  llleeeeeeelllllleeeeeeelllllllllleeeeeelllllllllllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  261
ident                                                             
Sbjct fnqylaqqgyvvfsldnrgtprrgrdfggalygkqgtvevadqlrgvawlkqqpwvdpar  562
DSSP  hhhhhhhllleeeeelllllllllhhhhhllllllllhhhhhhhhhhhhhhlllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  261
ident                                                             
Sbjct igvqgwsnggymtlmllakasdsyacgvagapvtdwglydshyterymdlparndagyre  622
DSSP  eeeeeelhhhhhhhhhhhhlllllleeeeelllllhhhllhhhhhhhhlllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  261
ident                                                             
Sbjct arvlthieglrsplllihgmaddnvlftnstslmsalqkrgqpfelmtypgakhglsgad  682
DSSP  hllhhhhhhlllleeeeeellllllllhhhhhhhhhhhhllllleeeeellllllllhhh


DSSP  -----lllllleeeeell
Query -----kfgxisticpire  274
ident                   
Sbjct alhryrvaeaflgrclkp  700
DSSP  hhhhhhhhhhhhhhhhll


No 195: Query=mol1A Sbjct=3c7xA Z-score=5.1

back to top
DSSP  llleeeeelllLLEEeeeelllleeeeeeelllllLLLEeeellllleeEELLlEEEEel
Query spqhllvggsgWNKIaiinkdtkeivweyplekgwECNSvaatkageilFSYSkGAKXit   60
ident                                                             
Sbjct ---------pnICDG--------------------NFDT-vamlrgemfVFKErWFWRvr   30
DSSP  ---------llHHHL--------------------LLLE-eeeelleeeEEELlEEEEee


DSSP  llllEEEEEELlllleeeeeeellllleeeeeellLEEEeeellllleeeeeeellllll
Query rdgrELWNIAApagcexqtarilpdgnalvawcghPSTIlevnxkgevlsktefetgier  120
ident                                                             
Sbjct nnqvMDGYPMP-------------------igqfwRGLP---------------------   50
DSSP  lleeLLLLLEE-------------------hhhhlLLLL---------------------


DSSP  hhhlLLLLEELLLLLEEEEELllLEEEEELLLLLE---eEEEE------LLLLLLEEEEL
Query phaqFRQINKNKKGNYLVPLFatSEVREIAPNGQL---lNSVK------LSGTPFSSAFL  171
ident            | |                            |               | 
Sbjct --asINTAYERKDGKFVFFKG--DKHWVFDEASLEpgypKHIKelgrglPTDKIDAALFW  106
DSSP  --llLLEEEELLLLLEEEEEL--LEEEEEELLEELllllEEHHhlllllLLLLLLEEEEE


DSSP  -LLLLEEEELllLLEEEEELLLLLLEE--EEEEHHHLLlLLLLEEEEEEELLLlleeeee
Query -DNGDCLVACgdAHCFVQLNLESNRIV--RRVNANDIEgVQLFFVAQLFPLQNgglyicn  228
ident   ||               | |          |    |          |           
Sbjct mPNGKTYFFR--GNKYYRFNEELRAVDseYPKNIKVWE-GIPESPRGSFMGSD-------  156
DSSP  lLLLEEEEEE--LLEEEEEELLLLEELllLLEEHHHLL-LLLLLLLEEEELLL-------


DSSP  ellllllhhhllllLEEEELLlLLEEE-EELLlllllllleeeeell
Query wqghdreagkgkhpQLVEIDSeGKVVW-QLNDkvkfgxisticpire  274
ident                        ||                      
Sbjct ---evftyfykgnkYWKFNNQkLKVEPgYPKS----alrdwmgcpsg  196
DSSP  ---lleeeeeelleEEEEELLlLEELLlLLEE----hhhhlllllll


No 196: Query=mol1A Sbjct=1h2zA Z-score=5.0

back to top
DSSP  ------llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeelll
Query ------spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsysk   54
ident                                                             
Sbjct mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir   60
DSSP  llllllllllllllleeeelleeeelllhhhhllllhhhhhhhhhhhhhhhhhhhhllhh


DSSP  eeeeellllleeeEEELLllleeeeeeELLLlLEEE--eeellleeeeeellllleeeee
Query gakxitrdgrelwNIAAPagcexqtarILPDgNALV--awcghpstilevnxkgevlskt  112
ident                                                             
Sbjct glykermtelydyPKYSC-------hfKKGK-RYFYfyntglqnqrvlyvqdslegearv  112
DSSP  hhhhhhhhhhlllLEELL-------leEELL-EEEEeeellllllleeeeelllllllee


DSSP  EELL----llLLHHhLLLLlEELL-lLLEEEEEL----LLLEEEEELL-LLLEEE-EEEL
Query EFET----giERPHaQFRQiNKNK-kGNYLVPLF----ATSEVREIAP-NGQLLN-SVKL  161
ident                                 |                    |      
Sbjct FLDPnilsddGTVA-LRGY-AFSEdgEYFAYGLSasgsDWVTIKFMKVdGAKELPdVLER  170
DSSP  EELHhhhlllLLEE-EEEE-EELLllLEEEEEEEelllLLEEEEEEELlLLEEEEeEEEE


DSSP  LLLlLEEEEL-LLLLEEEEL---------------lllLEEEEELLLLLL-EEEE-EEHH
Query SGTpFSSAFL-DNGDCLVAC---------------gdaHCFVQLNLESNR-IVRR-VNAN  203
ident        |   |                                 |              
Sbjct VKF-SCMAWThDGKGMFYNAypqqdgksdgtetstnlhQKLYYHVLGTDQsEDILcAEFP  229
DSSP  ELL-LLEEELlLLLEEEEEEllllllllllllllllllLEEEEEELLLLHhHLEEeELLL


DSSP  hllllllLEEEeEEEL-LLLLEEEEEELLLLllhhhllllLEEEELLL---------LLE
Query diegvqlFFVAqLFPL-QNGGLYICNWQGHDreagkgkhpQLVEIDSE---------GKV  253
ident                             | |          |   |            | 
Sbjct ---depkWMGG-AELSdDGRYVLLSIREGCD------pvnRLWYCDLQqesngitgiLKW  279
DSSP  ---llllLEEE-EEELlLLLEEEEEEELLLL------lllEEEEEEHHhllllllllLLL


DSSP  EEEELLLllLLLLleEEEE-----------------------------------------
Query VWQLNDKvkFGXIstICPI-----------------------------------------  272
ident |         |                                                 
Sbjct VKLIDNF--EGEY--DYVTnegtvftfktnrhspnyrlinidftdpeeskwkvlvpehek  335
DSSP  EEEELLL--LLLE--EEEEeelleeeeeellllllleeeeeelllllhhhleeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct dvlewvacvrsnflvlcylhdvkntlqlhdlatgallkifplevgsvvgysgqkkdteif  395
DSSP  leeeeeeeellleeeeeeeelleeeeeeeellllleeeeellllleeeeeelllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct yqftsflspgiiyhcdltkeeleprvfrevtvkgidasdyqtvqifypskdgtkipmfiv  455
DSSP  eeeelllllleeeeeelllllllleeeeelllllllhhheeeeeeeeellllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct hkkgikldgshpaflygyggfnisitpnysvsrlifvrhmggvlavanirgggeygetwh  515
DSSP  eelllllllllleeeellllllllllllllhhhhhhhhhhlleeeeellllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct kggilankqncfddfqcaaeylikegytspkrltingganggllvatcanqrpdlfgcvi  575
DSSP  hlllhhhlhhhhhhhhhhhhhhhhlllllhhheeeeeelhhhhhhhhhhhhlhhhlleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct aqvgvmdmlkfhkytighawttdygcsdskqhfewlikysplhnvklpeaddiqypsmll  635
DSSP  eellllllllhhhlllhhhhhhhhlllllhhhhhhhhhhlhhhllllllllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct ltadhddrvvplhslkfiatlqyivgrsrkqnnpllihvdtkaghgagkptakvieevsd  695
DSSP  eeellllllllhhhhhhhhhhhhhlllllllllleeeeeellllllllllhhhhhhhhhh


DSSP  ---------------ll
Query ---------------re  274
ident                  
Sbjct mfafiarclnidwipgp  712
DSSP  hhhhhhhhhllllllll


No 197: Query=mol1A Sbjct=1xfdA Z-score=5.0

back to top
DSSP  -----------llleeeeellllleeeeeeLLLL--------------------------
Query -----------spqhllvggsgwnkiaiinKDTK--------------------------   23
ident                                                             
Sbjct qkkkvtvedlfsedfkihdpeakwisdtefIYREqkgtvrlwnvetntstvliegkkies   60
DSSP  llllllhhhhllllllllllllllllllllLLLLlllleeellhhhllleeeelllllll


DSSP  -----------eeeEEEE---------------------------------lllLLLLle
Query -----------eivWEYP---------------------------------lekGWECns   39
ident                                                             
Sbjct lrairyeispdreyALFSynvepiyqhsytgyyvlskiphgdpqsldppevsnaKLQY-a  119
DSSP  lllleeeellllleEEEEelllllllllllleeeeeelllllleelllllllllLLLL-l


DSSP  EEELLLLLEEEELlLEEEEE-LLLLLEEEEEELL---LLLEEE--------------EEE
Query VAATKAGEILFSYsKGAKXI-TRDGRELWNIAAP---AGCEXQ--------------TAR   81
ident     |     |                                                 
Sbjct GWGPKGQQLIFIFeNNIYYCaHVGKQAIRVVSTGkegVIYNGLsdwlyeeeilkthiAHW  179
DSSP  LLLLLLLLEEEEElLEEEEElLLLLLLEEEELLLlllLEEEEEllhhhhhlllllleEEE


DSSP  ELLLLLEEEEEEL----------------------------------LLEEEEEELLLlL
Query ILPDGNALVAWCG----------------------------------HPSTILEVNXKgE  107
ident   |||  |                                         |          
Sbjct WSPDGTRLAYAAIndsrvpimelptytgsiyptvkpyhypkagsenpSISLHVIGLNG-P  238
DSSP  ELLLLLEEEEEEEellllleeeellllllllllleeeelllllllllEEEEEEEELLL-L


DSSP  EEEEEEELLL-lllhhHLLLlLEELLLLLEEEEELL----LLEEEEELL-LLLEEEEEEL
Query VLSKTEFETG-ierphAQFRqINKNKKGNYLVPLFA----TSEVREIAP-NGQLLNSVKL  161
ident                                |         |         |        
Sbjct THDLEMMPPDdprmreYYITmVKWATSTKVAVTWLNraqnVSILTLCDAtTGVCTKKHED  298
DSSP  LLLEELLLLLlhhhllEEEEeEEELLLLEEEEEEEEllllEEEEEEEELlLLLEEEEEEE


DSSP  ------LLLLLEEEELLL-LLEEE------------------ellllleeeeelllllle
Query ------SGTPFSSAFLDN-GDCLV------------------acgdahcfvqlnlesnri  196
ident               |                                             
Sbjct eseawlHRQNEEPVFSKDgRKFFFiraipqggrgkfyhitvsssqpnssndniqsitsgd  358
DSSP  elllllLLLLLLLEELLLlLLEEEeeeellllllleeeeeeellllllllllllllllll


DSSP  eEEEE---------------------hHHLL----------------llllleeeeeeeL
Query vRRVN---------------------aNDIE----------------gvqlffvaqlfpL  219
ident                                                             
Sbjct wDVTKilaydekgnkiyflstedlprrRQLYsantvgnfnrqclscdlvenctyfsasfS  418
DSSP  lLEEEeeeeelllleeeeeelllllllLEEEeelllllllllllllllllllllleeeeL


DSSP  LLLleeeeeellllllhhhllllleEEEL-------------------------------
Query QNGglyicnwqghdreagkgkhpqlVEID-------------------------------  248
ident                                                             
Sbjct HSM--------------------dfFLLKcegpgvpmvtvhnttdkkkmfdletnehvkk  458
DSSP  LLL--------------------leEEEElllllllleeeeellllleeeeeellhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  248
ident                                                             
Sbjct aindrqmpkveyrdieiddynlpmqilkpatftdtthyplllvvdgtpgsqsvaekfevs  518
DSSP  hhhllllllllllleeelleeellleelllllllllleeeeeelllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  248
ident                                                             
Sbjct wetvmvsshgavvvkcdgrgsgfqgtkllhevrrrlglleekdqmeavrtmlkeqyidrt  578
DSSP  hhhhhhhlllleeellllllllllhhhhhhllllllllhhhhhhhhhhhhhhlllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  248
ident                                                             
Sbjct rvavfgkdyggylstyilpakgenqgqtftcgsalspitdfklyasafserylglhgldn  638
DSSP  eeeeeeelhhhhhhhhlllllllllllllleeeeellllllllllhhhhhhhhlllllll


DSSP  -------------------------------------------------lllleeeeelL
Query -------------------------------------------------segkvvwqlnD  259
ident                                                             
Sbjct rayemtkvahrvsaleeqqfliihptadekihfqhtaelitqlirgkanyslqiypdesH  698
DSSP  llllllllhhhhlllllleeeeeeelllllllhhhhhhhhhhhhhllllleeeeellllL


DSSP  LLL----------llllleeeeell
Query KVK----------fgxisticpire  274
ident                          
Sbjct YFTssslkqhlyrsiinffvecfri  723
DSSP  LLLlhhhhhhhhhhhhhhhllllll


No 198: Query=mol1A Sbjct=1z68A Z-score=4.8

back to top
DSSP  --------------------------lLLEEeeellllleeeeEELL-------------
Query --------------------------sPQHLlvggsgwnkiaiINKD-------------   21
ident                                                             
Sbjct mraltlkdilngtfsyktffpnwisgqEYLH-----qsadnniVLYNietgqsytilsnr   55
DSSP  lllllhhhhhhlllllllllleellllEEEE-----ellllleEEEEllllleeeeelhh


DSSP  ---------------------lleeeeeeELLL--------------------lllllee
Query ---------------------tkeivweyPLEK--------------------gwecnsv   40
ident                                                             
Sbjct tmksvnasnyglspdrqfvylesdysklwRYSYtatyyiydlsngefvrgnelprpiqyl  115
DSSP  hhhllllleeeellllleeeeeeeeeellLLLEeeeeeeeelllleelllllllllllle


DSSP  eeLLLLleeeellleeeeellLLLE-----------------------------------
Query aaTKAGeilfsyskgakxitrDGRE-----------------------------------   65
ident      |                                                      
Sbjct cwSPVG-------------skLAYVyqnniylkqrpgdppfqitfngrenkifngipdwv  162
DSSP  eeLLLL-------------llEEEEelleeeeellllllleellllllllleeellllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   65
ident                                                             
Sbjct yeeemlatkyalwwspngkflayaefndtdipviaysyygdeqyprtinipypkagaknp  222
DSSP  hhhhllllllleeellllleeeeeeeellllleeeeeellllllleeeeeelllllllll


DSSP  --------------------eeeeellllleeeeeeelllllEEEEE-----elLLEEEE
Query --------------------lwniaapagcexqtarilpdgnALVAW-----cgHPSTIL  100
ident                                                             
Sbjct vvrifiidttypayvgpqevpvpamiassdyyfswltwvtdeRVCLQwlkrvqnVSVLSI  282
DSSP  eeeeeeeelllhhhhlleellllhhhhllleeeeeeeellllEEEEEeeellllEEEEEE


DSSP  EEL----lllleeeeeeELLLL---LLHH-HLLLlLEELLL-LLEEEEE---llLLEEEE
Query EVN----xkgevlskteFETGI---ERPH-AQFRqINKNKK-GNYLVPL---faTSEVRE  148
ident                                             |               
Sbjct CDFredwqtwdcpktqeHIEESrtgWAGGfFVST-PVFSYDaISYYKIFsdkdgYKHIHY  341
DSSP  EEElllllleellhhheEEEELlllLLLLlLLLL-LEELLLlLLEEEEEellllLEEEEE


DSSP  ELLLLLEEEEEE--lLLLLLEEEELlLLLEEEEL------llLLEEEEELLLL-lLEEEE
Query IAPNGQLLNSVK--lSGTPFSSAFLdNGDCLVAC------gdAHCFVQLNLES-nRIVRR  199
ident |                                                   |       
Sbjct IKDTVENAIQITsgkWEAINIFRVT-QDSLFYSSnefeeypgRRNIYRISIGSypPSKKC  400
DSSP  ELLLLLLLEELLlllLLEEEEEEEL-LLEEEEEEllhhhlllLLEEEEEELLLllLLEEE


DSSP  EEHHHllllLLLEEEeEEELL-lLLEEEEEELlllllhhhLLLLlEEEELL-LLLEEEE-
Query VNANDiegvQLFFVAqLFPLQ-nGGLYICNWQghdreagkGKHPqLVEIDS-EGKVVWQ-  256
ident |                                       |        |          
Sbjct VTCHL-rkeRCQYYT-ASFSDyaKYYALVCYG-------pGIPI-STLHDGrTDQEIKIl  450
DSSP  LLLLL-lllLLLLEE-EEELHhhLLEEEEELL-------lLLLE-EEEELLlLLLEEEEe


DSSP  ELLLLL------------------------------------------------------
Query LNDKVK------------------------------------------------------  262
ident    |                                                        
Sbjct EENKELenalkniqlpkeeikklevdeitlwykmilppqfdrskkyplliqvyggpcsqs  510
DSSP  ELLHHHhhhllllllleeeeeeeeelleeeeeeeeellllllllleeeeeeellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct vrsvfavnwisylaskegmvialvdgrgtafqgdkllyavyrklgvyevedqitavrkfi  570
DSSP  llllllllhhhhhhhlllleeeeeellllllllhhhhhhhlllllhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct emgfidekriaiwgwsyggyvsslalasgtglfkcgiavapvssweyyasvyterfmglp  630
DSSP  lllleeeeeeeeeeelhhhhhhhhhhlllllllleeeeellllllllllhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct tkddnlehyknstvmaraeyfrnvdyllihgtaddnvhfqnsaqiakalvnaqvdfqamw  690
DSSP  lllllhhhhhhlllhhhhhhhllleeeeeeellllllllhhhhhhhhhhhhllllleeee


DSSP  -----------------llllleeeeell
Query -----------------fgxisticpire  274
ident                              
Sbjct ysdqnhglsglstnhlythmthflkqcfs  719
DSSP  elllllllllhhhhhhhhhhhhhhhhhhl


No 199: Query=mol1A Sbjct=1r9mB Z-score=4.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct hhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens   60
DSSP  llllllleellhhhhhhlllllllllleelllleeeeelllleeeeellllleeeeelll


DSSP  ------------LLLEeeeellllleeeeeeLLLLE------------------------
Query ------------SPQHllvggsgwnkiaiinKDTKE------------------------   24
ident             |                                               
Sbjct tfdefghsindySISP---------------DGQFIlleynyvkqwrhsytasydiydln  105
DSSP  lllllllleeeeEELL---------------LLLEEeeeeeeeellllleeeeeeeeell


DSSP  -----------------------eeEEEE-------------------------------
Query -----------------------ivWEYP-------------------------------   30
ident                            |                                
Sbjct krqliteeripnntqwvtwspvghkLAYVwnndiyvkiepnlpsyritwtgkediiyngi  165
DSSP  lleellllllllleeeeeellllllEEEEelleeeeellllllleellllllllleeell


DSSP  LLLLL------llleEEEL-LLLLEEE---------------------------------
Query LEKGW------ecnsVAAT-KAGEILF---------------------------------   50
ident                                                             
Sbjct TDWVYeeevfsaysaLWWSpNGTFLAYaqfndtevplieysfysdeslqypktvrvpypk  225
DSSP  LLHHHhhhlllllllEEELlLLLEEEEeeeellllleeeeeellllllllleeeeeelll


DSSP  ----ellLEEEEELLL------lLEEEEEELL------LLLEEEEEEELllLLEEEEEEL
Query ----sysKGAKXITRD------gRELWNIAAP------AGCEXQTARILpdGNALVAWCG   94
ident                |            | ||                            
Sbjct agavnptVKFFVVNTDslssvtnATSIQITAPasmligDHYLCDVTWAT--QERISLQWL  283
DSSP  lllllleEEEEEEEHHhllllllLLEEEELLLhhhhllLEEEEEEEEEE--LLEEEEEEE


DSSP  -----LLEEEEEELL----LLLEEE-EEEELLL--lLLHH-HLLLlLEELLL-LLEEEEE
Query -----HPSTILEVNX----KGEVLS-KTEFETG--iERPH-AQFRqINKNKK-GNYLVPL  140
ident                        |      |                             
Sbjct rriqnYSVMDICDYDessgRWNCLVaRQHIEMSttgWVGRfRPSE-PHFTLDgNSFYKII  342
DSSP  ellllEEEEEEEEEEllllEEEELHhHLEEEELlllLLLLlLLLL-LEELLLlLEEEEEE


DSSP  ---lLLLEEEEELLLLLEEEEEEL--LLLLLEEEELlLLLEEEEL------lllleeeEE
Query ---fATSEVREIAPNGQLLNSVKL--SGTPFSSAFLdNGDCLVAC------gdahcfvQL  189
ident                                  |                          
Sbjct sneeGYRHICYFQIDKKDCTFITKgtWEVIGIEALT-SDYLYYISneykgmpggrnlyKI  401
DSSP  elllLLEEEEEEELLLLLLEELLLllLLEEEEEEEL-LLEEEEEEllhhhllllleeeEE


DSSP  LLLLLLEEEEEEHHhllllLLLEEeeeEELL-lLLEEeeeellllllhhhllllleeeel
Query NLESNRIVRRVNANdiegvQLFFVaqlFPLQ-nGGLYicnwqghdreagkgkhpqlveid  248
ident  |     |                                                    
Sbjct QLSDYTKVTCLSCElnperCQYYS--vSFSKeaKYYQ-----lrcsgpglplytlhssvn  454
DSSP  ELLLLLLEEELLLLlllllLLLEE--eEELLllLEEE-----eeelllllleeeeeelll


DSSP  lLLLEEE-----------------------------------------------------
Query sEGKVVW-----------------------------------------------------  255
ident   |  |                                                      
Sbjct dKGLRVLednsaldkmlqnvqmpskkldfiilnetkfwyqmilpphfdkskkypllldvy  514
DSSP  lLEEEEEellhhhhhhhlleelleeeeeeeeelleeeeeeeeellllllllleeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct agpcsqkadtvfrlnwatylasteniivasfdgrgsgyqgdkimhainrrlgtfevedqi  574
DSSP  lllllllllllllllhhhhhhhhhlleeeeelllllllllhhhhhhhllllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct eaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyt  634
DSSP  hhhhhhhhllleeeeeeeeeeelhhhhhhhhhhlllllllleeeeelllllhhhllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct erymglptpednldhyrnstvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvg  694
DSSP  hhhhllllllllhhhhhhlllhhhhhhhhhleeeeeeelllllllhhhhhhhhhhhhhll


DSSP  --------------------eelllllllllleeeeell
Query --------------------qlndkvkfgxisticpire  274
ident                                        
Sbjct vdfqamwytdedhgiasstahqhiythmshfikqcfslp  733
DSSP  llleeeeelllllllllhhhhhhhhhhhhhhhhhhllll


No 200: Query=mol1A Sbjct=2gbcA Z-score=4.7

back to top
DSSP  --------------------------llLEEEeellllleeEEEELL------lleeeee
Query --------------------------spQHLLvggsgwnkiAIINKD------tkeivwe   28
ident                                           |                 
Sbjct rrtytladylkntfrvksyslrwvsdseYLYK------qenNILLFNaehgnssiflens   54
DSSP  leellhhhhhllllllllllleelllleEEEE------lllLEEEEEllllllleeelll


DSSP  eelllllllleeeeLLLLleeeellleeeeelLLLL------------------------
Query yplekgwecnsvaaTKAGeilfsyskgakxitRDGR------------------------   64
ident                                                             
Sbjct tfeifgdsisdysvSPDR------------lfVLLEynyvkqwrhsytasysiydlnkrq  102
DSSP  lhhhhllleeeeeeLLLL------------leEEEEeeeeeellleeeeeeeeeelllle


DSSP  ----------------------------------------------------eeEEEE--
Query ----------------------------------------------------elWNIA--   70
ident                                                         |   
Sbjct liteekipnntqwitwsqeghklayvwkndiyvkiephlpshritstgkenvifNGINdw  162
DSSP  ellllllllllleeeelllllleeeeelleeeeellllllleellllllllleeELLLlh


DSSP  -LLLLLEeeeeeellLLLE-----------------------------------------
Query -APAGCExqtarilpDGNA-----------------------------------------   88
ident                                                             
Sbjct vYEEEIF--gaysalWWSPngtflayaqfndtgvplieysfysdeslqypktvwipypka  220
DSSP  hHHHHLL--llllleEELHhhleeeeeeeellllleeeeeellllllllleeeeeellll


DSSP  ---------------------------------eeeeellleEEEEellllleEEEEE--
Query ---------------------------------lvawcghpsTILEvnxkgevLSKTE--  113
ident                                                             
Sbjct gavnptvkffivntdslssttttipmqitapasvttgdhylcDVAW---vsedRISLQwl  277
DSSP  llllleeeeeeeehhhhhhlllllleeelllhhhhllleeeeEEEE---eellEEEEEee


DSSP  ----------------------------------ellLLLLHhhllllLEELLLL-LEEE
Query ----------------------------------fetGIERPhaqfrqINKNKKG-NYLV  138
ident                                                       |     
Sbjct rriqnysvmaicdydkttlvwncpttqehietsatgwCGRFR---paePHFTSDGsSFYK  334
DSSP  elllleeeeeeeeeelllleeellhhheeeeelllllLLLLL---lllLEELLLLlEEEE


DSSP  EE---lLLLEEEEELLLL---lEEEEEEL-lLLLLEE-EELLlLLEEEELLLL------L
Query PL---fATSEVREIAPNG---qLLNSVKL-sGTPFSS-AFLDnGDCLVACGDA------H  184
ident                                    |  |                     
Sbjct IVsdkdGYKHICQFQKDRkpeqVCTFITKgaWEVISIeALTS-DYLYYISNEYkempggR  393
DSSP  EEelllLLEEEEEEELLLllllLLEELLLllLLEEEEeEELL-LEEEEEELLHhhllllL


DSSP  EEEEELLLLLLEEEEEEHHHllllLLLEEeeEEELL-lLLEEEEEELlllllhhhLLLLl
Query CFVQLNLESNRIVRRVNANDiegvQLFFVaqLFPLQ-nGGLYICNWQghdreagkGKHPq  243
ident       |                                                |    
Sbjct NLYKIQLTDHTNKKCLSCDLnperCQYYS--VSLSKeaKYYQLGCRG-------pGLPL-  443
DSSP  EEEEEELLLLLLEEELLLLLllllLLLEE--EEELLllLEEEEEELL-------lLLLE-


DSSP  EEEELL-LLLEEE-EELLLLL---------------------------------------
Query LVEIDS-EGKVVW-QLNDKVK---------------------------------------  262
ident      |   |                                                  
Sbjct YTLHRStDQKELRvLEDNSALdkmlqdvqmpskkldfivlnetrfwyqmilpphfdkskk  503
DSSP  EEEEELlLLEEEEeEEELHHHhhhhhheelleeeeeeeeelleeeeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct ypllidvyagpcsqkadaafrlnwatylasteniivasfdgrgsgyqgdkimhainkrlg  563
DSSP  eeeeeeellllllllllllllllhhhhhhhlllleeeeelllllllllhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct tlevedqieaarqflkmgfvdskrvaiwgwsyggyvtsmvlgsgsgvfkcgiavapvsrw  623
DSSP  lhhhhhhhhhhhhhhhllleeeeeeeeeeelhhhhhhhhhhlllllllleeeeelllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct eyydsvyterymglptpednldhyrnstvmsraenfkqveyllihgtaddnvhfqqsaqi  683
DSSP  hhllhhhhhhhhllllllllhhhhhhlllhhhlhhhhhleeeeeeellllllllhhhhhh


DSSP  -----------------------------------llllleeeeell
Query -----------------------------------fgxisticpire  274
ident                                                
Sbjct skalvdagvdfqamwytdedhgiasstahqhiyshmshflqqcfslr  730
DSSP  hhhhhhhlllleeeeelllllllllhhhhhhhhhhhhhhhhhhllll


No 201: Query=mol1A Sbjct=2bklB Z-score=4.7

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct -------sypatraeqvvdtlhgvqvadpyrwledekapevqtwmtaqnaharealakfp   53
DSSP  -------lllllllllleeeelleeeelllhhhhllllhhhhhhhhhhhhhhhhhhhlll


DSSP  lllleeeeeellllleeeeeeELLLLLEEEE-eellleeeeeellllleeeeeeELLL--
Query rdgrelwniaapagcexqtarILPDGNALVA-wcghpstilevnxkgevlskteFETG--  117
ident                          |                                  
Sbjct grealaarfkelfytdsvstpSRRNGRFFYVrthkdkekailywrqgesgqekvLLDPng  113
DSSP  lhhhhhhhhhhhhllleelllEEELLEEEEEeellllllleeeeeelllllleeEELHhh


DSSP  -lllhhhlllLLEEL-LLLLEEEEE----lLLLEEEEELL-LLLEEE--EEELllLLLEE
Query -ierphaqfrQINKN-KKGNYLVPL----fATSEVREIAP-NGQLLN--SVKLsgTPFSS  168
ident                                      |    |                 
Sbjct wskdgtvslgTWAVSwDGKKVAFAQkpnaaDEAVLHVIDVdSGEWSKvdVIEG-gKYATP  172
DSSP  lllllleeeeEEEELlLLLEEEEEEeelllLLLEEEEEELlLLLLLLllLLLL-lLLLLL


DSSP  EELLL-LLEEEEL------------lLLLEEEEELLLLLL-EEEEEEHhhlllllllEEE
Query AFLDN-GDCLVAC------------gDAHCFVQLNLESNR-IVRRVNAndiegvqlfFVA  214
ident                                    |         |           |  
Sbjct KWTPDsKGFYYEWlptdpsikvderpGYTTIRYHTLGTEPsKDTVVHE--rtgdpttFLQ  230
DSSP  EELLLlLEEEEEElllllllllllhhHHLEEEEEELLLLHhHLEEEEL--lllllllEEE


DSSP  EeEELL-lLLEEEEEELLllllhhhlllLLEEEELL-LLLEEEEELLLLlLLLLleEEEE
Query QlFPLQ-nGGLYICNWQGhdreagkgkhPQLVEIDS-EGKVVWQLNDKVkFGXIstICPI  272
ident           |      |                   |                      
Sbjct S-DLSRdgKYLFVYILRG-------wseNDVYWKRPgEKDFRLLVKGVG-AKYE--VHAW  279
DSSP  E-EELLllLLEEEEEEEL-------lleEEEEEELLlLLLLEEEEELLL-LLEE--EEEE


DSSP  L-----------------------------------------------------------
Query R-----------------------------------------------------------  273
ident                                                             
Sbjct Kdrfyvltdegaprqrvfevdpakparaswkeivpedssasllsvsivgghlsleylkda  339
DSSP  Lleeeeeellllllleeeeellllllhhhleeeelllllleeeeeeeelleeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct tsevrvatlkgkpvrtvqlpgvgaasnlmgledlddayyvftsfttprqiyktsvstgks  399
DSSP  eeeeeeeelllleeeellllllleelllllllllleeeeeeeelleeeeeeeeellllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct elwakvdvpmnpeqyqveqvfyaskdgtkvpmfvvhrkdlkrdgnaptllygyggfnvnm  459
DSSP  eeeeellllllhhheeeeeeeeellllleeeeeeeeelllllllllleeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct eanfrssilpwldaggvyavanlrgggeygkawhdagrldkkqnvfddfhaaaeylvqqk  519
DSSP  lllllhhhhhhhhllleeeeelllllllllhhhhhlllhhhlhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct ytqpkrlaiyggsnggllvgaamtqrpelygavvcavplldmvryhlfgsgrtwipeygt  579
DSSP  lllhhheeeeeelhhhhhhhhhhhhlhhhlleeeeellllllllhhhlllhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct aekpedfktlhayspyhhvrpdvrypallmmaadhddrvdpmharkfvaavqnspgnpat  639
DSSP  lllhhhhhhhhhhlhhhllllllllleeeeeeellllllllhhhhhhhhhhhllllllll


DSSP  -------------------------------------l
Query -------------------------------------e  274
ident                                       
Sbjct allrieanaghggadqvakaiessvdlysflfqvldvq  677
DSSP  eeeeeellllllllllhhhhhhhhhhhhhhhhhhllll


No 202: Query=mol1A Sbjct=1pexA Z-score=4.6

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelLLLLLLLeeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplEKGWECNsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct ---------------------------tpdkCDPSLSL----------------------   11
DSSP  ---------------------------llllLLLLLLL----------------------


DSSP  lllleeeeeellllleeEEEEELLLlLEEEEEELlleEEEEELLL-LLEEEE---eEELL
Query rdgrelwniaapagcexQTARILPDgNALVAWCGhpsTILEVNXK-GEVLSK---tEFET  116
ident                       |                                     
Sbjct -----------------DAITSLRG-ETMIFKDR---FFWRLHPQqVDAELFltksFWPE   50
DSSP  -----------------LEEEEELL-EEEEEELL---EEEEELLLlLLLEEEehhhHLLL


DSSP  llllhhhLLLLLEELL-LLLEEEEELllLEEEEELlLLLEE--EEEEL--------LLLL
Query gierphaQFRQINKNK-KGNYLVPLFatSEVREIApNGQLL--NSVKL--------SGTP  165
ident                                         |     |             
Sbjct ----lpnRIDAAYEHPsHDLIFIFRG--RKFWALN-GYDILegYPKKIselglpkeVKKI  103
DSSP  ----lllLLLEEEEELlLLEEEEEEL--LEEEEEL-LLLLLllLLEELllllllllLLLL


DSSP  LEEEEL-LLLLEEEELLllLEEEEELLLLLLEEEeeehhhllllllleeeeeeellllle
Query FSSAFL-DNGDCLVACGdaHCFVQLNLESNRIVRrvnandiegvqlffvaqlfplqnggl  224
ident        | |  |   |                                           
Sbjct SAAVHFeDTGKTLLFSG--NQVWRYDDTNHIMDK--------------------------  135
DSSP  LEEEELlLLLEEEEEEL--LEEEEEELLLLEELL--------------------------


DSSP  eeeeellllllhhhlllLLEEEellllleeeeelllllllllleEEEE------------
Query yicnwqghdreagkgkhPQLVEidsegkvvwqlndkvkfgxistICPI------------  272
ident                  |                                          
Sbjct -------dyprlieedfPGIGD---kvdavyekngyiyffngpiQFEYsiwsnrivrvmp  185
DSSP  -------lllllhhhhlLLLLL---llleeeeelleeeeeelleEEEEelllleeeeeee


DSSP  -----ll
Query -----re  274
ident        
Sbjct ansilwc  192
DSSP  hhhhhll


No 203: Query=mol1A Sbjct=1jtdB Z-score=4.5

back to top
DSSP  llleeeeelLLLLEEEEEEL-llleeeEEEELlllLLLLEEEELllLLEEEeLLLE-EEE
Query spqhllvggSGWNKIAIINK-dtkeivWEYPLekgWECNSVAATkaGEILFsYSKG-AKX   58
ident                                                  |     |    
Sbjct ---------VAATSVVAWGGnndwgeaTVPAEaqsGVDAIAGGY--FHGLA-LKGGkVLG   48
DSSP  ---------LLLLEEEEELLlllllllLLLHHhllLEEEEEELL--LEEEE-EELLeEEE


DSSP  ELL----llleeeeEELLllleEEEEEELLlLLEEEEEElllEEEEEELL-lllEEEE--
Query ITR----dgrelwnIAAPagceXQTARILPdGNALVAWCghpSTILEVNX-kgeVLSK--  111
ident                                   |                         
Sbjct WGAnlngqltmpaaTQSG----VDAIAAGN-YHSLALKD---GEVIAWGGnedgQTTVpa  100
DSSP  EELlllllllllhhHHLL----LLEEEELL-LEEEEEEL---LEEEEEELllllLLLLlh


DSSP  -EEELlllllhhhllllleellllleEEEElllleEEEE---------llllleeEEEEL
Query -TEFEtgierphaqfrqinknkkgnyLVPLfatseVREI---------apngqllNSVKL  161
ident                                       |                 |   
Sbjct eARSG----------vdaiaagawasYALK----dGKVIawgddsdgqttvpaeaQSGVT  146
DSSP  hHHLL----------lleeeeelleeEEEE----lLEEEeeellllllllllhhhHLLEE


DSSP  llllleEEELllLLEEEellllleeEEELL---lllLEEE-----------------eEE
Query sgtpfsSAFLdnGDCLVacgdahcfVQLNL---esnRIVR-----------------rVN  201
ident                |         |            |                     
Sbjct -----aLDGG-vYTALA---vknggVIAWGdnyfgqTTVPaeaqsgvddvaggifhslAL  197
DSSP  -----eEEEL-lLEEEE---eelleEEEEEllllllLLLLhhhllleeeeeellleeeEE


DSSP  HH---------------hlLLLL-lLEEEEEEELllllEEEEEELlllllhhhlllLLEE
Query AN---------------diEGVQ-lFFVAQLFPLqnggLYICNWQghdreagkgkhPQLV  245
ident                                                             
Sbjct KDgkviawgdnrykqttvpTEALsgVSAIASGEW----YSLALKN----------gKVIA  243
DSSP  ELleeeeeellllllllllHHHHllLLEEEELLL----LEEEEEL----------lEEEE


DSSP  EELlllleEEEELLL-lLLLLLLEEEE-----ell
Query EIDsegkvVWQLNDK-vKFGXISTICP-----ire  274
ident                           |        
Sbjct WGS-----SRTAPSSvqSGVSSIEAGPnaayalkg  273
DSSP  ELL-----LLLLLHHhlLLEEEEEELLlleeeeel


No 204: Query=mol1A Sbjct=1qjsA Z-score=4.4

back to top
DSSP  llleeeeellLLLEeeeeelllleeeeeeellllLLLLeeeellllleeeellleeeeel
Query spqhllvggsGWNKiaiinkdtkeivweyplekgWECNsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct --------ieQCSD--------------------GWSF----------------------   10
DSSP  --------lhHHLL--------------------LLLL----------------------


DSSP  lllleeeeeellllleeEEEEELLLLLEEEEEELlleeeeeELLLLLE---eeEEEELLl
Query rdgrelwniaapagcexQTARILPDGNALVAWCGhpstileVNXKGEV---lsKTEFETg  117
ident                          |  |                |              
Sbjct -----------------DATTLDDNGTMLFFKDE----fvwKSHRGIReliseRWKNFI-   48
DSSP  -----------------LEEEELLLLLEEEEELL----eeeELLLLEEeehhhHLLLLL-


DSSP  lllhhhLLLLLEELLLLLEEEEELLlleeEEELL-----LLLEE---EEEE-LLLLLLEE
Query ierphaQFRQINKNKKGNYLVPLFAtsevREIAP-----NGQLL---NSVK-LSGTPFSS  168
ident                                                             
Sbjct -----gPVDAAFRHGHTSVYLIKGD---kVWVYTsekneKVYPKslqDEFPgIPFPLDAA  100
DSSP  -----lLLLEEEEELLLEEEEEELL---eEEEEElllllLLLLEehhHHLLlLLLLLLEE


DSSP  EELLL-----LLEEEELLllLEEEEELLLLLLEeEEEEHHhllllLLLEEEEEeelllll
Query AFLDN-----GDCLVACGdaHCFVQLNLESNRIvRRVNANdiegvQLFFVAQLfplqngg  223
ident              |   |         |                                
Sbjct VECHRgecqdEGILFFQG--NRKWFWDLTTGTK-KERSWP-----AVGNCTSA-------  145
DSSP  EEELLlllllLEEEEEEL--LEEEEEELLLLEE-EEELLL-----LLLLLLEE-------


DSSP  eeeeeellllllhhhllllLEEEEL-llLLEE-EEEL-----------------------
Query lyicnwqghdreagkgkhpQLVEID-seGKVV-WQLN-----------------------  258
ident                    |        | |                             
Sbjct ------lrwlgryycfqgnQFLRFNpvsGEVPpGYPLdvrdyflscpgrghrsshrhghe  199
DSSP  ------eeelleeeeeellEEEELLlllLLLLlLLLEehhhllllllllllllllllllh


DSSP  --------------------------llllllllleeeEELL------------------
Query --------------------------dkvkfgxisticPIRE------------------  274
ident                                                             
Sbjct strcdpdlvlsamvsdnhgatyvfsgshywrldtnrdgWHSWpiahqwpqgpstvdaafs  259
DSSP  hhhhllllllleeeellllleeeeelleeeelllllllLLEEehhhhllllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct wedklyliqdtkvyvfltkggytlvngypkrlekelgsppvisleavdaafvcpgssrlh  319
DSSP  elleeeeeelleeeeeellllleellllleehhhhhlllllllllllleeelllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct imagrrlwwldlksgaqatwtelpwphekvdgalcmekplgpnscstsgpnlylihgpnl  379
DSSP  eeelleeeeeelllhhhllleeelllllllleeeeelllllllllllllleeeeeellee


DSSP  -----------------------------
Query -----------------------------  274
ident                              
Sbjct ycyrhvdklnaaknlpqpqrvsrllgcth  408
DSSP  eeellhhhhhhllllllleehhhhlllll


No 205: Query=mol1A Sbjct=3ba0A Z-score=4.4

back to top
DSSP  llleeeeellllleeeeeellllEEEE---------------------------------
Query spqhllvggsgwnkiaiinkdtkEIVW---------------------------------   27
ident                                                             
Sbjct -------------------gpvwRKHYityrinnytpdmnredvdyairkafqvwsnvtp   41
DSSP  -------------------llllLLLLeeeeelllllllllhhhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   27
ident                                                             
Sbjct lkfskintgmadilvvfargahgddhafdgkggilahafgpgsgiggdahfdedefwtth  101
DSSP  lleeellllllleeeeeellllllllllllllllleeelllllllllleeeelllleell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   27
ident                                                             
Sbjct sggtnlfltavheighslglghssdpkavmfptykyvdintfrlsaddirgiqslygdpk  161
DSSP  llleellhhhhhhhhhhhlllllllllllllllllllllllllllhhhhhhhhlllllll


DSSP  -----------eeelLLLLLLLeeeellllleeeellleeeeellllleeeeeellllle
Query -----------eyplEKGWECNsvaatkageilfsyskgakxitrdgrelwniaapagce   76
ident                                                             
Sbjct enqrlpnpdnsepalCDPNLSF--------------------------------------  183
DSSP  lllllllllllllllLLLLLLL--------------------------------------


DSSP  eEEEEELLLlLEEEEEELlleeeEEELL-LLLEE----eeEEELLLlllhhhLLLLLEEL
Query xQTARILPDgNALVAWCGhpstiLEVNX-KGEVL----skTEFETGierphaQFRQINKN  131
ident                                                             
Sbjct -DAVTTVGN-KIFFFKDR---ffWLKVSeRPKTSvnlissLWPTLP-----sGIEAAYEI  233
DSSP  -LLEEEELL-EEEEEELL---eeEELLLlLLLLLeeehhhHLLLLL-----lLLLEEEEE


DSSP  L-LLLEEEEELllLEEEEELLlLLEE---eEEEL-------LLLLLEEEEL-LLLLEEEE
Query K-KGNYLVPLFatSEVREIAPnGQLL---nSVKL-------SGTPFSSAFL-DNGDCLVA  179
ident                   |                              |          
Sbjct EaRNQVFLFKD--DKYWLISN-LRPEpnypKSIHsfgfpnfVKKIDAAVFNpRFYRTYFF  290
DSSP  HhHLEEEEEEL--LEEEELLL-LLLLllllEELLlllllllLLLLLEEEEElLLLEEEEE


DSSP  LLllLEEEEELLLLLLEE--EEEEhhhllllllLEEEEeeellllleeeeeellllllhh
Query CGdaHCFVQLNLESNRIV--RRVNandiegvqlFFVAQlfplqngglyicnwqghdreag  237
ident                                                             
Sbjct VD--NQYWRYDERRQMMDpgYPKL-itknfqgiGPKID----------------------  325
DSSP  EL--LEEEEEELLLLEELllLLLL-hhhhllllLLLLL----------------------


DSSP  hllllleeeellllleeeeelllllllllleEEEE-----------------ll
Query kgkhpqlveidsegkvvwqlndkvkfgxistICPI-----------------re  274
ident                                                       
Sbjct --------------avfysknkyyyffqgsnQFEYdfllqritktlksnswfgc  365
DSSP  --------------eeeeellleeeeeelleEEEEelllleeeeeeelllllll


No 206: Query=mol1A Sbjct=2b4wA Z-score=4.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kqvkaafeankrvyesvlltfkgvdgydvyncsvpfsykgkthiygrvekrdiwaashvr   60
DSSP  lhhhhhhhhhlllleeeeleeellllleeellllleeelleeeeeeeeelllllllleee


DSSP  ---------------------------llLEEEEELLL------LLEEEeeelllLEEEe
Query ---------------------------spQHLLVGGSG------WNKIAiinkdtKEIVw   27
ident                                   ||                    |   
Sbjct lfeetgkdeftavpelsweledpyiakinNEXIFGGTRvrilsyYGYFY--rgtpDELTy  118
DSSP  eeeeeelleeeelllllllleeeeeeeelLEEEEEEEEelllleEEEEE--eeelLEEEe


DSSP  EEELLLLLLLLEEEELL-LLLEEE--ellLEEEEELLL----------llEEEEEELlLL
Query EYPLEKGWECNSVAATK-AGEILF--sysKGAKXITRD----------grELWNIAApAG   74
ident             |          |                                    
Sbjct FTRGPGCXKDIRVLQLQdGRLGVFsrprvASIGFVILNsidelgaeviakAPPLDIL-NA  177
DSSP  EEELLLLLLLLEEEELLlLLEEEEellllLLEEEEEELlhhhllhhhhhlLLEELLL-LE


DSSP  LEEEEEEELLL--LLEEEEEEL----LLEEEEEELL---LLLEEEEEEELLL--------
Query CEXQTARILPD--GNALVAWCG----HPSTILEVNX---KGEVLSKTEFETG--------  117
ident         |                        |           |              
Sbjct WGGVNQAYLLSsgKVGCIGHYSyeqsVYVNYAFVLDpqsRAITGAKIIGTKScyppcepk  237
DSSP  EEEEEEEEEELllLEEEEEEEEelllEEEEEEEEELlllLLEEEEEEEELHHhlllllll


DSSP  ---LLLHhhlllLLEELLL----LLEEEEELLlLEEEEELLLlleeeeeelllllleeee
Query ---IERPhaqfrQINKNKK----GNYLVPLFAtSEVREIAPNgqllnsvklsgtpfssaf  170
ident                                  |    |                     
Sbjct vplLADC---vfASGIVXRsdgkVDLYSGVGD-SHEGRITID------------------  275
DSSP  lhhHLLL---eeEEEEEELllllEEEEEEELL-LEEEEEEEL------------------


DSSP  llllleeeellllleeeeelllllleeeeeehhhllllllleeeeeEELLLlleeeeeel
Query ldngdclvacgdahcfvqlnlesnrivrrvnandiegvqlffvaqlFPLQNgglyicnwq  230
ident                                                             
Sbjct ----------------------------------ypfkghgtiigdLHFPX---------  292
DSSP  ----------------------------------lllllllleellLEELL---------


DSSP  lllllhhhllllleeeellllleeeeelllllllllleeeeell
Query ghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                             
Sbjct --------------------------------------------  292
DSSP  --------------------------------------------


No 207: Query=mol1A Sbjct=2gu3A Z-score=4.0

back to top
DSSP  -----------------lLLEEEEEllllleeeeeelllleeeeeeelllllllleeeel
Query -----------------sPQHLLVGgsgwnkiaiinkdtkeivweyplekgwecnsvaat   43
ident                        |                                    
Sbjct keegheaaaaeakketdlAHVDQVE-tfvgkekyyvvkgtdkkgtalyvwvpadkkakil   59
DSSP  llllhhhhhhhhhhhlleEEEEEEE-eeellleeeeeeeeelllleeeeeeellllllle


DSSP  LLLLeeeellleeeeellllleeeEEEL--lllLEEEEEEELLL---LLEEEEEEL--LL
Query KAGEilfsyskgakxitrdgrelwNIAA--pagCEXQTARILPD---GNALVAWCG--HP   96
ident                          |                         |        
Sbjct SKEA----------kegisedkaaKIIKdeglvSKQKEVHLAREgnvLLWEVTYLDkeGQ  109
DSSP  EEEH----------hhlllhhhhhHHHHhllllLEEEEEEEEEElleEEEEEEEELllLL


DSSP  EEEEEELL-LLLEEEEEEEllllllhhhllllleellllleeeeelllleeeeellllle
Query STILEVNX-KGEVLSKTEFetgierphaqfrqinknkkgnylvplfatsevreiapngql  155
ident      |    |  |                                              
Sbjct YSLSYVDFtTGKILKNITP-----------------------------------------  128
DSSP  EEEEEEELlLLLEEEEELL-----------------------------------------


DSSP  eeeeelllllleeeellllleeeellllleeeeelllllleeeeeehhhllllllleeee
Query lnsvklsgtpfssafldngdclvacgdahcfvqlnlesnrivrrvnandiegvqlffvaq  215
ident                                                             
Sbjct ------------------------------------------------------------  128
DSSP  ------------------------------------------------------------


DSSP  eeellllleeeeeellllllhhhllllleeeellllleeeeelllllllllleeeeell
Query lfplqngglyicnwqghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                                            
Sbjct -----------------------------------------------------------  128
DSSP  -----------------------------------------------------------


No 208: Query=mol1A Sbjct=1n7vA Z-score=3.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct anfnvpklgvfpvaavfdidnvpedssatgsrwlpsiyqggnywgggpqalhaqvsnfds   60
DSSP  leeeeleeeelleeeeeeellllllllllllllllllllhhheelllleeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snrlpynprtennpagncafafnpfgqyisnissaqsvhrriygidlndeplfspnaasi  120
DSSP  lleeellllllllllllllllllleeellllhhhhhhhhhhhllllllllllleelhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tnggnptmsqdtgyhnigpintaykaeifrpvnplpmsdtapdpetlepgqtepliksdg  180
DSSP  hhhhlllleelllleeelleeeleeeeeeeelllllleeeeelllllleeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vysnsgiasfifdrpvtepnpnwpplpppvipiiyptpalgigaaaaygfgyqvtvyrwe  240
DSSP  llllllleelllllleeeelllllllllleeeeelllhhhleeeeeeeeeeeeeeeeell


DSSP  --------------------------------------------------llleeeeell
Query --------------------------------------------------spqhllvggs   10
ident                                                             
Sbjct eipveflnpegspcayeagiilvrqtsnpmnavagrlvpyvediavdifltgkfftlnpp  300
DSSP  lllllllllllllllllllleeeellllllleeeelleeeeeeeeeeeeeeeeeeeelll


DSSP  lllEEEEEELllLEEEEEEE-------llLLLL-llEEEEllllLEEEELLL------ee
Query gwnKIAIINKdtKEIVWEYP-------leKGWE-cnSVAAtkagEILFSYSK------ga   56
ident              |                                              
Sbjct lriTNNYFAD--DEVKENTVtignytttlSSAYyavYKTD-gygGATCFIASggagisal  357
DSSP  eeeEEEELLL--LLLLLLEEeellllleeEELLeeeEEEL-lllEEEEEEELllleeeee


DSSP  EEELLlLLEEEEEELLLLleeeeeeellllleeeeeELLLEE--EEEEllllleeeeeee
Query KXITRdGRELWNIAAPAGcexqtarilpdgnalvawCGHPST--ILEVnxkgevlsktef  114
ident          |                                                  
Sbjct VQLQD-NSVLDVLYYSLP------------lslggsKAAIDEwvANNC------------  392
DSSP  EEEEL-LEEEEEEEEEEL------------hhhlllHHHHHHhhHHHH------------


DSSP  llllllhhhlllLLEEllllleeEEELL-LLEEEEE------lLLLL-EEEEEEL-----
Query etgierphaqfrQINKnkkgnylVPLFA-TSEVREI------aPNGQ-LLNSVKL-----  161
ident                                |             |        |     
Sbjct ---------glfPMSG-------GLDKTtLLEIPRRqleainpQDGPgQYDLFILddsga  436
DSSP  ---------lllLLLL-------LLEELlLEEEEHHhhhllllLLLLlLLLEEEElllll


DSSP  ---LLLLlEEEELLlLLEEEELLL------lLEEEEELLlLLLEEEEEEHhhLLLL----
Query ---SGTPfSSAFLDnGDCLVACGD------aHCFVQLNLeSNRIVRRVNAndIEGV----  208
ident                                                             
Sbjct yasFSSF-IGYPEA-AYYVAGAATfmdvenpDEIIFILR-NGAGWYACEI--GDALkiad  491
DSSP  lllLLLL-EEEEEL-LEEEEEEELlllllllLEEEEEEL-LLLLEEEEEL--HHHHllll


DSSP  ---LLLEeEEEEELlllLEEEEEELlllllHHHL-----LLLLEEEELLLlleeeeelll
Query ---QLFFvAQLFPLqngGLYICNWQghdreAGKG-----KHPQLVEIDSEgkvvwqlndk  260
ident                  |                            |             
Sbjct defDSVD-YFAYRG---GVMFIGSA-----RYTEggdplPIKYRAIIPGL----------  532
DSSP  lllLLLL-EEEEEL---LEEEEEEL-----LLLLlllllLLEEEEEEELL----------


DSSP  llllllleeeeell
Query vkfgxisticpire  274
ident               
Sbjct -------------p  533
DSSP  -------------l


No 209: Query=mol1A Sbjct=1suuA Z-score=3.7

back to top
DSSP  ---llleeeeellllleeeeeELLLL-EEEEEEE-LLLLLLLLEEEELLllleeeellle
Query ---spqhllvggsgwnkiaiiNKDTK-EIVWEYP-LEKGWECNSVAATKageilfsyskg   55
ident                                    |  | |                   
Sbjct enivvmltkkgflkrlsqneyKLQGTgGKGLSSFdLNDGDEIVIALCVN-----------   49
DSSP  leeeeeeelllleeeeehhhlLLLLLlLLLEELLlLLLLLLEEEEEEEE-----------


DSSP  eeeellllleeeeeellllleeeeeeelllLLEEEEEELllEEEEEELLLL---------
Query akxitrdgrelwniaapagcexqtarilpdGNALVAWCGhpSTILEVNXKG---------  106
ident                                                |            
Sbjct ----------------------------thDYLFMISNE--GKLYLINAYEikdqnisel   79
DSSP  ----------------------------llLEEEEEELL--LEEEEEEHHHlllllhhhl


DSSP  ---------------------------------------lEEEEEE-ELLLLLlhhHLLL
Query ---------------------------------------eVLSKTE-FETGIErphAQFR  126
ident                                                             
Sbjct inlgdqeeiltiknskdltddaylllttasgkiarfestdFKAGVIvIKLNDK---DFVT  136
DSSP  lllllllleeeeeeellllllleeeeeellleeeeeehhhHLLLEElLLLLLL---LLEE


DSSP  LLEELLLlleeeeelllleeeeellllleeeeeelllllleeeelllLLEEEELLlLLEE
Query QINKNKKgnylvplfatsevreiapngqllnsvklsgtpfssafldnGDCLVACGdAHCF  186
ident       |                                                     
Sbjct SAEIVFK---------------------------------------dEKVICLSK-KGSA  156
DSSP  EEEEELL---------------------------------------lLEEEEEEL-LLEE


DSSP  EEELLLLL----------------------------------------------------
Query VQLNLESN----------------------------------------------------  194
ident    |                                                        
Sbjct FIFNSRDVrltnrgtqgvcgmklkegdlfvkvlsvkenpyllivsengygkrlnmskise  216
DSSP  EEEEHHHLllllllllleellllllllleeeeeellllleeeeeellleeeeeehhhlll


DSSP  -LEEE-EEEHhhllllllLEEEEEEELLLlleeeeeellllllhhhllllleeEELLLL-
Query -RIVR-RVNAndiegvqlFFVAQLFPLQNgglyicnwqghdreagkgkhpqlvEIDSEG-  251
ident                     |                                       
Sbjct lKRGAtGYTSykksdkkaGSVVDAIAVSE----ddeillvskrskalrtvagkVSEQGKd  272
DSSP  lLLLLlLEELllllllllLLEEEEEEELL----lleeeeeellleeeeeehhhLLLLLLl


DSSP  LEEEEELLLLllLLLLEEEEELl
Query KVVWQLNDKVkfGXISTICPIRe  274
ident     |                  
Sbjct ARGIQVLFLD-nDSLVSVSKFI-  293
DSSP  LLLEELLLLL-lLLEEEEEELL-


No 210: Query=mol1A Sbjct=3f6kA Z-score=3.4

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeelllllllleeeellllleeeellleeeeel
Query spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakxit   60
ident                                                             
Sbjct ----------------------------------------------------rvrdfvak    8
DSSP  ----------------------------------------------------llllhhhh


DSSP  llLLEEEEEE-lLLLLEeeeeeellllleeeeeellleEEEEellllleEEEEE------
Query rdGRELWNIA-aPAGCExqtarilpdgnalvawcghpsTILEvnxkgevLSKTE------  113
ident               |                                             
Sbjct laNNTHQHVFddLRGSV--------------------sLSWV---gdstGVILVlttfhv   45
DSSP  hhLLEEEEEEllLLLEE--------------------eEEEL---llllLLEEEeeeell


DSSP  ----------------------elLLLLlhhhLLLL-LEELL--LLLEEEEE-----lll
Query ----------------------feTGIErphaQFRQ-INKNK--KGNYLVPL-----fat  143
ident                                              |              
Sbjct plgqsklyrsedygknfkditdliNNTF---iRTEFgMAIGPenSGKVVLTAevsggsrg  102
DSSP  llleeeeeeellllllleelhhhhLLLL---lLHHHlEEELLllLLLEEEEEllllllll


DSSP  LEEEEELLlLLEEEEEEL-LLLLLEEEELLLL--LEEEELlLLLEEEEELLllLLEEEEE
Query SEVREIAPnGQLLNSVKL-SGTPFSSAFLDNG--DCLVACgDAHCFVQLNLesNRIVRRV  200
ident                  |                  |                       
Sbjct GRIFRSSDfAKNFVQTDLpFHPLTQMMYSPQNsdYLLALS-TENGLWVSKN-fGGKWEEI  160
DSSP  LEEEEELLlLLLLEEEELlLLLLLLLEEELLEeeEEEEEL-LLLLEEEELL-lLLLEEEE


DSSP  EHhhllllllleeeeEEELLlLLEEEEE-ellllLLHHhlLLLLeEEELL---LLLEEEE
Query NAndiegvqlffvaqLFPLQnGGLYICN-wqghdREAGkgKHPQlVEIDS---EGKVVWQ  256
ident                                                  |          
Sbjct HK---------avclAKWGSdNTIFFTTyangscKADL--GALE-LWRTSdlgKSFKTIG  208
DSSP  EL---------leeeEEELLlLLEEEEEllllllLLLL--LLEE-EEEELlllLLLEEEE


DSSP  EL-------------------llLLLL------------------llleeeEELL-----
Query LN-------------------dkVKFG------------------xisticPIRE-----  274
ident                                                     |       
Sbjct VKiysfglggrflfasvmadkdtTRRIhvstdqgdtwsmaqlpsvgqeqfySILAanddm  268
DSSP  EEeeeeeeelleeeeeeelllllLEEEeeellllllleellllllllllleEEEEellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct vfmhvdepgdtgfgtiftsddrgivysksldrhlytttggetdftnvtslrgvyitsvls  328
DSSP  eeeeeelllllleeeeeeelllllleeeeeeeeelllllllllleellllllleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct ednsiqtmitfdqggrwthlrkpensecdataknknecslhihasysisqklnvpmapls  388
DSSP  lllleeeeeellllllleeeellllllllllllllllleeeellhhhhhlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct epnavgiviahgsvgdaisvmvpdvyisddggyswtkmlegphyytildsggiivaiehs  448
DSSP  llllllleeeeeeeelllllllleeeeellllllleeeellleeeeeehhhleeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct srpinvikfstdegqcwqtytftrdpiyftglasepgarsmnisiwgftesfltsqwvsy  508
DSSP  llllleeeeellllllleeeelllllleeeeeelllllllleeeeeeeeelllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct tidfkdilernceekdytiwlahstdpedyedgcilgykeqflrlrkssmcqngrdyvvt  568
DSSP  eeehhhlllllllhhheeeeelllllllllllllllleeeeeeeelllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  274
ident                                                             
Sbjct kqpsiclcsledflcdfgyyrpendskcveqpelkghdlefclygreehlttngyrkipg  628
DSSP  eeeeellllhhheeellleelllllllleelllllhhhhhhhhhllhhhheelleeelll


DSSP  -----------------------------
Query -----------------------------  274
ident                              
Sbjct dkcqggvnpvrevkdlkkkctsnflspek  657
DSSP  llllllllllllleelhhhhhhhllllll


No 211: Query=mol1A Sbjct=2bs5A Z-score=3.3

back to top
DSSP  llleeeeellllleeeeeelllleeeeeeellLLLLLlEEEELL-LLLEEEELL----LE
Query spqhllvggsgwnkiaiinkdtkeivweypleKGWECnSVAATK-AGEILFSYS----KG   55
ident                                                 |           
Sbjct --------------------------------SSVQT-AATSWGtVPSIRVYTAnngkIT   27
DSSP  --------------------------------LLLEE-EEEEELlLLEEEEEEEelleEE


DSSP  EEEELLLLLEEEEEELLllLEEEEeEELLL---LLEEEEEEL-LLEEEEEELlllLEEEE
Query AKXITRDGRELWNIAAPagCEXQTaRILPD---GNALVAWCG-HPSTILEVNxkgEVLSK  111
ident        |        |                    |        |            |
Sbjct ERCWDGKGWYTGAFNEP-gDNVSV-TSWLVgsaIHIRVYASTgTTTTEWCWD--gNGWTK   83
DSSP  EEEELLLLEEEEEEEEE-lLEEEE-EEEEElleEEEEEEEEElLEEEEEEEL--lLLEEE


DSSP  E-EELLLlllhhhllllleellllleeeeelllleeeeellllleeeeeelllllleeee
Query T-EFETGierphaqfrqinknkkgnylvplfatsevreiapngqllnsvklsgtpfssaf  170
ident      |                                                      
Sbjct GaYTATN-----------------------------------------------------   90
DSSP  LlLLLLL-----------------------------------------------------


DSSP  llllleeeellllleeeeelllllleeeeeehhhllllllleeeeeeellllleeeeeel
Query ldngdclvacgdahcfvqlnlesnrivrrvnandiegvqlffvaqlfplqngglyicnwq  230
ident                                                             
Sbjct ------------------------------------------------------------   90
DSSP  ------------------------------------------------------------


DSSP  lllllhhhllllleeeellllleeeeelllllllllleeeeell
Query ghdreagkgkhpqlveidsegkvvwqlndkvkfgxisticpire  274
ident                                             
Sbjct --------------------------------------------   90
DSSP  -----------------------