Results

Parseable data
Matches to PDB90
Dali: mol1A,

Query: mol1A

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, to pre-computed structural neighbours in the Dali Database, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2vii-A 15.8  2.3  132   247   22 PDB  MOLECULE: PSP OPERON TRANSCRIPTIONAL ACTIVATOR;                      
   2:  1ny5-B 15.6  2.2  132   385   23 PDB  MOLECULE: TRANSCRIPTIONAL REGULATOR (NTRC FAMILY);                   
   3:  1ojl-D 15.2  2.8  137   297   23 PDB  MOLECULE: TRANSCRIPTIONAL REGULATORY PROTEIN ZRAR;                   
   4:  3dzd-A 13.4  2.7  133   368   26 PDB  MOLECULE: TRANSCRIPTIONAL REGULATOR (NTRC FAMILY);                   
   5:  1in5-A 12.2  2.6  120   301   18 PDB  MOLECULE: HOLLIDAY JUNCTION DNA HELICASE RUVB;                       
   6:  2c9o-C 11.4  2.3  123   311   20 PDB  MOLECULE: RUVB-LIKE 1;                                               
   7:  3bos-B 11.3  3.2  130   231   14 PDB  MOLECULE: PUTATIVE DNA REPLICATION FACTOR;                           
   8:  2chq-A 11.2  2.7  122   313   13 PDB  MOLECULE: REPLICATION FACTOR C SMALL SUBUNIT;                        
   9:  1iqp-A 11.1  2.6  120   326   13 PDB  MOLECULE: RFCS;                                                      
  10:  2c9o-A 10.8  2.7  124   398   19 PDB  MOLECULE: RUVB-LIKE 1;                                               
  11:  3cf1-B 10.6  2.9  124   723   15 PDB  MOLECULE: TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE;                 
  12:  1ixs-B 10.6  2.5  117   315   18 PDB  MOLECULE: HOLLIDAY JUNCTION DNA HELICASE RUVA;                       
  13:  1sxj-B 10.6  3.1  118   316   15 PDB  MOLECULE: ACTIVATOR 1 95 KDA SUBUNIT;                                
  14:  1sxj-E 10.5  3.0  121   317   20 PDB  MOLECULE: ACTIVATOR 1 95 KDA SUBUNIT;                                
  15:  3hte-E 10.1  3.3  126   302   17 PDB  MOLECULE: ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT             
  16:  2qby-A 10.1  3.3  129   366   15 PDB  MOLECULE: CELL DIVISION CONTROL PROTEIN 6 HOMOLOG 1;                 
  17:  2qz4-A 10.1  2.8  120   223    8 PDB  MOLECULE: PARAPLEGIN;                                                
  18:  3eih-A 10.0  2.9  126   319   14 PDB  MOLECULE: VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4;             
  19:  2z4r-A 10.0  3.2  128   240   10 PDB  MOLECULE: CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA;            
  20:  2gno-A  9.9  3.1  115   296    6 PDB  MOLECULE: DNA POLYMERASE III, GAMMA SUBUNIT-RELATED                  
  21:  3h4m-A  9.8  3.0  125   261   16 PDB  MOLECULE: PROTEASOME-ACTIVATING NUCLEOTIDASE;                        
  22:  1lv7-A  9.8  3.2  125   251   15 PDB  MOLECULE: FTSH;                                                      
  23:  2rko-A  9.8  2.9  121   280   14 PDB  MOLECULE: VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4;             
  24:  1fnn-A  9.8  3.1  128   379   19 PDB  MOLECULE: CELL DIVISION CONTROL PROTEIN 6;                           
  25:  3ecc-A  9.7  3.2  126   182   12 PDB  MOLECULE: DNA REPLICATION PROTEIN DNAC;                              
  26:  2ce7-D  9.7  3.0  122   413   17 PDB  MOLECULE: CELL DIVISION PROTEIN FTSH;                                
  27:  1sxj-D  9.7  3.4  122   328   15 PDB  MOLECULE: ACTIVATOR 1 95 KDA SUBUNIT;                                
  28:  1qvr-A  9.6  3.1  129   803   12 PDB  MOLECULE: CLPB PROTEIN;                                              
  29:  1nsf-A  9.6  3.3  126   247   14 PDB  MOLECULE: N-ETHYLMALEIMIDE SENSITIVE FACTOR;                         
  30:  1sxj-C  9.6  3.0  119   322   13 PDB  MOLECULE: ACTIVATOR 1 95 KDA SUBUNIT;                                
  31:  3d8b-A  9.4  2.7  120   281    9 PDB  MOLECULE: FIDGETIN-LIKE PROTEIN 1;                                   
  32:  2dhr-A  9.4  3.0  124   458   16 PDB  MOLECULE: FTSH;                                                      
  33:  1xwi-A  9.3  3.0  122   322   14 PDB  MOLECULE: SKD1 PROTEIN;                                              
  34:  3b9p-A  9.3  2.9  120   268   15 PDB  MOLECULE: CG5977-PA, ISOFORM A;                                      
  35:  2qby-B  9.3  3.4  127   368   13 PDB  MOLECULE: CELL DIVISION CONTROL PROTEIN 6 HOMOLOG 1;                 
  36:  2r65-A  9.3  3.1  123   249   13 PDB  MOLECULE: CELL DIVISION PROTEASE FTSH HOMOLOG;                       
  37:  3co5-A  9.3  2.9  111   134   19 PDB  MOLECULE: PUTATIVE TWO-COMPONENT SYSTEM TRANSCRIPTIONAL              
  38:  1um8-A  9.2  3.3  125   327   14 PDB  MOLECULE: ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT             
  39:  2v1u-A  9.2  3.6  124   382   17 PDB  MOLECULE: CELL DIVISION CONTROL PROTEIN 6 HOMOLOG;                   
  40:  1ofh-A  9.1  3.0  121   309   17 PDB  MOLECULE: ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT             
  41:  1ksf-X  9.1  3.1  126   714   13 PDB  MOLECULE: ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT             
  42:  1jr3-D  9.1  3.0  119   338   20 PDB  MOLECULE: DNA POLYMERASE III SUBUNIT GAMMA;                          
  43:  1jr3-E  8.7  3.3  120   334    9 PDB  MOLECULE: DNA POLYMERASE III SUBUNIT GAMMA;                          
  44:  1w5s-B  8.6  3.3  126   396   11 PDB  MOLECULE: ORC2;                                                      
  45:  3crv-A  8.4  3.2  113   551   10 PDB  MOLECULE: XPD/RAD3 RELATED DNA HELICASE;                             
  46:  1im2-A  8.3  3.4  126   346   17 PDB  MOLECULE: ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT             
  47:  1jbk-A  8.3  3.6  124   189   11 PDB  MOLECULE: CLPB PROTEIN;                                              
  48:  2w58-A  8.3  3.1  121   188   12 PDB  MOLECULE: PRIMOSOME COMPONENT (HELICASE LOADER);                     
  49:  1sxj-A  8.2  3.4  117   441   17 PDB  MOLECULE: ACTIVATOR 1 95 KDA SUBUNIT;                                
  50:  1g3i-A  8.1  3.0  116   326   18 PDB  MOLECULE: ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT            
  51:  2p65-A  8.1  3.3  121   185   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN PF08_0063;                            
  52:  1g6o-A  7.9  3.2  121   323   11 PDB  MOLECULE: CAG-ALPHA;                                                 
  53:  1svl-A  7.6  2.9  115   363   13 PDB  MOLECULE: LARGE T ANTIGEN;                                           
  54:  1g4a-E  7.5  2.9  119   356   18 PDB  MOLECULE: ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT             
  55:  2gxa-E  7.5  3.5  121   274   11 PDB  MOLECULE: REPLICATION PROTEIN E1;                                    
  56:  2vl7-A  7.4  2.9  109   459   12 PDB  MOLECULE: XPD;                                                       
  57:  1w4r-A  7.2  3.2  102   174   10 PDB  MOLECULE: THYMIDINE KINASE;                                          
  58:  2orw-B  7.2  3.5  105   173   10 PDB  MOLECULE: THYMIDINE KINASE;                                          
  59:  2oap-2  7.1  3.5  123   503   12 PDB  MOLECULE: TYPE II SECRETION SYSTEM PROTEIN;                          
  60:  1xp8-A  7.1  3.5  117   298   15 PDB  MOLECULE: RECA PROTEIN;                                              
  61:  3crw-1  7.1  3.0  109   485   10 PDB  MOLECULE: XPD/RAD3 RELATED DNA HELICASE;                             
  62:  2qgz-A  7.1  2.9  111   183   13 PDB  MOLECULE: PUTATIVE PRIMOSOME COMPONENT;                              
  63:  3gp8-A  7.1  3.8  119   551   17 PDB  MOLECULE: EXODEOXYRIBONUCLEASE V, SUBUNIT RECD, PUTATIVE;            
  64:  1s9h-A  6.9  4.8  124   268   13 PDB  MOLECULE: REP 40 PROTEIN;                                            
  65:  2qen-A  6.9  3.8  119   350   10 PDB  MOLECULE: WALKER-TYPE ATPASE;                                        
  66:  1cr1-A  6.9  3.2  114   245   14 PDB  MOLECULE: DNA PRIMASE/HELICASE;                                      
  67:  1mo4-A  6.8  3.3  120   324   14 PDB  MOLECULE: RECA;                                                      
  68:  3e2i-A  6.8  3.4  105   175   12 PDB  MOLECULE: THYMIDINE KINASE;                                          
  69:  3b85-A  6.7  3.7  114   187   11 PDB  MOLECULE: PHOSPHATE STARVATION-INDUCIBLE PROTEIN;                    
  70:  2ja1-A  6.7  3.4  104   193   10 PDB  MOLECULE: THYMIDINE KINASE;                                          
  71:  2qe7-D  6.5  3.1  121   461   12 PDB  MOLECULE: ATP SYNTHASE SUBUNIT ALPHA;                                
  72:  2g88-A  6.5  3.2  115   331   16 PDB  MOLECULE: PROTEIN RECA;                                              
  73:  2is6-A  6.5  3.9  114   654   11 PDB  MOLECULE: DNA HELICASE II;                                           
  74:  1xx6-A  6.5  3.3  102   178    7 PDB  MOLECULE: THYMIDINE KINASE;                                          
  75:  1xmr-B  6.5  3.4  100   207    8 PDB  MOLECULE: THYMIDINE KINASE;                                          
  76:  2ewv-A  6.4  3.6  120   343    9 PDB  MOLECULE: TWITCHING MOTILITY PROTEIN PILT;                           
  77:  3kx2-A  6.4  3.3  116   755   13 PDB  MOLECULE: PRE-MRNA-SPLICING FACTOR ATP-DEPENDENT RNA                 
  78:  1tue-D  6.4  3.5  111   202    9 PDB  MOLECULE: REPLICATION PROTEIN E1;                                    
  79:  3cmv-A  6.4  2.9  107  1190   17 PDB  MOLECULE: PROTEIN RECA;                                              
  80:  2j87-D  6.4  3.3  101   171    8 PDB  MOLECULE: THYMIDINE KINASE;                                          
  81:  2r2a-A  6.3  2.9  105   191    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
  82:  2awn-A  6.3  4.6  108   330   11 PDB  MOLECULE: MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN            
  83:  2iut-A  6.2  3.4  118   408   11 PDB  MOLECULE: DNA TRANSLOCASE FTSK;                                      
  84:  1q57-A  6.2  3.4  116   483   13 PDB  MOLECULE: DNA PRIMASE/HELICASE;                                      
  85:  1z6t-B  6.2  3.5  109   586   10 PDB  MOLECULE: APOPTOTIC PROTEASE ACTIVATING FACTOR 1;                    
  86:  1g8p-A  6.1  3.2  117   321   21 PDB  MOLECULE: MAGNESIUM-CHELATASE 38 KDA SUBUNIT;                        
  87:  2ehv-C  6.1  3.4  116   226   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH0186;                               
  88:  3cmv-G  6.1  3.2  111  1167   17 PDB  MOLECULE: PROTEIN RECA;                                              
  89:  1t5l-A  6.1  3.2  113   595   11 PDB  MOLECULE: UVRABC SYSTEM PROTEIN B;                                   
  90:  1d2m-A  6.1  3.1  110   552   10 PDB  MOLECULE: EXCINUCLEASE ABC SUBUNIT B;                                
  91:  2fwr-A  6.1  3.2  111   434    9 PDB  MOLECULE: DNA REPAIR PROTEIN RAD25;                                  
  92:  1g64-B  6.1  3.2  103   190   13 PDB  MOLECULE: COB(I)ALAMIN ADENOSYLTRANSFERASE;                          
  93:  1w36-B  6.1  3.8  116  1158   10 PDB  MOLECULE: DNA HAIRPIN;                                               
  94:  2o8f-A  6.1  4.8  110   831    8 PDB  MOLECULE: DNA MISMATCH REPAIR PROTEIN MSH2;                          
  95:  3cpe-A  6.1  3.7  114   553    9 PDB  MOLECULE: DNA PACKAGING PROTEIN GP17;                                
  96:  1sky-B  6.0  3.5  122   479   11 PDB  MOLECULE: F1-ATPASE;                                                 
  97:  2wss-A  6.0  3.8  122   510    9 PDB  MOLECULE: ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL;                 
  98:  2fdc-A  6.0  3.3  113   505   10 PDB  MOLECULE: UVRABC SYSTEM PROTEIN B;                                   
  99:  1sgw-A  6.0  3.3  107   200   14 PDB  MOLECULE: PUTATIVE ABC TRANSPORTER;                                  
 100:  2is4-B  6.0  3.9  112   632   10 PDB  MOLECULE: DNA HELICASE II;                                           
 101:  2hld-K  5.9  3.2  115   486   10 PDB  MOLECULE: ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL;                   
 102:  2d7d-A  5.9  3.1  108   621    9 PDB  MOLECULE: UVRABC SYSTEM PROTEIN B;                                   
 103:  2cvf-A  5.9  3.4  116   220   14 PDB  MOLECULE: DNA REPAIR AND RECOMBINATION PROTEIN RADB;                 
 104:  1n0w-A  5.9  3.3  108   210   13 PDB  MOLECULE: DNA REPAIR PROTEIN RAD51 HOMOLOG 1;                        
 105:  1szp-A  5.9  3.4  113   294   13 PDB  MOLECULE: DNA REPAIR PROTEIN RAD51;                                  
 106:  2gza-C  5.8  3.0  118   336   15 PDB  MOLECULE: TYPE IV SECRETION SYSTEM PROTEIN VIRB11;                   
 107:  3cmt-A  5.8  3.3  117  1609   16 PDB  MOLECULE: DNA (5'-                                                   
 108:  2ixf-A  5.8  3.4  111   255   15 PDB  MOLECULE: ANTIGEN PEPTIDE TRANSPORTER 1;                             
 109:  2dr3-D  5.7  3.3  117   242   15 PDB  MOLECULE: UPF0273 PROTEIN PH0284;                                    
 110:  1z6a-A  5.7  3.2  114   480    9 PDB  MOLECULE: HELICASE OF THE SNF2/RAD54 FAMILY;                         
 111:  3gfo-A  5.7  4.9  117   251   15 PDB  MOLECULE: COBALT IMPORT ATP-BINDING PROTEIN CBIO 1;                  
 112:  2r6f-A  5.7  3.6  106   899   16 PDB  MOLECULE: EXCINUCLEASE ABC SUBUNIT A;                                
 113:  2zj8-A  5.7  3.7  103   700   13 PDB  MOLECULE: PUTATIVE SKI2-TYPE HELICASE;                               
 114:  1ewq-A  5.7  4.7  114   759   11 PDB  MOLECULE: DNA MISMATCH REPAIR PROTEIN MUTS;                          
 115:  1p9w-A  5.6  3.0  120   384    9 PDB  MOLECULE: GENERAL SECRETION PATHWAY PROTEIN E;                       
 116:  1vpl-A  5.6  4.3  112   238   13 PDB  MOLECULE: ABC TRANSPORTER, ATP-BINDING PROTEIN;                      
 117:  1v5w-A  5.6  3.3  109   239   12 PDB  MOLECULE: MEIOTIC RECOMBINATION PROTEIN DMC1/LIM15 HOMOLOG;          
 118:  2zuc-B  5.6  3.8  115   301   16 PDB  MOLECULE: DNA REPAIR AND RECOMBINATION PROTEIN RADA;                 
 119:  1nlf-A  5.6  3.3   98   254   11 PDB  MOLECULE: REGULATORY PROTEIN REPA;                                   
 120:  3ice-C  5.5  3.9  123   413    7 PDB  MOLECULE: TRANSCRIPTION TERMINATION FACTOR RHO;                      
 121:  2cbz-A  5.5  5.0  109   230   13 PDB  MOLECULE: MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1;                 
 122:  2r6d-C  5.5  3.5  117   399   12 PDB  MOLECULE: REPLICATIVE HELICASE;                                      
 123:  3ew9-A  5.5  3.2  114   314   10 PDB  MOLECULE: DNA REPAIR AND RECOMBINATION PROTEIN RADA;                 
 124:  1oxu-A  5.5  3.3  106   353   13 PDB  MOLECULE: ABC TRANSPORTER, ATP BINDING PROTEIN;                      
 125:  2d62-A  5.5  3.4  104   375   14 PDB  MOLECULE: MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING               
 126:  3k70-D  5.4  3.4  115   547   16 PDB  MOLECULE: EXODEOXYRIBONUCLEASE V BETA CHAIN;                         
 127:  2r6e-A  5.4  3.5  116   387   12 PDB  MOLECULE: REPLICATIVE HELICASE;                                      
 128:  2yz2-A  5.4  3.4  107   266   10 PDB  MOLECULE: PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN               
 129:  2r44-A  5.4  3.1  112   330   13 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
 130:  2onk-A  5.4  3.3  105   240   11 PDB  MOLECULE: MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING           
 131:  1z3i-X  5.4  3.7  117   644   10 PDB  MOLECULE: SIMILAR TO RAD54-LIKE;                                     
 132:  2oca-A  5.4  3.5  111   494   10 PDB  MOLECULE: ATP-DEPENDENT DNA HELICASE UVSW;                           
 133:  1uaa-A  5.4  3.9  109   636   14 PDB  MOLECULE: PROTEIN (ATP-DEPENDENT DNA HELICASE REP.);                 
 134:  3pjr-A  5.4  3.8  104   646    9 PDB  MOLECULE: HELICASE PCRA;                                             
 135:  2obl-A  5.3  3.6  118   346   11 PDB  MOLECULE: ESCN;                                                      
 136:  2nq2-C  5.3  3.4  109   251   11 PDB  MOLECULE: HYPOTHETICAL ABC TRANSPORTER PERMEASE PROTEIN              
 137:  1jj7-A  5.3  4.6  113   251   15 PDB  MOLECULE: PEPTIDE TRANSPORTER TAP1;                                  
 138:  1xu4-A  5.3  3.2  113   318   12 PDB  MOLECULE: DNA REPAIR AND RECOMBINATION PROTEIN RADA;                 
 139:  1v43-A  5.3  4.3  108   353   13 PDB  MOLECULE: SUGAR-BINDING TRANSPORT ATP-BINDING PROTEIN;               
 140:  3bgw-A  5.3  3.8  116   419    8 PDB  MOLECULE: DNAB-LIKE REPLICATIVE HELICASE;                            
 141:  2awn-B  5.3  4.4  111   374   11 PDB  MOLECULE: MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN            
 142:  2pcj-A  5.3  4.9  110   223   12 PDB  MOLECULE: LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN           
 143:  3dmq-A  5.3  3.3  109   961   14 PDB  MOLECULE: RNA POLYMERASE-ASSOCIATED PROTEIN RAPA;                    
 144:  2awn-C  5.3  3.3  100   344   12 PDB  MOLECULE: MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN            
 145:  1c9k-B  5.3  3.2   97   180   11 PDB  MOLECULE: ADENOSYLCOBINAMIDE KINASE;                                 
 146:  1e9s-A  5.2  3.6  120   427    8 PDB  MOLECULE: CONJUGAL TRANSFER PROTEIN TRWB;                            
 147:  3b60-A  5.2  4.8  113   572   15 PDB  MOLECULE: LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA;          
 148:  2qi9-C  5.2  3.2  106   248   12 PDB  MOLECULE: VITAMIN B12 IMPORT SYSTEM PERMEASE PROTEIN BTUC;           
 149:  3fvq-B  5.2  4.8  114   349   13 PDB  MOLECULE: FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC;               
 150:  1z47-A  5.2  3.2  105   345   13 PDB  MOLECULE: PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN;              
 151:  2ihy-B  5.1  4.8  107   261   14 PDB  MOLECULE: ABC TRANSPORTER, ATP-BINDING PROTEIN;                      
 152:  2gbl-A  5.1  3.4  114   506   11 PDB  MOLECULE: CIRCADIAN CLOCK PROTEIN KINASE KAIC;                       
 153:  3dhw-C  5.1  4.9  110   343   14 PDB  MOLECULE: D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN             
 154:  1ji0-A  5.1  4.6  107   240   11 PDB  MOLECULE: ABC TRANSPORTER;                                           
 155:  3fyh-A  5.1  3.5  107   296   10 PDB  MOLECULE: DNA REPAIR AND RECOMBINATION PROTEIN RADA;                 
 156:  1gm5-A  5.1  4.2  108   729   11 PDB  MOLECULE: DNA (5'-(*CP*AP*GP*CP*TP*CP*CP*AP*TP*GP*AP*TP*             
 157:  2zpa-B  5.1  3.5   97   662   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN YPFI;                              
 158:  1xmi-C  5.0  4.4  111   270   12 PDB  MOLECULE: CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                  
 159:  2it1-A  5.0  4.4  111   362    9 PDB  MOLECULE: 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN               
 160:  1f3o-A  5.0  3.3  103   232   11 PDB  MOLECULE: HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN           
 161:  2r8r-A  5.0  3.5  105   209    9 PDB  MOLECULE: SENSOR PROTEIN;                                            
 162:  2gxs-B  5.0  4.1  109   207   13 PDB  MOLECULE: HEAT RESISTANT RNA DEPENDENT ATPASE;                       
 163:  2pjz-A  5.0  4.9  110   261   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN ST1066;                               
 164:  3gqb-B  4.9  3.3  116   460    9 PDB  MOLECULE: V-TYPE ATP SYNTHASE ALPHA CHAIN;                           
 165:  1hv8-A  4.9  3.9  110   363   10 PDB  MOLECULE: PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669;                
 166:  2ff7-A  4.9  4.9  115   243    8 PDB  MOLECULE: ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING                  
 167:  3d31-A  4.9  3.5  110   348   11 PDB  MOLECULE: SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING             
 168:  2i3b-A  4.9  3.7  106   189   11 PDB  MOLECULE: HUMAN CANCER-RELATED NTPASE;                               
 169:  1r0z-C  4.8  4.7  108   277   13 PDB  MOLECULE: CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                  
 170:  2dpy-B  4.8  3.4  111   426   10 PDB  MOLECULE: FLAGELLUM-SPECIFIC ATP SYNTHASE;                           
 171:  2p6r-A  4.8  3.6  104   683   13 PDB  MOLECULE: AFUHEL308 HELICASE;                                        
 172:  2ghi-A  4.8  4.5  109   255   12 PDB  MOLECULE: TRANSPORT PROTEIN;                                         
 173:  3dkp-A  4.8  3.7  112   240   11 PDB  MOLECULE: PROBABLE ATP-DEPENDENT RNA HELICASE DDX52;                 
 174:  1yqt-A  4.8  3.5  105   515   13 PDB  MOLECULE: RNASE L INHIBITOR;                                         
 175:  2vf8-B  4.8  4.1  106   835   16 PDB  MOLECULE: EXCINUCLEASE ABC SUBUNIT A;                                
 176:  2z0m-A  4.8  3.4  102   331    8 PDB  MOLECULE: 337AA LONG HYPOTHETICAL ATP-DEPENDENT RNA                  
 177:  1nlz-C  4.8  3.5  103   278    7 PDB  MOLECULE: VIRB11 HOMOLOG;                                            
 178:  1pjr-A  4.8  3.8  104   623   10 PDB  MOLECULE: PCRA;                                                      
 179:  2j0u-B  4.8  3.8  107   347   17 PDB  MOLECULE: ATP-DEPENDENT RNA HELICASE DDX48;                          
 180:  1w36-F  4.8  2.8   92  1077    2 PDB  MOLECULE: DNA HAIRPIN;                                               
 181:  2hyd-A  4.7  4.8  112   578   11 PDB  MOLECULE: ABC TRANSPORTER HOMOLOG;                                   
 182:  2r6f-B  4.7  3.6  106   879   17 PDB  MOLECULE: EXCINUCLEASE ABC SUBUNIT A;                                
 183:  2vye-A  4.7  3.5  117   424    9 PDB  MOLECULE: REPLICATIVE DNA HELICASE;                                  
 184:  1g29-1  4.7  4.4  107   372   13 PDB  MOLECULE: MALTOSE TRANSPORT PROTEIN MALK;                            
 185:  1s2m-A  4.7  4.0  110   377    5 PDB  MOLECULE: PUTATIVE ATP-DEPENDENT RNA HELICASE DHH1;                  
 186:  1htw-A  4.7  3.4   97   158   14 PDB  MOLECULE: HI0065;                                                    
 187:  2ius-D  4.6  3.6  119   393    9 PDB  MOLECULE: DNA TRANSLOCASE FTSK;                                      
 188:  2yyz-A  4.6  4.5  109   358   13 PDB  MOLECULE: SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN;                
 189:  2olj-A  4.6  4.7  110   242   10 PDB  MOLECULE: AMINO ACID ABC TRANSPORTER;                                
 190:  2bmf-B  4.6  4.6  104   443    7 PDB  MOLECULE: RNA HELICASE;                                              
 191:  2ekd-F  4.5  3.7  105   204    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH0250;                               
 192:  3g5u-A  4.5  4.9  113  1182   13 PDB  MOLECULE: MULTIDRUG RESISTANCE PROTEIN 1A;                           
 193:  1w36-C  4.5  2.7   91  1121    2 PDB  MOLECULE: DNA HAIRPIN;                                               
 194:  1ye8-A  4.5  3.3   89   172    8 PDB  MOLECULE: HYPOTHETICAL UPF0334 KINASE-LIKE PROTEIN AQ_1292;          
 195:  2vsf-A  4.5  3.3   93   588   10 PDB  MOLECULE: DNA REPAIR HELICASE RAD3 RELATED PROTEIN;                  
 196:  1c4o-A  4.4  3.1  110   504   10 PDB  MOLECULE: DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB;                
 197:  2va8-B  4.4  3.9  109   695   12 PDB  MOLECULE: SKI2-TYPE HELICASE;                                        
 198:  1b0u-A  4.4  4.5  108   257   13 PDB  MOLECULE: HISTIDINE PERMEASE;                                        
 199:  2q6t-A  4.4  3.6  116   419    9 PDB  MOLECULE: DNAB REPLICATION FORK HELICASE;                            
 200:  2v6i-A  4.4  3.1   90   421    7 PDB  MOLECULE: RNA HELICASE;                                              
 201:  3bk7-A  4.3  3.6  107   593   13 PDB  MOLECULE: ABC TRANSPORTER ATP-BINDING PROTEIN;                       
 202:  2a0m-A  4.2  3.2  109   298    6 PDB  MOLECULE: ARGINASE SUPERFAMILY PROTEIN;                              
 203:  1g6h-A  4.2  4.4  110   254   11 PDB  MOLECULE: HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                    
 204:  2kbe-A  4.2  3.6  107   226   10 PDB  MOLECULE: ATP-DEPENDENT RNA HELICASE DBP5;                           
 205:  3eiq-D  4.2  4.0  107   371   14 PDB  MOLECULE: EUKARYOTIC INITIATION FACTOR 4A-I;                         
 206:  3i5x-A  4.2  3.5  102   509    5 PDB  MOLECULE: ATP-DEPENDENT RNA HELICASE MSS116;                         
 207:  1rz3-A  4.2  3.9   92   184   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN RBSTP0775;                            
 208:  1m6n-A  4.2  3.5   98   802   10 PDB  MOLECULE: PREPROTEIN TRANSLOCASE SECA;                               
 209:  1ewr-A  4.1  4.4  110   447   14 PDB  MOLECULE: DNA MISMATCH REPAIR PROTEIN MUTS;                          
 210:  1ii0-B  4.1  3.7   90   553    8 PDB  MOLECULE: ARSENICAL PUMP-DRIVING ATPASE;                             
 211:  2awn-D  4.1  3.3   88   301   13 PDB  MOLECULE: MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN            
 212:  1gl9-B  4.0  3.8  113  1020    8 PDB  MOLECULE: REVERSE GYRASE;                                            
 213:  2wjy-A  4.0  3.8   99   773    5 PDB  MOLECULE: REGULATOR OF NONSENSE TRANSCRIPTS 1;                       
 214:  1z2r-A  4.0  5.2  107   496   11 PDB  MOLECULE: LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA;          
 215:  1fuu-B  4.0  3.9  107   380   14 PDB  MOLECULE: YEAST INITIATION FACTOR 4A;                                
 216:  2vf7-B  4.0  3.4  100   813   12 PDB  MOLECULE: EXCINUCLEASE ABC, SUBUNIT A.;                              
 217:  3dmn-A  4.0  3.5   91   161    9 PDB  MOLECULE: PUTATIVE DNA HELICASE;                                     
 218:  2w0m-A  3.9  3.5  100   220   12 PDB  MOLECULE: SSO2452;                                                   
 219:  2r6a-B  3.9  3.4  102   374   13 PDB  MOLECULE: REPLICATIVE HELICASE;                                      
 220:  3b6e-A  3.9  3.3   90   182    7 PDB  MOLECULE: INTERFERON-INDUCED HELICASE C DOMAIN-CONTAINING            
 221:  2z83-A  3.9  3.3   92   426    8 PDB  MOLECULE: HELICASE/NUCLEOSIDE TRIPHOSPHATASE;                        
 222:  2vda-A  3.9  3.6  101   828   10 PDB  MOLECULE: TRANSLOCASE SUBUNIT SECA;                                  
 223:  2qeq-A  3.9  3.5   91   415    8 PDB  MOLECULE: FLAVIVIRIN PROTEASE NS3 CATALYTIC SUBUNIT;                 
 224:  1oft-A  3.9  3.0   80   119   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN PA3008;                               
 225:  2ved-B  3.8  3.6  100   254   14 PDB  MOLECULE: MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE;           
 226:  2d2f-A  3.8  5.1  100   246   14 PDB  MOLECULE: SUFC PROTEIN;                                              
 227:  1w44-A  3.7  3.3  105   304   10 PDB  MOLECULE: NTPASE P4;                                                 
 228:  2vbc-A  3.7  3.6  105   600    7 PDB  MOLECULE: DENGUE 4 NS3 FULL-LENGTH PROTEIN;                          
 229:  3f9v-A  3.7  4.3  100   595   10 PDB  MOLECULE: MINICHROMOSOME MAINTENANCE PROTEIN MCM;                    
 230:  1ki9-B  3.7  3.5   86   192   12 PDB  MOLECULE: ADENYLATE KINASE;                                          
 231:  3kds-E  3.7  3.4   91   428   15 PDB  MOLECULE: CELL DIVISION PROTEIN FTSH;                                
 232:  1mv5-A  3.6  3.8  108   242   12 PDB  MOLECULE: MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING           
 233:  2wv9-A  3.6  4.1  101   600    9 PDB  MOLECULE: FLAVIVIRIN PROTEASE NS2B REGULATORY SUBUNIT,               
 234:  1wrb-A  3.6  4.0  105   232   11 PDB  MOLECULE: DJVLGB;                                                    
 235:  2jeo-A  3.6  2.9   84   212   12 PDB  MOLECULE: URIDINE-CYTIDINE KINASE 1;                                 
 236:  2fsf-B  3.6  3.8  101   723   10 PDB  MOLECULE: PREPROTEIN TRANSLOCASE SECA SUBUNIT;                       
 237:  2a5y-B  3.6  3.6   96   501   13 PDB  MOLECULE: APOPTOSIS REGULATOR CED-9;                                 
 238:  3euj-A  3.5  3.4  102   437   14 PDB  MOLECULE: CHROMOSOME PARTITION PROTEIN MUKB, LINKER;                 
 239:  1e69-A  3.5  3.9  102   263   12 PDB  MOLECULE: CHROMOSOME SEGREGATION SMC PROTEIN;                        
 240:  2fsh-A  3.5  3.8  101   691    9 PDB  MOLECULE: PREPROTEIN TRANSLOCASE SECA SUBUNIT;                       
 241:  2eh6-A  3.5  4.0  103   375   10 PDB  MOLECULE: ACETYLORNITHINE AMINOTRANSFERASE;                          
 242:  3hjn-A  3.5  3.3   87   189   15 PDB  MOLECULE: THYMIDYLATE KINASE;                                        
 243:  2iw3-B  3.4  4.2  111   980   17 PDB  MOLECULE: ELONGATION FACTOR 3A;                                      
 244:  2zu0-C  3.4  3.5   95   247   11 PDB  MOLECULE: PROTEIN SUFD;                                              
 245:  2p0e-A  3.4  3.3   80   190   14 PDB  MOLECULE: NICOTINAMIDE RIBOSIDE KINASE 1;                            
 246:  3bk1-A  3.4  4.0   88   551    9 PDB  MOLECULE: METAL DEPENDENT HYDROLASE;                                 
 247:  2q9a-A  3.4  3.9   89   304   18 PDB  MOLECULE: CELL DIVISION PROTEIN FTSY;                                
 248:  1b0a-A  3.4  3.4   85   287    9 PDB  MOLECULE: PROTEIN (FOLD BIFUNCTIONAL PROTEIN);                       
 249:  1iv8-A  3.4  3.3   82   720   15 PDB  MOLECULE: MALTOOLIGOSYL TREHALOSE SYNTHASE;                          
 250:  1xfk-A  3.3  4.2  102   324   13 PDB  MOLECULE: FORMIMIDOYLGLUTAMASE;                                      
 251:  3cio-A  3.3  4.0  102   255   15 PDB  MOLECULE: TYROSINE-PROTEIN KINASE ETK;                               
 252:  3bs4-A  3.3  4.0  106   245    1 PDB  MOLECULE: UNCHARACTERIZED PROTEIN PH0321;                            
 253:  1uj2-A  3.3  2.8   80   213   10 PDB  MOLECULE: URIDINE-CYTIDINE KINASE 2;                                 
 254:  3idq-A  3.3  4.3   92   272   13 PDB  MOLECULE: ATPASE GET3;                                               
 255:  2v54-A  3.3  2.8   81   204   10 PDB  MOLECULE: THYMIDYLATE KINASE;                                        
 256:  1grq-A  3.3  3.0   81   178   14 PDB  MOLECULE: CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE;                    
 257:  1ni4-B  3.3  3.9   99   330   10 PDB  MOLECULE: PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA                 
 258:  3glf-G  3.3  3.7   99   378   12 PDB  MOLECULE: DNA POLYMERASE III SUBUNIT DELTA;                          
 259:  2ged-A  3.3  3.2   79   170    8 PDB  MOLECULE: SIGNAL RECOGNITION PARTICLE RECEPTOR BETA                  
 260:  1wp9-A  3.3  4.0   92   479    7 PDB  MOLECULE: ATP-DEPENDENT RNA HELICASE, PUTATIVE;                      
 261:  2yv4-A  3.3  3.3   72   102    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH0435;                               
 262:  2plr-A  3.2  3.2   85   212   11 PDB  MOLECULE: PROBABLE THYMIDYLATE KINASE;                               
 263:  1e2f-A  3.2  3.2   82   210   15 PDB  MOLECULE: THYMIDYLATE KINASE;                                        
 264:  2qeq-B  3.2  3.8   89   391    7 PDB  MOLECULE: FLAVIVIRIN PROTEASE NS3 CATALYTIC SUBUNIT;                 
 265:  2k4m-A  3.2  3.4   84   153   13 PDB  MOLECULE: UPF0146 PROTEIN MTH_1000;                                  
 266:  3h1t-A  3.2  3.8   91   515    4 PDB  MOLECULE: TYPE I SITE-SPECIFIC RESTRICTION-MODIFICATION              
 267:  2fna-A  3.1  3.6   94   352   13 PDB  MOLECULE: CONSERVED HYPOTHETICAL PROTEIN;                            
 268:  2g25-A  3.1  3.8   97   831    7 PDB  MOLECULE: PYRUVATE DEHYDROGENASE E1 COMPONENT;                       
 269:  1osn-A  3.1  3.2   82   325   13 PDB  MOLECULE: THYMIDINE KINASE;                                          
 270:  2ges-A  3.0  3.9  100   308   14 PDB  MOLECULE: PANTOTHENATE KINASE;                                       
 271:  2woj-D  3.0  3.3  101   304   14 PDB  MOLECULE: ATPASE GET3;                                               
 272:  3en0-A  3.0  3.3   97   266    7 PDB  MOLECULE: CYANOPHYCINASE;                                            
 273:  4tmk-A  3.0  3.8   88   210   10 PDB  MOLECULE: PROTEIN (THYMIDYLATE KINASE);                              
 274:  2px0-A  3.0  4.2   91   258   15 PDB  MOLECULE: FLAGELLAR BIOSYNTHESIS PROTEIN FLHF;                       
 275:  3ftb-A  3.0  4.0   92   334    5 PDB  MOLECULE: HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;                     
 276:  1nks-A  3.0  3.1   83   194   12 PDB  MOLECULE: ADENYLATE KINASE;                                          
 277:  2i7t-A  3.0  3.9   92   404    8 PDB  MOLECULE: CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR            
 278:  2vbi-A  3.0  3.8   95   554    5 PDB  MOLECULE: PYRUVATE DECARBOXYLASE;                                    
 279:  2g5g-X  2.9  3.3   87   255    8 PDB  MOLECULE: PUTATIVE LIPOPROTEIN;                                      
 280:  2eo5-A  2.9  3.9   97   412    7 PDB  MOLECULE: 419AA LONG HYPOTHETICAL AMINOTRANSFERASE;                  
 281:  1dp4-C  2.9  5.9  101   429    9 PDB  MOLECULE: ATRIAL NATRIURETIC PEPTIDE RECEPTOR A;                     
 282:  1vma-B  2.9  3.8   85   294   14 PDB  MOLECULE: CELL DIVISION PROTEIN FTSY;                                
 283:  3ewo-A  2.9  3.1   76   177    7 PDB  MOLECULE: NON-STRUCTURAL PROTEIN 3;                                  
 284:  1xjq-B  2.9  3.5   79   590   14 PDB  MOLECULE: BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                       
 285:  1zu5-B  2.9  3.8   88   310   14 PDB  MOLECULE: FTSY;                                                      
 286:  2vli-B  2.9  3.3   80   173   14 PDB  MOLECULE: ANTIBIOTIC RESISTANCE PROTEIN;                             
 287:  2ax4-A  2.9  3.1   78   198   17 PDB  MOLECULE: BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                       
 288:  1tex-D  2.9  3.5   79   247    8 PDB  MOLECULE: STF0 SULFOTRANSFERASE;                                     
 289:  2cuk-A  2.9  4.6   88   311    8 PDB  MOLECULE: GLYCERATE DEHYDROGENASE/GLYOXYLATE REDUCTASE;              
 290:  1zja-A  2.9  3.5   83   557   11 PDB  MOLECULE: TREHALULOSE SYNTHASE;                                      
 291:  3h16-B  2.9  3.5   84   137   12 PDB  MOLECULE: TIR PROTEIN;                                               
 292:  2vy9-A  2.9  2.8   70   115   10 PDB  MOLECULE: ANTI-SIGMA-FACTOR ANTAGONIST;                              
 293:  2ov6-A  2.9  2.4   59   101   14 PDB  MOLECULE: V-TYPE ATP SYNTHASE SUBUNIT F;                             
 294:  2o5v-A  2.8  3.6   98   358   12 PDB  MOLECULE: DNA REPLICATION AND REPAIR PROTEIN RECF;                   
 295:  1esm-A  2.8  3.7   92   311   18 PDB  MOLECULE: PANTOTHENATE KINASE;                                       
 296:  1vec-A  2.8  4.0  107   206    6 PDB  MOLECULE: ATP-DEPENDENT RNA HELICASE P54;                            
 297:  3i4j-B  2.8  3.8  107   386    8 PDB  MOLECULE: AMINOTRANSFERASE, CLASS III;                               
 298:  1dty-A  2.8  4.0  107   429    7 PDB  MOLECULE: ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE                  
 299:  2db3-A  2.8  3.8  105   420    7 PDB  MOLECULE: ATP-DEPENDENT RNA HELICASE VASA;                           
 300:  1d2f-B  2.8  4.2  102   368   12 PDB  MOLECULE: MALY PROTEIN;                                              
 301:  2zxq-A  2.8  3.6   96  1178    9 PDB  MOLECULE: ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE;                      
 302:  2hoy-A  2.8  4.1   96   402   11 PDB  MOLECULE: GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)            
 303:  3iqx-A  2.8  3.3   95   261   15 PDB  MOLECULE: TAIL-ANCHORED PROTEIN TARGETING FACTOR GET3;               
 304:  3c8u-A  2.8  3.9   90   206   18 PDB  MOLECULE: FRUCTOKINASE;                                              
 305:  2axn-A  2.8  3.4   80   451   13 PDB  MOLECULE: 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-                     
 306:  2qmo-A  2.8  3.2   81   220   20 PDB  MOLECULE: DETHIOBIOTIN SYNTHETASE;                                   
 307:  2dbq-A  2.8  4.8   87   333   13 PDB  MOLECULE: GLYOXYLATE REDUCTASE;                                      
 308:  3tmk-A  2.8  3.2   82   216    9 PDB  MOLECULE: THYMIDYLATE KINASE;                                        
 309:  1l8a-A  2.8  3.9   98   801   10 PDB  MOLECULE: PYRUVATE DEHYDROGENASE E1 COMPONENT;                       
 310:  2yvu-A  2.8  3.5   83   179   22 PDB  MOLECULE: PROBABLE ADENYLYL-SULFATE KINASE;                          
 311:  1y63-A  2.8  3.6   76   168   13 PDB  MOLECULE: LMAJ004144AAA PROTEIN;                                     
 312:  2p2x-A  2.8  2.7   67   267    9 PDB  MOLECULE: PROBABLE DIPHTHINE SYNTHASE;                               
 313:  2hy5-C  2.8  3.2   70   101    9 PDB  MOLECULE: PUTATIVE SULFURTRANSFERASE DSRE;                           
 314:  2i4r-B  2.8  1.9   52    80    8 PDB  MOLECULE: V-TYPE ATP SYNTHASE SUBUNIT F;                             
 315:  1pq3-A  2.7  4.5  107   306    8 PDB  MOLECULE: ARGINASE II, MITOCHONDRIAL PRECURSOR;                      
 316:  2ef4-A  2.7  3.5   96   282   10 PDB  MOLECULE: ARGINASE;                                                  
 317:  2v30-A  2.7  3.6   91   262   12 PDB  MOLECULE: OROTIDINE 5'-PHOSPHATE DECARBOXYLASE;                      
 318:  3fmi-A  2.7  3.8   87   232   10 PDB  MOLECULE: DETHIOBIOTIN SYNTHETASE;                                   
 319:  1izj-A  2.7  4.5   91   637    9 PDB  MOLECULE: AMYLASE;                                                   
 320:  1akb-A  2.7  4.2  103   402   14 PDB  MOLECULE: ASPARTATE AMINOTRANSFERASE;                                
 321:  1wwk-A  2.7  4.5   88   304    9 PDB  MOLECULE: PHOSPHOGLYCERATE DEHYDROGENASE;                            
 322:  2bif-A  2.7  3.4   76   432   12 PDB  MOLECULE: PROTEIN (6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-            
 323:  1ay0-A  2.7  4.1   96   678    5 PDB  MOLECULE: TRANSKETOLASE;                                             
 324:  1z6g-A  2.7  3.7   79   191   11 PDB  MOLECULE: GUANYLATE KINASE;                                          
 325:  1zpd-A  2.7  3.6   94   565    7 PDB  MOLECULE: PYRUVATE DECARBOXYLASE;                                    
 326:  1gpj-A  2.7  5.1   85   400   11 PDB  MOLECULE: GLUTAMYL-TRNA REDUCTASE;                                   
 327:  2wtz-B  2.7  3.5   83   508    6 PDB  MOLECULE: UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE-                 
 328:  2if2-C  2.7  3.6   77   163   14 PDB  MOLECULE: DEPHOSPHO-COA KINASE;                                      
 329:  1rkb-A  2.7  3.1   72   173   15 PDB  MOLECULE: PROTEIN AD-004;                                            
 330:  1u9y-A  2.7  4.4   85   274    6 PDB  MOLECULE: RIBOSE-PHOSPHATE PYROPHOSPHOKINASE;                        
 331:  2f1r-A  2.7  3.7   71   148   15 PDB  MOLECULE: MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS            
 332:  1cbf-A  2.7  3.2   74   239    7 PDB  MOLECULE: COBALT-PRECORRIN-4 TRANSMETHYLASE;                         
 333:  3gmz-A  2.6  4.0  101   316    4 PDB  MOLECULE: ARGINASE-1;                                                
 334:  3f07-C  2.6  3.5   99   340   10 PDB  MOLECULE: HISTONE DEACETYLASE 8;                                     
 335:  3din-A  2.6  4.1  100   816    9 PDB  MOLECULE: PROTEIN TRANSLOCASE SUBUNIT SECA;                          
 336:  2ord-A  2.6  3.9   97   393    8 PDB  MOLECULE: ACETYLORNITHINE AMINOTRANSFERASE;                          
 337:  3tat-A  2.6  4.1  104   397   10 PDB  MOLECULE: TYROSINE AMINOTRANSFERASE;                                 
 338:  3cq5-B  2.6  4.4   95   366    8 PDB  MOLECULE: HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;                     
 339:  2qy9-A  2.6  4.0   94   300   12 PDB  MOLECULE: CELL DIVISION PROTEIN FTSY;                                
 340:  2o8n-A  2.6  5.8   94   233    7 PDB  MOLECULE: APOA-I BINDING PROTEIN;                                    
 341:  2d0i-A  2.6  5.0   87   333    7 PDB  MOLECULE: DEHYDROGENASE;                                             
 342:  2o1s-B  2.6  3.9   92   493    4 PDB  MOLECULE: 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE;                   
 343:  2bwj-A  2.6  3.7   81   196   16 PDB  MOLECULE: ADENYLATE KINASE 5;                                        
 344:  3fkd-A  2.6  3.8   88   326    7 PDB  MOLECULE: L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE;                   
 345:  2bdt-A  2.6  2.9   74   172   11 PDB  MOLECULE: BH3686;                                                    
 346:  1pow-A  2.6  5.8   93   585    4 PDB  MOLECULE: PYRUVATE OXIDASE;                                          
 347:  1kht-B  2.6  3.2   78   191   14 PDB  MOLECULE: ADENYLATE KINASE;                                          
 348:  1dvr-A  2.6  2.9   78   220   18 PDB  MOLECULE: ADENYLATE KINASE;                                          
 349:  2z6i-B  2.6  3.2   85   321   12 PDB  MOLECULE: TRANS-2-ENOYL-ACP REDUCTASE II;                            
 350:  3gpg-B  2.6  3.8   78   162    4 PDB  MOLECULE: NON-STRUCTURAL PROTEIN 3;                                  
 351:  2vri-A  2.6  3.5   80   173    6 PDB  MOLECULE: NON-STRUCTURAL PROTEIN 3;                                  
 352:  3jrn-A  2.6  3.6   78   151    8 PDB  MOLECULE: AT1G72930 PROTEIN;                                         
 353:  2z67-A  2.6  3.8  102   434    6 PDB  MOLECULE: O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE;             
 354:  1z8f-A  2.6  3.9   81   184   15 PDB  MOLECULE: GUANYLATE KINASE;                                          
 355:  1yzg-A  2.6  3.6   71   168   17 PDB  MOLECULE: ADP-RIBOSYLATION FACTOR-LIKE 8;                            
 356:  3f07-B  2.5  3.6   99   368   10 PDB  MOLECULE: HISTONE DEACETYLASE 8;                                     
 357:  1kfl-A  2.5  3.9  107   351    7 PDB  MOLECULE: 3-DEOXY-D-ARABINO-HEPTULOSONATE-7-PHOSPHATE                
 358:  1hqf-A  2.5  3.7   98   314    4 PDB  MOLECULE: ARGINASE 1;                                                
 359:  3ibg-A  2.5  3.2   92   300   15 PDB  MOLECULE: ATPASE, SUBUNIT OF THE GET COMPLEX;                        
 360:  1dqw-A  2.5  3.6   93   267   11 PDB  MOLECULE: OROTIDINE 5'-PHOSPHATE DECARBOXYLASE;                      
 361:  2zsm-A  2.5  4.1   97   425   15 PDB  MOLECULE: GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE;                  
 362:  1ohv-A  2.5  3.9   96   461    5 PDB  MOLECULE: 4-AMINOBUTYRATE AMINOTRANSFERASE;                          
 363:  2bwo-B  2.5  3.8   99   399    5 PDB  MOLECULE: 5-AMINOLEVULINATE SYNTHASE;                                
 364:  1vcn-A  2.5  4.3   89   506   11 PDB  MOLECULE: CTP SYNTHETASE;                                            
 365:  2csu-A  2.5  4.5   95   435    6 PDB  MOLECULE: 457AA LONG HYPOTHETICAL PROTEIN;                           
 366:  1sg9-A  2.5  6.1   91   276    5 PDB  MOLECULE: HEMK PROTEIN;                                              
 367:  3h86-A  2.5  3.5   79   191   14 PDB  MOLECULE: ADENYLATE KINASE;                                          
 368:  3k28-A  2.5  4.2   98   423   10 PDB  MOLECULE: GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE 2;                
 369:  2grj-A  2.5  3.1   73   179   14 PDB  MOLECULE: DEPHOSPHO-COA KINASE;                                      
 370:  1vlw-B  2.5  3.8   85   207    9 PDB  MOLECULE: 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-              
 371:  2ols-A  2.5  3.9   78   725    8 PDB  MOLECULE: PHOSPHOENOLPYRUVATE SYNTHASE;                              
 372:  3ewq-A  2.5  3.6   77   167   10 PDB  MOLECULE: NON-STRUCTURAL PROTEIN 3;                                  
 373:  3es8-A  2.5  5.0   88   387    6 PDB  MOLECULE: MUCONATE CYCLOISOMERASE;                                   
 374:  1vyt-A  2.5  3.6   82   273    9 PDB  MOLECULE: CALCIUM CHANNEL BETA-3 SUBUNIT;                            
 375:  1fyv-A  2.5  3.4   77   161    9 PDB  MOLECULE: TOLL-LIKE RECEPTOR 1;                                      
 376:  1r9j-B  2.5  4.3   93   671   11 PDB  MOLECULE: TRANSKETOLASE;                                             
 377:  1zrh-A  2.5  3.9   77   263    8 PDB  MOLECULE: HEPARAN SULFATE GLUCOSAMINE 3-O-SULFOTRANSFERASE           
 378:  1nst-A  2.5  3.5   74   282    9 PDB  MOLECULE: HEPARAN SULFATE N-DEACETYLASE/N-SULFOTRANSFERASE;          
 379:  1yt8-A  2.5  3.3   69   525   16 PDB  MOLECULE: THIOSULFATE SULFURTRANSFERASE;                             
 380:  1y56-A  2.5  3.4   66   484   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1363;                               
 381:  1ofp-B  2.4  4.1   99   321    9 PDB  MOLECULE: PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE;               
 382:  3end-A  2.4  3.3   88   268   15 PDB  MOLECULE: LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE            
 383:  3czp-A  2.4  3.9  106   466    6 PDB  MOLECULE: PUTATIVE POLYPHOSPHATE KINASE 2;                           
 384:  2ga8-A  2.4  3.1   91   329   11 PDB  MOLECULE: HYPOTHETICAL 39.9 KDA PROTEIN;                             
 385:  3czq-A  2.4  4.0  102   288    7 PDB  MOLECULE: PUTATIVE POLYPHOSPHATE KINASE 2;                           
 386:  2j0e-A  2.4  3.4   82   263   12 PDB  MOLECULE: 6-PHOSPHOGLUCONOLACTONASE;                                 
 387:  3bcb-A  2.4  3.6  103   445    8 PDB  MOLECULE: O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE;             
 388:  1m7g-C  2.4  3.6   75   209   12 PDB  MOLECULE: ADENYLYLSULFATE KINASE;                                    
 389:  3l44-B  2.4  3.9   94   433   10 PDB  MOLECULE: GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE 1;                
 390:  3hl2-B  2.4  4.3  105   445   10 PDB  MOLECULE: O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE;             
 391:  3be4-A  2.4  3.3   76   215   17 PDB  MOLECULE: ADENYLATE KINASE;                                          
 392:  1zp6-A  2.4  3.2   75   176   17 PDB  MOLECULE: HYPOTHETICAL PROTEIN ATU3015;                              
 393:  2w91-A  2.4  4.8   91   635   10 PDB  MOLECULE: ENDO-BETA-N-ACETYLGLUCOSAMINIDASE D;                       
 394:  2ffh-A  2.4  4.0   90   407   11 PDB  MOLECULE: PROTEIN (FFH);                                             
 395:  1zhh-A  2.4  3.7   82   344    9 PDB  MOLECULE: AUTOINDUCER 2-BINDING PERIPLASMIC PROTEIN LUXP;            
 396:  1ozg-A  2.4  3.4   89   549    8 PDB  MOLECULE: ACETOLACTATE SYNTHASE, CATABOLIC;                          
 397:  1fcf-A  2.4  3.0   77   387   14 PDB  MOLECULE: PHOTOSYSTEM II D1 PROTEASE;                                
 398:  1ko5-A  2.4  3.1   74   172   11 PDB  MOLECULE: GLUCONATE KINASE;                                          
 399:  1uf9-A  2.4  3.3   73   191   14 PDB  MOLECULE: TT1252 PROTEIN;                                            
 400:  2axp-A  2.4  3.2   72   172   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN BSU20280;                             
 401:  1d0i-H  2.4  3.4   80   153   10 PDB  MOLECULE: TYPE II 3-DEHYDROQUINATE HYDRATASE;                        
 402:  2e5w-A  2.4  5.7   94   280    5 PDB  MOLECULE: PROBABLE SPERMIDINE SYNTHASE;                              
 403:  2uy2-A  2.4  4.2   89   287    6 PDB  MOLECULE: ENDOCHITINASE;                                             
 404:  2zc8-A  2.4  3.7   83   368    7 PDB  MOLECULE: N-ACYLAMINO ACID RACEMASE;                                 
 405:  3blv-H  2.4  3.9   72   348    7 PDB  MOLECULE: ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 1;                  
 406:  1s4d-E  2.4  4.1   85   265    6 PDB  MOLECULE: UROPORPHYRIN-III C-METHYLTRANSFERASE;                      
 407:  2pb0-A  2.3  4.0  101   389   16 PDB  MOLECULE: ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE                    
 408:  2vcg-D  2.3  3.5  101   376    5 PDB  MOLECULE: HISTONE DEACETYLASE-LIKE AMIDOHYDROLASE;                   
 409:  3b55-A  2.3  4.1  100   408   13 PDB  MOLECULE: SUCCINOGLYCAN BIOSYNTHESIS PROTEIN;                        
 410:  1um9-C  2.3  3.6   93   335    6 PDB  MOLECULE: 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT;                    
 411:  1waw-A  2.3  3.6   93   366   11 PDB  MOLECULE: CHITOTRIOSIDASE 1;                                         
 412:  3a8u-X  2.3  4.1  102   441   11 PDB  MOLECULE: OMEGA-AMINO ACID--PYRUVATE AMINOTRANSFERASE;               
 413:  1vf8-A  2.3  3.5   92   373   13 PDB  MOLECULE: SECRETORY PROTEIN;                                         
 414:  2bkw-A  2.3  4.4   96   381   10 PDB  MOLECULE: ALANINE-GLYOXYLATE AMINOTRANSFERASE 1;                     
 415:  3ea0-B  2.3  3.5   85   242    7 PDB  MOLECULE: ATPASE, PARA FAMILY;                                       
 416:  3ihl-A  2.3  4.2   84   233   12 PDB  MOLECULE: CTP SYNTHASE 2;                                            
 417:  3jzd-A  2.3  3.4   80   354   13 PDB  MOLECULE: IRON-CONTAINING ALCOHOL DEHYDROGENASE;                     
 418:  3iv7-A  2.3  3.4   80   356    9 PDB  MOLECULE: ALCOHOL DEHYDROGENASE IV;                                  
 419:  2hf8-A  2.3  3.7   76   211   16 PDB  MOLECULE: PROBABLE HYDROGENASE NICKEL INCORPORATION                  
 420:  2atm-A  2.3  4.4   90   324    6 PDB  MOLECULE: HYALURONOGLUCOSAMINIDASE;                                  
 421:  3grz-B  2.3  5.5   89   193   10 PDB  MOLECULE: RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE;                   
 422:  1zak-A  2.3  3.5   90   220    9 PDB  MOLECULE: ADENYLATE KINASE;                                          
 423:  3fb4-A  2.3  3.2   72   215   15 PDB  MOLECULE: ADENYLATE KINASE;                                          
 424:  1s3g-A  2.3  3.2   75   217   17 PDB  MOLECULE: ADENYLATE KINASE;                                          
 425:  3dah-C  2.3  3.8   85   300   11 PDB  MOLECULE: RIBOSE-PHOSPHATE PYROPHOSPHOKINASE;                        
 426:  2fg1-A  2.3  3.4   70   157    6 PDB  MOLECULE: CONSERVED HYPOTHETICAL PROTEIN BT1257;                     
 427:  2vbf-A  2.3  3.6   88   546    3 PDB  MOLECULE: BRANCHED-CHAIN ALPHA-KETOACID DECARBOXYLASE;               
 428:  3flm-A  2.3  7.0   89   535   10 PDB  MOLECULE: 2-SUCCINYL-5-ENOLPYRUVYL-6-HYDROXY-3-CYCLOHEXENE-          
 429:  3gmt-A  2.3  3.6   75   204   12 PDB  MOLECULE: ADENYLATE KINASE;                                          
 430:  1yj5-B  2.3  4.4   96   383   10 PDB  MOLECULE: 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE                    
 431:  1t8t-B  2.3  3.8   77   271   10 PDB  MOLECULE: HEPARAN SULFATE D-GLUCOSAMINYL 3-O-                        
 432:  2pmq-B  2.3  3.6   78   374    4 PDB  MOLECULE: MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME;            
 433:  3hh1-A  2.3  2.9   68   113    6 PDB  MOLECULE: TETRAPYRROLE METHYLASE FAMILY PROTEIN;                     
 434:  3hrg-A  2.3  5.0   75   257   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BT_3980 WITH ACTIN-LIKE            
 435:  3lec-A  2.3  2.9   56   225   14 PDB  MOLECULE: NADB-ROSSMANN SUPERFAMILY PROTEIN;                         
 436:  1rd5-A  2.2  3.7   88   261    6 PDB  MOLECULE: TRYPTOPHAN SYNTHASE ALPHA CHAIN, CHLOROPLAST;              
 437:  1dfl-B  2.2  4.8  100   766    6 PDB  MOLECULE: MYOSIN HEAD;                                               
 438:  2cks-B  2.2  3.8   93   306    4 PDB  MOLECULE: ENDOGLUCANASE E-5;                                         
 439:  1ky8-A  2.2  3.6   80   499    9 PDB  MOLECULE: GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE;                  
 440:  3kje-A  2.2  2.9   77   254   13 PDB  MOLECULE: CO DEHYDROGENASE/ACETYL-COA SYNTHASE COMPLEX,              
 441:  2cjd-A  2.2  4.0   99   436   15 PDB  MOLECULE: L-LYSINE-EPSILON AMINOTRANSFERASE;                         
 442:  2e7u-A  2.2  4.1  103   424   10 PDB  MOLECULE: GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE;                  
 443:  2o1x-B  2.2  3.9   88   579    7 PDB  MOLECULE: 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE;                   
 444:  2eu8-A  2.2  3.4   76   216   16 PDB  MOLECULE: ADENYLATE KINASE;                                          
 445:  3fg0-C  2.2  3.6   84   503   17 PDB  MOLECULE: BETAINE ALDEHYDE DEHYDROGENASE;                            
 446:  3bwb-A  2.2  5.9   90   288    3 PDB  MOLECULE: SPERMIDINE SYNTHASE;                                       
 447:  3ch4-B  2.2  3.9   78   188   12 PDB  MOLECULE: PHOSPHOMEVALONATE KINASE;                                  
 448:  1ols-B  2.2  4.0   94   336    6 PDB  MOLECULE: 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT;              
 449:  2p7h-C  2.2  3.6   87   229    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
 450:  3io3-A  2.2  3.6   82   230   16 PDB  MOLECULE: DEHA2D07832P;                                              
 451:  1hyq-A  2.2  3.8   86   232   16 PDB  MOLECULE: CELL DIVISION INHIBITOR (MIND-1);                          
 452:  2cdn-A  2.2  3.4   74   186   20 PDB  MOLECULE: ADENYLATE KINASE;                                          
 453:  1mjf-A  2.2  5.7   92   271    4 PDB  MOLECULE: SPERMIDINE SYNTHASE;                                       
 454:  1t3l-A  2.2  3.6   84   306    8 PDB  MOLECULE: DIHYDROPYRIDINE-SENSITIVE L-TYPE, CALCIUM                  
 455:  3d6k-C  2.2  5.0   92   413    7 PDB  MOLECULE: PUTATIVE AMINOTRANSFERASE;                                 
 456:  1t3h-C  2.2  3.4   74   187   19 PDB  MOLECULE: DEPHOSPHO-COA KINASE;                                      
 457:  2ps2-A  2.2  3.5   77   361   12 PDB  MOLECULE: PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING           
 458:  2v45-A  2.2  3.4   83   723    8 PDB  MOLECULE: PERIPLASMIC NITRATE REDUCTASE;                             
 459:  3can-A  2.2  3.5   74   161   14 PDB  MOLECULE: PYRUVATE-FORMATE LYASE-ACTIVATING ENZYME;                  
 460:  2h06-B  2.2  5.0   95   308    5 PDB  MOLECULE: RIBOSE-PHOSPHATE PYROPHOSPHOKINASE I;                      
 461:  1k32-A  2.2  5.0   77  1023    8 PDB  MOLECULE: TRICORN PROTEASE;                                          
 462:  8abp-A  2.2  4.1   71   305    6 PDB  MOLECULE: L-ARABINOSE-BINDING PROTEIN;                               
 463:  2ozt-A  2.2  6.1   78   321    4 PDB  MOLECULE: TLR1174 PROTEIN;                                           
 464:  1yba-A  2.2  4.1   62   406   10 PDB  MOLECULE: D-3-PHOSPHOGLYCERATE DEHYDROGENASE;                        
 465:  3k95-A  2.1  4.8  102   665    5 PDB  MOLECULE: TRANSKETOLASE;                                             
 466:  1cev-A  2.1  3.3   91   299   12 PDB  MOLECULE: PROTEIN (ARGINASE);                                        
 467:  2woo-A  2.1  4.1  100   303   13 PDB  MOLECULE: ATPASE GET3;                                               
 468:  3h84-B  2.1  3.3   91   323   14 PDB  MOLECULE: ATPASE GET3;                                               
 469:  1tvn-A  2.1  3.9   95   293    5 PDB  MOLECULE: CELLULASE;                                                 
 470:  1wky-A  2.1  3.7   94   446    7 PDB  MOLECULE: ENDO-BETA-1,4-MANNANASE;                                   
 471:  3b4w-A  2.1  4.0   79   483   16 PDB  MOLECULE: ALDEHYDE DEHYDROGENASE;                                    
 472:  2zy2-A  2.1  4.1   99   521   10 PDB  MOLECULE: L-ASPARTATE 4-CARBOXYLYASE;                                
 473:  1vcm-A  2.1  4.1   88   531   13 PDB  MOLECULE: CTP SYNTHETASE;                                            
 474:  2e5b-A  2.1  3.8   88   466    8 PDB  MOLECULE: NICOTINAMIDE PHOSPHORIBOSYLTRANSFERASE;                    
 475:  3ch7-A  2.1  3.7   81   266   12 PDB  MOLECULE: 6-PHOSPHOGLUCONOLACTONASE;                                 
 476:  3d3a-A  2.1  3.7   85   604    8 PDB  MOLECULE: BETA-GALACTOSIDASE;                                        
 477:  3i10-A  2.1  3.7   83   278   10 PDB  MOLECULE: PUTATIVE GLYCEROPHOSPHORYL DIESTER                         
 478:  3hh9-A  2.1  5.8   90   260    4 PDB  MOLECULE: SPERMIDINE SYNTHASE;                                       
 479:  1y7o-B  2.1  3.2   76   178    9 PDB  MOLECULE: ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT;            
 480:  3cm0-A  2.1  3.3   81   184   15 PDB  MOLECULE: ADENYLATE KINASE;                                          
 481:  3b9e-A  2.1  3.7   86   581    6 PDB  MOLECULE: CHITINASE A;                                               
 482:  2rgx-A  2.1  3.1   73   203   16 PDB  MOLECULE: ADENYLATE KINASE;                                          
 483:  2anb-A  2.1  3.5   72   206   11 PDB  MOLECULE: GUANYLATE KINASE;                                          
 484:  2cy8-A  2.1  4.3   95   401    9 PDB  MOLECULE: D-PHENYLGLYCINE AMINOTRANSFERASE;                          
 485:  1vyt-B  2.1  3.1   77   294    8 PDB  MOLECULE: CALCIUM CHANNEL BETA-3 SUBUNIT;                            
 486:  3jwp-A  2.1  4.0   74   255    7 PDB  MOLECULE: TRANSCRIPTIONAL REGULATORY PROTEIN SIR2                    
 487:  1hgx-A  2.1  4.0   83   164    8 PDB  MOLECULE: HYPOXANTHINE-GUANINE-XANTHINE                              
 488:  1j99-A  2.1  2.9   69   284   12 PDB  MOLECULE: ALCOHOL SULFOTRANSFERASE;                                  
 489:  1lbq-A  2.1  3.3   76   356    9 PDB  MOLECULE: FERROCHELATASE;                                            
 490:  3gf7-A  2.1  3.6   79   543    8 PDB  MOLECULE: GLUTACONYL-COA DECARBOXYLASE SUBUNIT A;                    
 491:  2ji4-A  2.1  5.2   92   302   11 PDB  MOLECULE: PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE-                   
 492:  2ayi-A  2.1  4.3   89   397    2 PDB  MOLECULE: AMINOPEPTIDASE T;                                          
 493:  1kag-A  2.1  2.9   65   158   14 PDB  MOLECULE: SHIKIMATE KINASE I;                                        
 494:  3d1c-A  2.1  3.4   74   358    8 PDB  MOLECULE: FLAVIN-CONTAINING PUTATIVE MONOOXYGENASE;                  
 495:  1pix-A  2.1  3.2   75   586   11 PDB  MOLECULE: GLUTACONYL-COA DECARBOXYLASE A SUBUNIT;                    
 496:  2qbu-B  2.1  3.0   68   230    7 PDB  MOLECULE: PRECORRIN-2 METHYLTRANSFERASE;                             
 497:  3fcp-A  2.1  3.8   78   356    9 PDB  MOLECULE: L-ALA-D/L-GLU EPIMERASE, A MUCONATE LACTONIZING            
 498:  2fb6-A  2.1  3.4   72   116    8 PDB  MOLECULE: CONSERVED HYPOTHETICAL PROTEIN;                            
 499:  1c7s-A  2.0  3.7   86   858    8 PDB  MOLECULE: BETA-N-ACETYLHEXOSAMINIDASE;                               
 500:  2ekc-B  2.0  4.0   91   257    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE ALPHA CHAIN;                           
 501:  2v3c-C  2.0  3.7   86   403    9 PDB  MOLECULE: SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN;                
 502:  3hy6-A  2.0  3.8   85   198    2 PDB  MOLECULE: 5-FORMYLTETRAHYDROFOLATE CYCLO-LIGASE;                     
 503:  3fe2-A  2.0  3.7   97   234    2 PDB  MOLECULE: PROBABLE ATP-DEPENDENT RNA HELICASE DDX5;                  
 504:  1t0b-G  2.0  3.3   74   242    9 PDB  MOLECULE: THUA-LIKE PROTEIN;                                         
 505:  1zin-A  2.0  3.0   69   217   22 PDB  MOLECULE: ADENYLATE KINASE;                                          
 506:  2o20-B  2.0  4.1   68   275   12 PDB  MOLECULE: CATABOLITE CONTROL PROTEIN A;                              
 507:  2z1d-B  2.0  3.6   84   368    6 PDB  MOLECULE: HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPD;             
 508:  1gca-A  2.0  3.9   78   309    1 PDB  MOLECULE: GLUCOSE/GALACTOSE-BINDING PROTEIN;                         
 509:  1fp4-B  2.0  6.6   77   522    4 PDB  MOLECULE: NITROGENASE MOLYBDENUM-IRON PROTEIN ALPHA CHAIN;           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=mol1A Sbjct=2viiA Z-score=15.8

back to top
DSSP  --llLLHHHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHLLLLLLLLLEEEE-L
Query --igRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRXTGARYLHQFGRNAQGEFVYRE-L   57
ident                   |   |  |   |  |||    |  ||      || |      
Sbjct nllgEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNcA   60
DSSP  llllLLHHHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHHLHHHHLLEEEEEhH


DSSP  LLL--LLLLHH----------HHHHHHLLLLEEEELHHHLLHHHHHHHHHHHHL------
Query TPD--NAPQLN----------DFIALAQGGTLVLSHPEHLTREQQYHLVQLQSQ------   99
ident                           | |||| |          |  |            
Sbjct ALNenLLDSELfgheaqkrhpGRFERADGGTLFLDELATAPMMVQEKLLRVIEYgelerv  120
DSSP  HLLhhHHHHHHhlllllllllLHHHHLLLEEEEEELHHHLLHHHHHHHHHHHHHleelll


DSSP  -----lllLLLEEEEELLlhhHHHHHL---LLLHHHHHHHHHHEEELLL-----------
Query -----ehrPFRLIGIGDTslvELAASN---HIIAELYYCFAXTQIACLP-----------  140
ident           ||          | |        | |    |       |           
Sbjct ggsqplqvNVRLVCATNA---DLPAMVnegTFRADLLDRLAFDVVQLPPlreresdimlm  177
DSSP  llllleelLEEEEEEELL---LHHHHHhllLLLHHHHHHHLLEEEELLLhhhllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct aeyfaiqmcreiklplfpgfteraretllnyrwpgnirelknvversvyrhgtsdypldd  237
DSSP  hhhhhhhhhhhllllllllllhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllllllll


DSSP  --------ll
Query --------lt  142
ident           
Sbjct iiidpfkrrp  247
DSSP  llllllllll


No 2: Query=mol1A Sbjct=1ny5B Z-score=15.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl   60
DSSP  leeeeelllhhhhhhhhhhhhhhlleeeeellhhhhhhhhhhlllleeeeelllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk  120
DSSP  hhhhhhhhhlllleeeeeellllhhhhhhhhhlllleeeellllhhhhhhhhhhhhhhhh


DSSP  -------------------llLLHHHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHH
Query -------------------igRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRXTGARYL   41
ident                       |             |     |   |  | |    ||  
Sbjct lrkenellrrekdlkeeeyvfESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLI  180
DSSP  hhhhhhhhhhhhhhlllllllLLHHHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHH


DSSP  HHLLLLLLLLLEEEEL---LLLLL-LLHH---------------HHHHHHLLLLEEEELH
Query HQFGRNAQGEFVYREL---TPDNA-PQLN---------------DFIALAQGGTLVLSHP   82
ident |         ||         |     |                 |  || |||| |   
Sbjct HKLSDRSKEPFVALNVasiPRDIFeAELFgyekgaftgavsskeGFFELADGGTLFLDEI  240
DSSP  HHLLLLLLLLEEEEELlllLHHHHhHHHHlllllllllllllllLHHHHLLLLEEEEELH


DSSP  HHLLHHHHHHHHHHHHL-----------lllLLLEEEEELLlhhHHHHHL---LLLHHHH
Query EHLTREQQYHLVQLQSQ-----------ehrPFRLIGIGDTslvELAASN---HIIAELY  128
ident   |  | |  |                      |                        ||
Sbjct GELSLEAQAKLLRVIESgkfyrlggrkeievNVRILAATNR---NIKELVkegKFREDLY  297
DSSP  HHLLHHHHHHHHHHHHHleelllllllleelLLEEEEEELL---LHHHHHhllLLLHHHH


DSSP  HHHHHHEEELLL------------------------------------------------
Query YCFAXTQIACLP------------------------------------------------  140
ident |      |   |                                                
Sbjct YRLGVIEIEIPPlrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvr  357
DSSP  HHHLLEEEELLLllllhhhhhhhhhhhhhhhhhhlllllleelhhhhhhhhhlllllhhh


DSSP  --------------------------ll
Query --------------------------lt  142
ident                             
Sbjct elknvieravlfsegkfidrgelsclvn  385
DSSP  hhhhhhhhhhhllllleellllllllll


No 3: Query=mol1A Sbjct=1ojlD Z-score=15.2

back to top
DSSP  --llLLHHHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHLLLLLLLLLEEEELL
Query --igRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRXTGARYLHQFGRNAQGEFVYRELT   58
ident      |                |  |   |  |||    || ||          |     
Sbjct hmigSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDRPLVTLNCA   60
DSSP  llllLLHHHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHHLLLLLLLEEEEELL


DSSP  L----LLLLLHH---------------HHHHHHLLLLEEEELHHHLLHHHHHHHHHHHHL
Query P----DNAPQLN---------------DFIALAQGGTLVLSHPEHLTREQQYHLVQLQSQ   99
ident           |                     | |||| |          |  |      
Sbjct AlnesLLESELFghekgaftgadkrreGRFVEADGGTLFLDEIGDISPLMQVRLLRAIQE  120
DSSP  LllhhHHHHHHLlllllllllllllllLLLHHHLLLEEEEELLLLLLHHHHHHHHHHHHL


DSSP  -----------lllLLLEEEEELLLHHHHHHHLLLLHHHHHHHHHHEEELLLLL------
Query -----------ehrPFRLIGIGDTSLVELAASNHIIAELYYCFAXTQIACLPLT------  142
ident                 |||      | |          |||      |    |       
Sbjct revqrvgsnqtisvDVRLIAATHRDLAEEVSAGRFRQDLYYRLNVVAIEMPSLRqrredi  180
DSSP  leelllllllleelLLEEEEEELLLHHHHHHLLLLLHHHHHHHLLEEEELLLHHhhlllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct plladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyise  240
DSSP  hhhhhhhhhhhhhhlllllllllhhhhhhhhllllllhhhhhhhhhhhhhhhlllllllh


DSSP  ---------------------------------------------------------
Query ---------------------------------------------------------  142
ident                                                          
Sbjct relplaiaatpikeiqplvdvekevilaalektggnkteaarqlgitrktllaklsr  297
DSSP  hhllhhhllllllllllhhhhhhhhhhhhhhlllllhhhhhhhhlllhhhhhhhlll


No 4: Query=mol1A Sbjct=3dzdA Z-score=13.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct krvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwxpdgdgv   60
DSSP  leeeeelllhhhhhhhhhhhhhllleeeeellhhhhhhhhhhlllleeeeeleelleell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeeys  120
DSSP  lhhhhhhhhlllleeeeeelllllhhhhhhhhhllleeeellllhhhhhhhhhhhhhhhl


DSSP  -----------llLLHHHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHLLLLlL
Query -----------igRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRXTGARYLHQFGRNaQ   49
ident                  |    |           |   |  |||    ||  |       
Sbjct kkappqeeiefvgEHPKILEIKRLIPKIAKSKAPVLITGESGTGKEIVARLIHRYSGR-K  179
DSSP  lllllllllllllLLHHHHHHHHHHHHHHLLLLLEEEELLLLLLHHHHHHHHHHHHLL-L


DSSP  LLLEEEELL---LLLLL-LHHH---------------HHHHHLLLLEEEE-LHHH---LL
Query GEFVYRELT---PDNAP-QLND---------------FIALAQGGTLVLS-HPEH---LT   86
ident | ||           |   |                    ||  ||| |    |      
Sbjct GAFVDLNCAsipQELAEsELFGhekgaftgaltrkkgKLELADQGTLFLDeVGELdqrVQ  239
DSSP  LLEEEEELLlllLLLHHhHHHEellllllllllleelHHHHLLLLEEEEElHHHLlhhHH


DSSP  HHHHHHHHHH-------hhllllLLLEEEEELLLHHHHHHHLLLLHHHHHHHHHHEEELL
Query REQQYHLVQL-------qsqehrPFRLIGIGDTSLVELAASNHIIAELYYCFAXTQIACL  139
ident       |                  | |      | |          |||     ||   
Sbjct AKLLRVLETGsftrlggnqkievDIRVISATNKNLEEEIKKGNFREDLYYRLSVFQIYLP  299
DSSP  HHHHHHHHHLeelllllllleelLLEEEEEELLLHHHHHHLLLLLHHHHHHHLLEEEELL


DSSP  LLL---------------------------------------------------------
Query PLT---------------------------------------------------------  142
ident ||                                                          
Sbjct PLRergkdvillaeyflkkfakeykkncfelseetkeylxkqewkgnvrelknlieravi  359
DSSP  LHHhlllhhhhhhhhhhhhhhhhlllllllllhhhhhhhhllllllhhhhhhhhhhhhhh


DSSP  ---------
Query ---------  142
ident          
Sbjct lcegevikp  368
DSSP  lllllllll


No 5: Query=mol1A Sbjct=1in5A Z-score=12.2

back to top
DSSP  -------llllHHHHHHHHHHHHHLL-------LLLLEEEELLLLLLHHHHHHHHHHLLL
Query -------igrsEWINQYRRRLQQLSE-------TDIAVWLYGAPGTGRXTGARYLHQFGR   46
ident                     |    |           | | | || |  | |        
Sbjct qflrpksldefIGQENVKKKLSLALEaakmrgeVLDHVLLAGPPGLGKTTLAHIIASELQ   60
DSSP  lllllllhhhlLLLHHHHHHHHHHHHhhhhhllLLLLEEEELLLLLLHHHHHHHHHHHHL


DSSP  LlllLLEEEELLllLLLL---HHHHHHHHLL-LLEEEELHHHLLHHHHHHHHHHHHL---
Query NaqgEFVYRELTpdNAPQ---LNDFIALAQG-GTLVLSHPEHLTREQQYHLVQLQSQ---   99
ident                                   |       |       |         
Sbjct T---NIHVTSGP--VLVKqgdMAAILTSLERgDVLFIDEIHRLNKAVEELLYSAIEDfqi  115
DSSP  L---LEEEEELL--LLLLhhhHHHHHHHLLLlLEEEEELHHHLLHHHHHHHHHHHHLlll


DSSP  ---lllLLLEEEEELLLhHHHHhhllllHHHHHHHhHHEEELLL----------------
Query ---ehrPFRLIGIGDTSlVELAasnhiiAELYYCFaXTQIACLP----------------  140
ident       || | |    |   |         |   |                         
Sbjct dimdiqPFTLVGSTTRS-GLLS------SPLRSRF-GIILELDFytvkelkeiikraasl  167
DSSP  llllllLLEEEEEELLH-HHLL------HHHHLLL-LEEEELLLllhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct mdveiedaaaemiakrsrgtpriairltkrvrdmltvvkadrintdivlktmevlnidde  227
DSSP  llllllhhhhhhhhhlllllhhhhhhhhhhhhhhhhhhllllllhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepyllqagflartprgri  287
DSSP  lllhhhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhlllhhhhhhllleeeelleee


DSSP  ------------ll
Query ------------lt  142
ident               
Sbjct vtekaykhlkyevp  301
DSSP  elhhhhhhllllll


No 6: Query=mol1A Sbjct=2c9oC Z-score=11.4

back to top
DSSP  -----------------------------llllhHHHHHHHHHHHHLLLL-------LLE
Query -----------------------------igrseWINQYRRRLQQLSETD-------IAV   24
ident                                        |       |          ||
Sbjct ksttktqriashshvkglgldesglakqaasglvGQENAREACGVIVELIkskkmagRAV   60
DSSP  lllllhhhlhhhlllllllllllllllleelleeLLHHHHHHHHHHHHHHhllllllLEE


DSSP  EEELLLLLLHHHHHHHHHHLLLlLLLLLEEEELLllLLLL--------HHHHHHHHL---
Query WLYGAPGTGRXTGARYLHQFGRnAQGEFVYRELTpdNAPQ--------LNDFIALAQ---   73
ident  | | ||||    |    |        |                    |      |    
Sbjct LLAGPPGTGKTALALAIAQELG-SKVPFCPMVGS--EVYSteikktevLMENFRRAIglr  117
DSSP  EEELLLLLLHHHHHHHHHHHHL-LLLLEEEEEHH--HHLLllllhhhhHHHHHHHLEeee


DSSP  ----------------------------------------LLLEEEELHHHLLHHHHHHH
Query ----------------------------------------GGTLVLSHPEHLTREQQYHL   93
ident                                          | |       |  |    |
Sbjct iketkkkeiiqdvtlhdldvageinkvvnkyidqgiaelvPGVLFVDEVHMLDIECFTYL  177
DSSP  eeeelleeeeeeehhhhhlllllhhhhhhhhhhllleeeeELEEEEELHHHLLHHHHHHH


DSSP  HHHHHLlLLLLLEEEEELLlhhhhhHHLL-----------LLHHHHHHHhhHEEELLL--
Query VQLQSQeHRPFRLIGIGDTslvelaASNH-----------IIAELYYCFaxTQIACLP--  140
ident              |                          |   |        |      
Sbjct HRALES-SIAPIVIFASNR-----gNCVIrgteditsphgIPLDLLDRV--MIIRTMLyt  229
DSSP  HHHHLL-LLLLEEEEEELL-----lEEELlllllleeellLLHHHHLLE--EEEELLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct pqemkqiikiraqteginiseealnhlgeigtkttlrysvqlltpanllakingkdsiek  289
DSSP  hhhhhhhhhhhhhhllllllhhhhhhhhhhhhhllhhhhhhlhhhhhhhhhhlllllllh


DSSP  --------------------ll
Query --------------------lt  142
ident                       
Sbjct ehveeiselfydakssakilad  311
DSSP  hhhhhhhhhlllhhhhhhhhhl


No 7: Query=mol1A Sbjct=3bosB Z-score=11.3

back to top
DSSP  ---------------llllhHHHHHHHHHHHHLL-----LLLLEEEELLLLLLHHHHHHH
Query ---------------igrseWINQYRRRLQQLSE-----TDIAVWLYGAPGTGRXTGARY   40
ident                                |          |  | |    ||      
Sbjct plqlslpvhlpddetftsyyPAAGNDELIGALKSaasgdGVQAIYLWGPVKSGRTHLIHA   60
DSSP  lllleeelllllllllllllLLLLLHHHHHHHHHhhhllLLLEEEEELLLLLLHHHHHHH


DSSP  HHHLLllLLLLLEEEEL-LLLLlLLHHHHHHHhLLLLEEEELHHHL--LHHHHHHHHHHH
Query LHQFGrnAQGEFVYREL-TPDNaPQLNDFIALaQGGTLVLSHPEHL--TREQQYHLVQLQ   97
ident              |  |              | |                        | 
Sbjct ACARAneLERRSFYIPLgIHAS-ISTALLEGLeQFDLICIDDVDAVagHPLWEEAIFDLY  119
DSSP  HHHHHhhLLLLEEEEEHhHHHH-LLHHHHLLHhHLLEEEEELHHHHllLHHHHHHHHHHH


DSSP  H--LLLLLLLEEEEELLLHHHHHhhlLLLHHHHHHHH-HHEEELLLLL------------
Query S--QEHRPFRLIGIGDTSLVELAasnHIIAELYYCFA-XTQIACLPLT------------  142
ident     |     ||     |  |          |             |              
Sbjct NrvAEQKRGSLIVSASASPXEAG---FVLPDLVSRXHwGLTYQLQPXXddeklaalqrra  176
DSSP  HhhHLLLLLEEEEEELLLLLLLL---LLLHHHHHHHHhLEEEELLLLLhhhhhhhhhhhh


DSSP  -------------------------------------------------------
Query -------------------------------------------------------  142
ident                                                        
Sbjct axrglqlpedvgrfllnrxardlrtlfdvldrldkasxvhqrkltipfvkexlrl  231
DSSP  hhllllllhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhlllllhhhhhhhhll


No 8: Query=mol1A Sbjct=2chqA Z-score=11.2

back to top
DSSP  ----------llllhHHHHHHHHHHHHL--LLLLLEEEELLLLLLHHHHHHHHHHLLL--
Query ----------igrseWINQYRRRLQQLS--ETDIAVWLYGAPGTGRXTGARYLHQFGR--   46
ident                       ||               | ||||    |  |       
Sbjct iwvekyrprtldevvGQDEVIQRLKGYVerKNIPHLLFSGPPGTGKTATAIALARDLFge   60
DSSP  llllllllllhhhllLLHHHHHHHHLLLllLLLLLEEEELLLLLLHHHHHHHHHHHHHll


DSSP  lLLLLLEEEEL-LLLLLLLHHHHHHHHL---------LLLEEEE-LHHH--lLHHHHHHH
Query nAQGEFVYREL-TPDNAPQLNDFIALAQ---------GGTLVLS-HPEH--lTREQQYHL   93
ident      |                 |                  |                 
Sbjct nWRDNFIEMNAsDERGIDVVRHKIKEFArtapiggapFKIIFLDeADALtadAQAALRRT  120
DSSP  lHHHHLEEEELlLLLLLLLLLHHHHHHHhllllllllLEEEEEElHHHLlhhHHHLLHHH


DSSP  HHHHHlllLLLLEEEEELLLhHHHHhhllllHHHHHHHhhHEEELLLL------------
Query VQLQSqehRPFRLIGIGDTSlVELAasnhiiAELYYCFaxTQIACLPL------------  141
ident     |      | |                                |             
Sbjct MEMYS---KSCRFILSCNYV-SRII------EPIQSRC--AVFRFKPVpkeamkkrllei  168
DSSP  LLLLL---LLEEEEEEELLH-HHLL------HHHHLLL--EEEELLLLlhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct cekegvkitedglealiyisggdfrkainalqgaaaigevvdadtiyqitatarpeemte  228
DSSP  hhlllllllhhhhhhhhhlllllhhhhhhhhhhhhhllllllhhhhhhhlllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct liqtalkgnfmearelldrlmveygmsgedivaqlfreiismpikdslkvqlidklgevd  288
DSSP  hhhhhhhllhhhhhhhhhhhhhhllllhhhhhhhhhhhhhlllllllhhhhhhhhhhhhh


DSSP  ------------------------l
Query ------------------------t  142
ident                          
Sbjct frlteganeriqldaylaylstlak  313
DSSP  hhhhllllhhhhhhhhhhhhhhlll


No 9: Query=mol1A Sbjct=1iqpA Z-score=11.1

back to top
DSSP  ----------------------llllhHHHHHHHHHHHHL--LLLLLEEEELLLLLLHHH
Query ----------------------igrseWINQYRRRLQQLS--ETDIAVWLYGAPGTGRXT   36
ident                                   ||               | || |  |
Sbjct seeirevkvlekpwvekyrpqrlddivGQEHIVKRLKHYVktGSMPHLLFAGPPGVGKTT   60
DSSP  llllhhhhhllllhhhhllllllllllLLHHHHHHHHHHHhhLLLLEEEEELLLLLLHHH


DSSP  HHHHHHHLLL--lLLLLLEEEEL-LLLLLL-LHHHHHHHH--------lLLLEEEE-LHH
Query GARYLHQFGR--nAQGEFVYREL-TPDNAP-QLNDFIALA--------qGGTLVLS-HPE   83
ident  |  |            |                     |              |     
Sbjct AALALARELFgenWRHNFLELNAsDERGINvIREKVKEFArtkpiggasFKIIFLDeADA  120
DSSP  HHHHHHHHHHhhhHHHHEEEEELlLHHHHHlLHHHHHHHHhlllhhhllLEEEEEElHHH


DSSP  H---LLHHHHHHHHHHHhlllLLLLEEEEELLLhHHHHhhllllHHHHHHHhhHEEELLL
Query H---LTREQQYHLVQLQsqehRPFRLIGIGDTSlVELAasnhiiAELYYCFaxTQIACLP  140
ident                         | |     |                          |
Sbjct LtqdAQQALRRTMEMFS----SNVRFILSCNYS-SKII------EPIQSRC--AIFRFRP  167
DSSP  LlhhHHHHHHHHHHHLL----LLEEEEEEELLH-HHLL------HHHHHLE--EEEELLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct lrdediakrlryiaeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvf  227
DSSP  llhhhhhhhhhhhhhlllleelhhhhhhhhhhhlllhhhhhhhhhhhhlllleelhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct mvasrarpediremmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieep  287
DSSP  hhlllllhhhhhhhhhhhhhllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhllllhh


DSSP  -------------------------------------ll
Query -------------------------------------lt  142
ident                                        
Sbjct kkvlladkigeynfrlveganeiiqleallaqftligkk  326
DSSP  hhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhll


No 10: Query=mol1A Sbjct=2c9oA Z-score=10.8

back to top
DSSP  ---------------------------llllHHHHHHHHHHHHHLLLL-------LLEEE
Query ---------------------------igrsEWINQYRRRLQQLSETD-------IAVWL   26
ident                                      |       |          || |
Sbjct ttktqriashshvkglgldesglakqaasglVGQENAREACGVIVELIkskkmagRAVLL   60
DSSP  lhhhhhhhlllllllllllllllllleelleELLHHHHHHHHHHHHHHhllllllLEEEE


DSSP  ELLLLLLHHHHHHHHHHLLLlLLLLLEEEELLllLLLL--------HHHHHHHHL-----
Query YGAPGTGRXTGARYLHQFGRnAQGEFVYRELTpdNAPQ--------LNDFIALAQ-----   73
ident  | ||||    |    |        |                    |      |      
Sbjct AGPPGTGKTALALAIAQELG-SKVPFCPMVGS--EVYSteikktevLMENFRRAIglrik  117
DSSP  ELLLLLLHHHHHHHHHHHHL-LLLLEEEEEHH--HHLLllllhhhhHHHHHHHLEeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   73
ident                                                             
Sbjct etkevyegevteltpchviiglktakgtkqlkldpsifeslqkerveagdviyieansga  177
DSSP  eeeeeeeeeeeeeeelleeeeeeelleeeeeeelhhhhhhhhhlllllleeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   73
ident                                                             
Sbjct vkrqgrcdtyatefdleaeeyvplpkgdvhkkkeiiqdvtlhdldvangeinkvvnkyid  237
DSSP  eeeeeeellllllllllllleellllllleeeeeeeeeeehhhhhhlllhhhhhhhhhhh


DSSP  -------LLLEEEELHHHLLHHHHHHHHHHHHLLLlLLLEEEEELLlhhhhhHHLL----
Query -------GGTLVLSHPEHLTREQQYHLVQLQSQEHrPFRLIGIGDTslvelaASNH----  122
ident         | |       |  |    |             |                   
Sbjct qgiaelvPGVLFVDEVHMLDIECFTYLHRALESSI-APIVIFASNR-----gNCVIrgte  291
DSSP  llleeeeELEEEEELHHHLLHHHHHHHHHHLLLLL-LLEEEEEELL-----lEEELllll


DSSP  -------LLHHHHHHHhhHEEELLL-----------------------------------
Query -------IIAELYYCFaxTQIACLP-----------------------------------  140
ident        |   |        |                                       
Sbjct ditsphgIPLDLLDRV--MIIRTMLytpqemkqiikiraqteginiseealnhlgeigtk  349
DSSP  lleeellLLHHHHLLE--EEEELLLllhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhh


DSSP  -----------------------------------------------ll
Query -----------------------------------------------lt  142
ident                                                  
Sbjct ttlrysvqlltpanllakingkdsiekehveeiselfydakssakilad  398
DSSP  llhhhhhhlhhhhhhhhhhlllllllhhhhhhhhhhlllhhhhhhhhhl


No 11: Query=mol1A Sbjct=3cf1B Z-score=10.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde   60
DSSP  llllllleelllllllllllllhhhhhhhllllllllleeellleeelllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl  120
DSSP  leellhhhhhlllllllllllllllllllllleeeeeelhhhlllllllhhhhlhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne  180
DSSP  lllllllllllleeeelleeeeeeeeellllllllllllleeelllllllllllllllll


DSSP  --llllhHHHHHHHHHHHHLLL---------------LLLEEEELLLLLLHHHHHHHHHH
Query --igrseWINQYRRRLQQLSET---------------DIAVWLYGAPGTGRXTGARYLHQ   43
ident                     |                     ||| ||||    ||    
Sbjct vgyddigGCRKQLAQIKEMVELplrhpalfkaigvkpPRGILLYGPPGTGKTLIARAVAN  240
DSSP  llhhhllLLHHHHHHHHHHHLLlllllllllllllllLLEEEELLLLLLLHHHHHHHHHH


DSSP  LLLLlllLLEEEEL--LLLL-----lLLHHHHHHHHL---LLLEEEELHHHL--------
Query FGRNaqgEFVYREL--TPDN-----aPQLNDFIALAQ---GGTLVLSHPEHL--------   85
ident         |                   |      |                        
Sbjct ETGA---FFFLINGpeIMSKlageseSNLRKAFEEAEknaPAIIFIDELDAIapkrekth  297
DSSP  HHLL---EEEEEELlhHHHLlllhhhHHHHHHHHHHHhllLEEEEEELHHHLllllllll


DSSP  ------LHHHHHHHHHHHHLLLLlLLEEEEELLLhHHHHhhllllHHHHH--HHHHhEEE
Query ------TREQQYHLVQLQSQEHRpFRLIGIGDTSlVELAasnhiiAELYY--CFAXtQIA  137
ident          |   |     |                           |     |      
Sbjct geverrIVSQLLTLMDGLKQRAH-VIVMAATNRP-NSID------PALRRfgRFDR-EVD  348
DSSP  lhhhhhHHHHHHHHHLLLLLLLL-LLEEEELLLL-LLLL------HHHLLllLLLE-EEL


DSSP  LLLLL-------------------------------------------------------
Query CLPLT-------------------------------------------------------  142
ident                                                             
Sbjct IGIPDatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmd  408
DSSP  LLLLLhhhhhhhhhhhlllllllllllhhhhhlllllllllhhhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct lidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkre  468
DSSP  hhllllllllhhhhhhllllhhhhhhhhhhllllllllllllllllllllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct lqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpell  528
DSSP  hhhhhhhhhhlllhhhhhllllllleeeellllllhhhhhhhhhhhllleeeellhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct tmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltem  588
DSSP  hhhlllllhhhhhhhhhhhlllleeeeeelllhhhhhlllllllllllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct dgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvak  648
DSSP  hlllllllleeeeeellhhhllhhhllllllleeeelllllhhhhhhhhhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct dvdleflakmtngfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvs  708
DSSP  lllhhhhllllllllhhhhhhhhhhhhllhhhhhhhhhllllllhhhhhhhhllllllll


DSSP  ---------------
Query ---------------  142
ident                
Sbjct dndirkyemfaqtlq  723
DSSP  hhhhhhhhhhhhhhl


No 12: Query=mol1A Sbjct=1ixsB Z-score=10.6

back to top
DSSP  -------llllhHHHHHHHHHHHHLL-------lLLLEEEELLLLLLHHHHHHHHHHLLL
Query -------igrseWINQYRRRLQQLSE-------tDIAVWLYGAPGTGRXTGARYLHQFGR   46
ident                     |    |             | | || |  | |        
Sbjct lalrpktldeyiGQERLKQKLRVYLEaakarkepLEHLLLFGPPGLGKTTLAHVIAHELG   60
DSSP  lllllllhhhllLLHHHHHHHHHHHHhhllllllLLLEEEELLLLLLHHHHHHHHHHHHL


DSSP  LlllLLEEEELLllLLLL---HHHHHH-HHLL-LLEEEELH-HHLLHhhHHHHHHHHHL-
Query NaqgEFVYRELTpdNAPQ---LNDFIA-LAQG-GTLVLSHP-EHLTReqQYHLVQLQSQ-   99
ident                      |    |        |               ||       
Sbjct V---NLRVTSGP--AIEKpgdLAAILAnSLEEgDILFIDEIhRLSRQ-aEEHLYPAMEDf  114
DSSP  L---LEEEEELL--LLLLhhhHHHHHHlLLLLlLEEEEELHhHLLHH-hHHHHHHHHHHl


DSSP  -----------------lllLLLEEEEELLLhHHHHhhllllHHHHHHHhHHEEELLLL-
Query -----------------ehrPFRLIGIGDTSlVELAasnhiiAELYYCFaXTQIACLPL-  141
ident                      | |||                | |   |           
Sbjct vmdivigqgpaartirlelpRFTLIGATTRP-GLIT------APLLSRF-GIVEHLEYYt  166
DSSP  eeeeelllllllleeeeellLLEEEEEELLL-LLLL------LHHHHHL-LEEEELLLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct peelaqgvmrdarllgvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitre  226
DSSP  hhhhhhhhhhhhhhhlllllhhhhhhhhhhllllhhhhhhhhhhhhhhhlllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct ralealaalgldelglekrdreilevlilrfgggpvglatlatalsedpgtleevhepyl  286
DSSP  hhhhhhhhhllllllllhhhhhhhhlllllllllllllhhhhhhhlllllhhhhllhhhh


DSSP  ----------------------------l
Query ----------------------------t  142
ident                              
Sbjct irqgllkrtprgrvatelayrhlgypppv  315
DSSP  hhllleeelllleeelhhhhhhhllllll


No 13: Query=mol1A Sbjct=1sxjB Z-score=10.6

back to top
DSSP  -------------llllhhHHHHHHHHHHHL--LLLLLEEEELLLLLLHHHHHHHHHHLL
Query -------------igrsewINQYRRRLQQLS--ETDIAVWLYGAPGTGRXTGARYLHQFG   45
ident                          ||||             | || |  |    |    
Sbjct lqlpwvekyrpqvlsdivgNKETIDRLQQIAkdGNMPHMIISGMPGIGKTTSVHCLAHEL   60
DSSP  llllhhhhlllllhhhlllLLHHHHHHHHHHhlLLLLLEEEELLLLLLHHHHHHHHHHHH


DSSP  L--lLLLLLEEEELLLlLLLL--HHHHHHHHL----------LLLEEEELH-HHLLHhhH
Query R--nAQGEFVYRELTPdNAPQ--LNDFIALAQ----------GGTLVLSHP-EHLTReqQ   90
ident                            |                   |           |
Sbjct LgrsYADGVLELNASD-DRGIdvVRNQIKHFAqkklhlppgkHKIVILDEAdSMTAG-aQ  118
DSSP  HhhhHHHHEEEELLLL-LLLHhhHHLHHHHHHhlllllllllLEEEEEELHhHLLHH-hH


DSSP  HHHHHHHHlllLLLLEEEEELlLHHHhhhhllLLHHHHHHHhhHEEELLL----------
Query YHLVQLQSqehRPFRLIGIGDtSLVElaasnhIIAELYYCFaxTQIACLP----------  140
ident   |           |                 ||  |                       
Sbjct QALRRTMElysNSTRFAFACN-QSNK------IIEPLQSQC--AILRYSKlsdedvlkrl  169
DSSP  HLLHHHHHhllLLEEEEEEEL-LHHH------LLHHHHLLL--EEEELLLllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct lqiikledvkytndgleaiiftaegdmrqainnlqstvaghglvnadnvfkivdsphpli  229
DSSP  hhhhhhhlllllhhhhhhhhhhhlllhhhhhhhhhhhhhhhllllhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct vkkmllasnledsiqilrtdlwkkgyssidivttsfrvtknlaqvkesvrlemikeiglt  289
DSSP  hhhhhllllhhhhhhhhhhllllllllhhhhhhhhhhhhhllllllhhhhhhhhhhhhhh


DSSP  -------------------------ll
Query -------------------------lt  142
ident                            
Sbjct hmrilegvgtylqlasmlakihklnnk  316
DSSP  hhhhhlllllhhhhhhhhhhhhhhlll


No 14: Query=mol1A Sbjct=1sxjE Z-score=10.5

back to top
DSSP  ---------llllHHHHHHHHHHHHHLL---LLLLEEEELLLLLLHHHHHHHHHHLLL--
Query ---------igrsEWINQYRRRLQQLSE---TDIAVWLYGAPGTGRXTGARYLHQFGR--   46
ident                       |  ||          |||  |||  |    |       
Sbjct wvdkyrpkslnalSHNEELTNFLKSLSDqprDLPHLLLYGPNGTGKKTRCMALLESIFgp   60
DSSP  lllllllllhhhlLLLHHHHHHHHLLLLlllLLLLEEEELLLLLLHHHHHHLHHHHHLll


DSSP  ------lllLLLEEEELLlLLLLLHHHHHHHHL-----LLLEEEELHHHLLHHHHHHHHH
Query ------naqGEFVYRELTpDNAPQLNDFIALAQ-----GGTLVLSHPEHLTREQQYHLVQ   95
ident                                                  ||   |  |  
Sbjct gvyrnvvssPYHLEITPS-NDRIVIQELLKEVAqmeqrYKCVIINEANSLTKDAQAALRR  119
DSSP  lllllleelLLEEEELLL-LLHHHHHHHHHHHLlllllLEEEEEELLLLLLHHHHHHHHH


DSSP  HHHLllLLLLEEEEELLLhhhhhhhLLLLHHHHHHHhhHEEELLL---------------
Query LQSQehRPFRLIGIGDTSlvelaasNHIIAELYYCFaxTQIACLP---------------  140
ident          |||   |           |||          | |                 
Sbjct TMEKysKNIRLIMVCDSM-------SPIIAPIKSQC--LLIRCPApsdseistilsdvvt  170
DSSP  HHHHllLLEEEEEEELLL-------LLLLHHHHLLL--EEEELLLllhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct neriqletkdilkriaqasngnlrvsllmlesmalnnelalkssspiikpdwiivihklt  230
DSSP  hhlleelllhhhhhhhhhhlllhhhhhhhhlhhhhlllleelllllllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct rkivkersvnsliecravlydllahcipaniilkeltfslldvetlnttnkssiieyssv  290
DSSP  hhhhhlllhhhhhhhhhhhhhhhlllllhhhhhhhhhhlllllllllhhhhhhhhhhhhh


DSSP  -------------------------ll
Query -------------------------lt  142
ident                            
Sbjct fderlslgnkaifhlegfiakvmccld  317
DSSP  hhhhhhllllhhhhhhhhhhhhhhhhl


No 15: Query=mol1A Sbjct=3hteE Z-score=10.1

back to top
DSSP  -----------llllhHHHHHHHHHHHHLLLL---------------LLEEEELLLLLLH
Query -----------igrseWINQYRRRLQQLSETD---------------IAVWLYGAPGTGR   34
ident                    |    |                          | |  | | 
Sbjct lptpheirnhlddyviGQEQAKKVLAVAVYNHykrlrngsngvelgkSNILLIGPTGSGK   60
DSSP  lllhhhhhhhhhllllLLHHHHHHHHHHHHHHhhhhhhlllllllllLLEEEELLLLLLH


DSSP  HHHHHHHHHLlllLLLLLEEEELLL---llllLHHHHHHHH-----------LLLLEEEE
Query XTGARYLHQFgrnAQGEFVYRELTP---dnapQLNDFIALA-----------QGGTLVLS   80
ident    |  |          |     |             |              | |     
Sbjct TLLAETLARL---LDVPFTMADATTltgyvgeDVENIIQKLlqkcdydvqkaQRGIVYID  117
DSSP  HHHHHHHHHL---LLLLEEEEEHHHhllllhhHHHHHHHHHhhlllllhhhhHHLEEEEE


DSSP  LHHHL--LHHHHHHHHHHHHLL-lLLLLEEEEELL---------------------lHHH
Query HPEHL--TREQQYHLVQLQSQE-hRPFRLIGIGDT---------------------sLVE  116
ident            |  |  |           |  |                           
Sbjct QIDKIsrGEGVQQALLKLIEGTdtSKILFICGGAFagldkvishrvesegellaqvePED  177
DSSP  LHHHHllLHHHHHHHHHHHHLLllLLLEEEEEELLllhhhhhhhhhllhhhhhllllHHH


DSSP  HHHhLLLLHHHHHHHhHHEEELLLLL----------------------------------
Query LAAsNHIIAELYYCFaXTQIACLPLT----------------------------------  142
ident |      | |              |                                   
Sbjct LIK-FGLIPEFIGRL-PVVATLNELSeealiqilkepknaltkqyqalfnlegvdlefrd  235
DSSP  HHH-HLLLHHHHLLL-LEEEELLLLLhhhhhhhhhlllllhhhhhhhhhhhllleeeelh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct ealdaiakkamarktgarglrsiveaalldtmydlpsmedvekvvidesvidgqskplli  295
DSSP  hhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhhhhlllleeeelhhhhllllllleee


DSSP  -------
Query -------  142
ident        
Sbjct ygkpeaq  302
DSSP  lllllll


No 16: Query=mol1A Sbjct=2qbyA Z-score=10.1

back to top
DSSP  -------------llllHHHHHHHHHHHHHLLL------LLLEEEELLLLLLHHHHHHHH
Query -------------igrsEWINQYRRRLQQLSET------DIAVWLYGAPGTGRXTGARYL   41
ident                         |                    ||  |||        
Sbjct ifinreyllpdyipdelPHREDQIRKIASILAPlyreekPNNIFIYGLTGTGKTAVVKFV   60
DSSP  llllhhhhlllllllllLLLHHHHHHHHHLLHHhhhlllLLLEEEEELLLLLHHHHHHHH


DSSP  HHLLL---llLLLLEEEEL-LLLLLLLHHHHHHHHL------------------------
Query HQFGR---naQGEFVYREL-TPDNAPQLNDFIALAQ------------------------   73
ident               ||      |                                     
Sbjct LSKLHkkflgKFKHVYINTrQIDTPYRVLADLLESLdvkvpftglsiaelyrrlvkavrd  120
DSSP  HHHHHhhlllLLEEEEEEHhHHLLHHHHHHHHLLLLllllllllllhhhhhhhhhhhhhl


DSSP  ---LLLEEEELHHHL----LHHHHHHHHHHHHLLLLlLLEEEEELLLhhHHHHhlLLLHH
Query ---GGTLVLSHPEHL----TREQQYHLVQLQSQEHRpFRLIGIGDTSlvELAAsnHIIAE  126
ident        ||               | |    |        |||                 
Sbjct ygsQVVIVLDEIDAFvkkyNDDILYKLSRINSEVNK-ISFIGITNDV--KFVD--LLDPR  175
DSSP  lllLEEEEEELHHHHhhllLLLHHHHHHHHHHLLLL-EEEEEEELLH--HHHH--HLLLH


DSSP  HHHHHHHHEEELLL----------------------------------------------
Query LYYCFAXTQIACLP----------------------------------------------  140
ident          |   |                                              
Sbjct VKSSLSEEEIIFPPynaeelediltkraqmafkpgvlpdnviklcaalaarehgdarral  235
DSSP  HHHLLLLEEEEELLllhhhhhhhhhhhhhhhlllllllhhhhhhhhhhhhhllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct dllrvsgeiaermkdtkvkeeyvymakeeierdrvrdiiltlpfhsklvlmavvsisvst  295
DSSP  hhhhhhhhhhhhlllllllhhhhhhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct tgavyetylnickklgveavtqrrvsdiineldmvgiltakvvnrgrygktkeiglavdk  355
DSSP  hhhhhhhhhhhhhhhllllllhhhhhhhhhhhhhhlleeeeellllllllleeeeellll


DSSP  ---------ll
Query ---------lt  142
ident            
Sbjct niivrsliesd  366
DSSP  hhhhhhhhhhl


No 17: Query=mol1A Sbjct=2qz4A Z-score=10.1

back to top
DSSP  ----llllhHHHHHHHHHHHHLLL--------LLLEEEELLLLLLHHHHHHHHHHLLLLl
Query ----igrseWINQYRRRLQQLSET--------DIAVWLYGAPGTGRXTGARYLHQFGRNa   48
ident                                      | | || |    |          
Sbjct mgvsfkdvaGMHEAKLEVREFVDYlkspeakvPKGALLLGPPGCGKTLLAKAVATEAQV-   59
DSSP  lllllllllLLHHHHHHHHHHHHHhhllllllLLEEEEELLLLLLHHHHHHHHHHHHLL-


DSSP  llLLEEEE--LLLL----LLLL-HHHHHHHHL---LLLEEEELhhHLLHhHHHHHHHHHh
Query qgEFVYRE--LTPD----NAPQ-LNDFIALAQ---GGTLVLSHpeHLTReQQYHLVQLQs   98
ident    |                          |                   |         
Sbjct --PFLAMAgaEFVEviggLGAArVRSLFKEARaraPCIVYIDEieQTLN-QLLVEMDGM-  115
DSSP  --LEEEEEllLLLLllllHHHHhHHHHHHHHHhllLEEEEEELllHHHH-HHHHHHHLL-


DSSP  LLLLLLLEEEEELLLhhHHHHhllllHHHHH--HHHHhEEELLL----------------
Query QEHRPFRLIGIGDTSlvELAAsnhiiAELYY--CFAXtQIACLP----------------  140
ident                             |                               
Sbjct GTTDHVIVLASTNRA--DILD-----GALMRpgRLDR-HVFIDLptlqerreifeqhlks  167
DSSP  LLLLLEEEEEEELLH--HHHH-----LHHHLllLLLE-EEELLLllhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------ll
Query ------------------------------------------------------lt  142
ident                                                         
Sbjct lkltqsstfysqrlaeltpgfsgadianicneaalhvhtlnfeyavervlagtakk  223
DSSP  llllllhhhhhhhhhhllllllhhhhhhhhhhhhlllllllhhhhhhhhhhhhhll


No 18: Query=mol1A Sbjct=3eihA Z-score=10.0

back to top
DSSP  -------------llllhHHHHHHHHHHHHLL--------------LLLLEEEELLLLLL
Query -------------igrseWINQYRRRLQQLSE--------------TDIAVWLYGAPGTG   33
ident                           |                         ||| ||||
Sbjct lssailsekpnvkwedvaGLEGAKEALKEAVIlpvkfphlfkgnrkPTSGILLYGPPGTG   60
DSSP  lllllllllllllhhhllLLHHHHHHHHHHLHhhhhllllllllllLLLEEEEELLLLLL


DSSP  HHHHHHHHHHLLLLlllLLEEEEL---LLLL---LLLH-HHHHHHHL---LLLEEEELHH
Query RXTGARYLHQFGRNaqgEFVYREL---TPDN---APQL-NDFIALAQ---GGTLVLSHPE   83
ident     |             |                  |     | |              
Sbjct KSYLAKAVATEANS---TFFSVSSsdlVSKWmgeSEKLvKQLFAMARenkPSIIFIDQVD  117
DSSP  HHHHHHHHHHLLLL---EEEEEEHhhhHHLLhhhHHHHhHHHHHHHHlllLEEEEEELHH


DSSP  HL--------------LHHHHHHHHHHHHLLLLLLLEEEEELLLhHHHHhhllllHHHHH
Query HL--------------TREQQYHLVQLQSQEHRPFRLIGIGDTSlVELAasnhiiAELYY  129
ident  |                                    |        |            
Sbjct ALtgtrgegeseasrrIKTELLVQMNGVGNDSQGVLVLGATNIP-WQLD------SAIRR  170
DSSP  HLllllllllllllhhHHHHHHHHHHHHHLLLLLEEEEEEELLH-HHLL------HHHHH


DSSP  HHhHHEEELLLLL-----------------------------------------------
Query CFaXTQIACLPLT-----------------------------------------------  142
ident  |    |                                                     
Sbjct RF-ERRIYIPLPDlaarttmfeinvgdtpcvltkedyrtlgamtegysgsdiavvvkdal  229
DSSP  HL-LEEEELLLLLhhhhhhhhhhhhllllllllhhhhhhhhhhlllllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct mqpirkiqsathfkdvsteddetrkltpcspgddgaiemswtdieadelkepdltikdfl  289
DSSP  hhhhhhhhllleeeelllllllllleeelllllllleellhhhllhhhlllllllhhhhh


DSSP  ------------------------------
Query ------------------------------  142
ident                               
Sbjct kaikstrptvneddllkqeqftrdfgqegn  319
DSSP  hhhhlllllllhhhhhhhhhhhhhllllll


No 19: Query=mol1A Sbjct=2z4rA Z-score=10.0

back to top
DSSP  -----------lllLHHHHHHHHHHHHHLLLL---LLEEEELLLLLLHHHHHHHHHHLLL
Query -----------igrSEWINQYRRRLQQLSETD---IAVWLYGAPGTGRXTGARYLHQFGR   46
ident                                         ||  | |             
Sbjct tplnpdytfenfvvGPGNSFAYHAALEVAKHPgryNPLFIYGGVGLGKTHLLQSIGNYVV   60
DSSP  llllllllhhhlllLLLLHHHHHHHHHHHHLLlllLLEEEELLLLLLHHHHHHHHHHHHH


DSSP  --llLLLLEEEELL--LLLLL----------LHHHHHHHHllLLEEEELHHHL-----LH
Query --naQGEFVYRELT--PDNAP----------QLNDFIALAqgGTLVLSHPEHL-----TR   87
ident          |                                  |       |       
Sbjct qnepDLRVMYITSEkfLNDLVdsmkegklneFREKYRKKV--DILLIDDVQFLigktgVQ  118
DSSP  hhllLLLEEEEEHHhhHHHHHhhhhlllhhhHHHHHLLLL--LEEEEELHHHHlllhhHH


DSSP  HHHHHHHHHHHLllLLLLEEEEELLLHHHHhhhLLLLHHHHHHHH-HHEEELLL------
Query EQQYHLVQLQSQehRPFRLIGIGDTSLVELaasNHIIAELYYCFA-XTQIACLP------  140
ident     |                  |     |         |   |         |      
Sbjct TELFHTFNELHD--SGKQIVICSDREPQKL---SEFQDRLVSRFQmGLVAKLEPpdeetr  173
DSSP  HHHHHHHHHHHL--LLLEEEEEELLLLLLL---LLLLHHHHHHHHlLEEEELLLllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ksiarkmleiehgelpeevlnfvaenvddnlrrlrgaiikllvykettgkevdlkeaill  233
DSSP  hhhhhhhhhhhlllllllhhhhhhhhllllhhhhhhhhhhhhhhhhhllllllhhhhhhh


DSSP  -----ll
Query -----lt  142
ident        
Sbjct lkdfikp  240
DSSP  lhhhlll


No 20: Query=mol1A Sbjct=2gnoA Z-score=9.9

back to top
DSSP  llllhhhhHHHHHHHHHLL--lLLLEEEELLLLLLHHHHHHHHHHLLL---lllLLLEEE
Query igrsewinQYRRRLQQLSE--tDIAVWLYGAPGTGRXTGARYLHQFGR---naqGEFVYR   55
ident              |    |    |     |            |                 
Sbjct --------DQLETLKRIIEkseGISILINGEDLSYPREVSLELPEYVEkfppkaSDVLEI   52
DSSP  --------LHHHHHHHHHHlllLEEEEEELLLLLHHHHHHHHHHHHHHllllllLLEEEE


DSSP  eLLLL--lLLLH-HHHHHHHL-------lLLEEEELHHHLLHHHHHHHHHHHHllLLLLL
Query eLTPD--nAPQL-NDFIALAQ-------gGTLVLSHPEHLTREQQYHLVQLQSqeHRPFR  105
ident                                      |  |                   
Sbjct -DPEGeniGIDDiRTIKDFLNyspelytrKYVIVHDCERXTQQAANAFLKALEepPEYAV  111
DSSP  -LLLLlllLHHHhHHHHHHHLllllllllEEEEELLHHHLLHHHHHHLHHHHHllLLLEE


DSSP  EEEEELlLHHHhhhhllLLHHHHHHHhhHEEELLLL------------------------
Query LIGIGDtSLVElaasnhIIAELYYCFaxTQIACLPL------------------------  141
ident                                                             
Sbjct IVLNTR-RWHY------LLPTIKSRV--FRVVVNVPkefrdlvkekigdlweelpllerd  162
DSSP  EEEEEL-LHHH------LLHHHHLLL--EEEELLLLhhhhhhhhhhhllhhhhlhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct fktaleayklgaeklsglxeslkvletekllkkvlskglegylacrellerfskveskef  222
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhllhhhhlllllllhhhhhhhhhhhhhhhhhllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct falfdqvtntitgkdaflliqrltriilhentwesvedqksvsfldsilrvkianlnnkl  282
DSSP  hhhhhhhhhhlllhhhhhhhhhhhhhhhhllllllhhhhhhhhhhhhhhlllhhhllhhh


DSSP  -------------l
Query -------------t  142
ident               
Sbjct tlxnilaihrerkr  296
DSSP  hhhhhhhhhhhhhl


No 21: Query=mol1A Sbjct=3h4mA Z-score=9.8

back to top
DSSP  -----------llllhHHHHHHHHHHHH-LLLL--------------LLEEEELLLLLLH
Query -----------igrseWINQYRRRLQQL-SETD--------------IAVWLYGAPGTGR   34
ident                                                    ||| |||| 
Sbjct amevderpnvryedigGLEKQMQEIREVvELPLkhpelfekvgieppKGILLYGPPGTGK   60
DSSP  leeeellllllhhhllLLHHHHHHHHHHlHHHHhlhhhhhhhlllllLEEEEELLLLLLH


DSSP  HHHHHHHHHLLLLlllLLEEEE--LLLL-----LLLLHHHHHHHHL---LLLEEEELHHH
Query XTGARYLHQFGRNaqgEFVYRE--LTPD-----NAPQLNDFIALAQ---GGTLVLSHPEH   84
ident    |             |                |    |   ||               
Sbjct TLLAKAVATETNA---TFIRVVgsELVKkfigeGASLVKDIFKLAKekaPSIIFIDEIDA  117
DSSP  HHHHHHHHHHLLL---EEEEEEhhHHLLllllhHHHHHHHHHHHHHhllLEEEEEELLHH


DSSP  L-----------------LHHHHHHHHHHHHLlLLLLLEEEEELLLhHHHHhhllllHHH
Query L-----------------TREQQYHLVQLQSQeHRPFRLIGIGDTSlVELAasnhiiAEL  127
ident                   |  |                 ||        |          
Sbjct IaakrtdaltggdrevqrTLMQLLAEMDGFDA-RGDVKIIGATNRP-DILD------PAI  169
DSSP  HhllllllllhhhhhhhhHHHHHHHHHHLLLL-LLLEEEEEELLLH-HHLL------HHH


DSSP  HH--HHHHhEEELLLLL-------------------------------------------
Query YY--CFAXtQIACLPLT-------------------------------------------  142
ident      |    |                                                 
Sbjct LRpgRFDR-IIEVPAPDekgrleilkihtrkmnlaedvnleeiakmtegcvgaelkaict  228
DSSP  HLllLEEE-EEELLLLLhhhhhhhhhhhhllllllllllhhhhhhhlllllhhhhhhhhh


DSSP  ---------------------------------
Query ---------------------------------  142
ident                                  
Sbjct eagmnairelrdyvtmddfrkavekimekkkvk  261
DSSP  hhhhhhhhlllllllhhhhhhhhhhhhhhhlll


No 22: Query=mol1A Sbjct=1lv7A Z-score=9.8

back to top
DSSP  ----------llllhHHHHHHHHHHHHLLL---------LLLEEEELLLLLLHHHHHHHH
Query ----------igrseWINQYRRRLQQLSET---------DIAVWLYGAPGTGRXTGARYL   41
ident                           | |             |   | ||||    |   
Sbjct mltedqikttfadvaGCDEAKEEVAELVEYlrepsrfkiPKGVLMVGPPGTGKTLLAKAI   60
DSSP  leeellllllhhhllLLHHHHHHLHHHHHHhhlhhhlllLLEEEEELLLLLLHHHHHHHH


DSSP  HHLLLLlllLLEEEELL-----LLLLL--LHHHHHHHHL---LLLEEEELHHHL------
Query HQFGRNaqgEFVYRELT-----PDNAP--QLNDFIALAQ---GGTLVLSHPEHL------   85
ident           |                     |    |                      
Sbjct AGEAKV---PFFTISGSdfvemFVGVGasRVRDMFEQAKkaaPCIIFIDEIDAVgrqrga  117
DSSP  HHHHLL---LEEEELLLlllllLLLLLhhHHHHHHHHHHlllLEEEEELLHHHHllllll


DSSP  -----------LHHHHHHHHHHHhLLLLLLLEEEEELLlHHHHHhhllllHHHHH--HHH
Query -----------TREQQYHLVQLQsQEHRPFRLIGIGDTsLVELAasnhiiAELYY--CFA  132
ident            |  |                 |         |         |     | 
Sbjct glggghdereqTLNQMLVEMDGF-EGNEGIIVIAATNR-PDVLD------PALLRpgRFD  169
DSSP  lllllllhhhhHHHHHHHHHHLL-LLLLLEEEEEEELL-LLLLL------HHHHLllLLL


DSSP  HhEEELLLLL--------------------------------------------------
Query XtQIACLPLT--------------------------------------------------  142
ident   |                                                         
Sbjct R-QVVVGLPDvrgreqilkvhmrrvplapdidaaiiargtpgfsgadlanlvneaalfaa  228
DSSP  E-EEELLLLLhhhhhhhhhhhhllllllllllhhhhhhllllllhhhhhhhhhhhhhhhh


DSSP  -----------------------
Query -----------------------  142
ident                        
Sbjct rgnkrvvsmvefekakdkimmgl  251
DSSP  hlllllllhhhhhhhhhhhllll


No 23: Query=mol1A Sbjct=2rkoA Z-score=9.8

back to top
DSSP  ---llllhHHHHHHHHHHH-HLLL-------------LLLEEEELLLLLLHHHHHHHHHH
Query ---igrseWINQYRRRLQQ-LSET-------------DIAVWLYGAPGTGRXTGARYLHQ   43
ident                 |                         ||| ||||    |     
Sbjct nvkwedvaGLEGAKEALKEaVILPvkfphlfkgnrkpTSGILLYGPPGTGKSYLAKAVAT   60
DSSP  lllhhhhlLLLLLHHHHHHhLHHHhllhhhlllllllLLEEEEELLLLLLHHHHHHHHHH


DSSP  LLLLlllLLEEEEL-LLLL---lLLHHHHHHHHL---LLLEEEELHHHL-----LHHHHH
Query FGRNaqgEFVYREL-TPDN---aPQLNDFIALAQ---GGTLVLSHPEHL-----TREQQY   91
ident         |                     | |               |           
Sbjct EANS---TFFSVSSsDLVSgeseKLVKQLFAMARenkPSIIFIDEVDALtasrrIKTELL  117
DSSP  HLLL---EEEEEELhHHHLlllhHHHHHHHHHHHlllLEEEEEELHHHHlllhhHHHHHH


DSSP  HHHHHHhlllLLLLEEEEELLLhHHHHhhllllHHHHHHHhHHEEELLLLL---------
Query HLVQLQsqehRPFRLIGIGDTSlVELAasnhiiAELYYCFaXTQIACLPLT---------  142
ident                 |        |             |    |               
Sbjct VQMNGV----QGVLVLGATNIP-WQLD------SAIRRRF-ERRIYIPLPDlaarttmfe  165
DSSP  HHHLLL----LLEEEEEEELLH-HHLL------HHHHHHL-LEEEELLLLLllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct invgdtpcvltkedyrtlgamtegysgsdiavvvkdalmqpirkiqsathfkdvltpcsp  225
DSSP  hllllllllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhllleeellleeell


DSSP  -------------------------------------------------------
Query -------------------------------------------------------  142
ident                                                        
Sbjct gddgaiemswtdieadelkepdltikdflkaikstrptvneddllkqeqftrdfg  280
DSSP  llllleelllllllllllllllllhhhhhhhhhlllllllhhhhhhhhhhhhhhl


No 24: Query=mol1A Sbjct=1fnnA Z-score=9.8

back to top
DSSP  --------------llllHHHHHHHHHHHHHLL--------lLLLEEEELLLLLLHHHHH
Query --------------igrsEWINQYRRRLQQLSE--------tDIAVWLYGAPGTGRXTGA   38
ident                       |    |  |                | | ||||     
Sbjct aivvddsvfspsyvpkrlPHREQQLQQLDILLGnwlrnpghhYPRATLLGRPGTGKTVTL   60
DSSP  lllllhhhhlllllllllLLLHHHHHHHHHHHHhhhhlllllLLEEEEELLLLLLHHHHH


DSSP  HHHHHLLL-lLLLLLEEEELLLlLLLL-HHHHHHHHL-----------------------
Query RYLHQFGR-nAQGEFVYRELTPdNAPQ-LNDFIALAQ-----------------------   73
ident | |           |||               ||                          
Sbjct RKLWELYKdkTTARFVYINGFIyRNFTaIIGEIARSLnipfprrglsrdeflallvehlr  120
DSSP  HHHHHHHLllLLLEEEEEELLLlLLHHhHHHHHHHHLllllllllllhhhhhhhhhhhhh


DSSP  ----LLLEEEELHHHLLHHHHHHHHHHHHLL----LLLLLEEEEELLLhhHHHHhlLLLH
Query ----GGTLVLSHPEHLTREQQYHLVQLQSQE----HRPFRLIGIGDTSlvELAAsnHIIA  125
ident        |||     |          |             |   |               
Sbjct erdlYMFLVLDDAFNLAPDILSTFIRLGQEAdklgAFRIALVIVGHND--AVLN--NLDP  176
DSSP  hlllLEEEEEELHHHLLHHHHHHHHHHLLLHhhhlLLLEEEEEEELLL--HHHH--LLLH


DSSP  HHHHHHHHHEEELL----------------------------------------------
Query ELYYCFAXTQIACL----------------------------------------------  139
ident           |                                                 
Sbjct STRGIMGKYVIRFSpytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnr  236
DSSP  HHHHHHLLLEEELLlllhhhhhhhhhhhhhhhlllllllhhhhhhhhhhhllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct gdarlaidilyrsayaaqqngrkhiapedvrksskevlfgiseevliglplheklfllai  296
DSSP  llhhhhhhhhhhhhhhhhhlllllllhhhhhhhhhhhlllllhhhhhhllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct vrslkishtpyitfgdaeesykivceeygerprvhsqlwsylndlrekgivetrqnttli  356
DSSP  hhhhhhhlllleehhhhhhhhhhhhhhlllllllhhhhhhhhhhhhhlllleeeelleee


DSSP  --------------------lll
Query --------------------plt  142
ident                        
Sbjct sigtepldtleavitklikeelr  379
DSSP  elllllhhhhhhhhhhhhhhhll


No 25: Query=mol1A Sbjct=3eccA Z-score=9.7

back to top
DSSP  ------------lllLHHHHHHHHHHHHHLL-----lLLLEEEELLLLLLHHHHHHHHHH
Query ------------igrSEWINQYRRRLQQLSE-----tDIAVWLYGAPGTGRXTGARYLHQ   43
ident                    |                        | || |    |     
Sbjct akrywnanldtyhpkNVSQNRALLTIRVFVHnfnpeeGKGLTFVGSPGVGKTHLAVATLK   60
DSSP  lllllllllllllllLHHHHHHHHHHHHHHHllllllLLEEEEEELLLLLHHHHHHHHHH


DSSP  LLL-lLLLLLEEEELLLlLLLLH------------HHHHHHHllLLEEEELHH-----hl
Query FGR-nAQGEFVYRELTPdNAPQL------------NDFIALAqgGTLVLSHPE-----hl   85
ident                       |                       |||           
Sbjct AIYekKGIRGYFFDTKD-LIFRLkhlmdegkdtkfLKTVLNS--PVLVLDDLGserlsdw  117
DSSP  HHHhhLLLLLEEEEHHH-HHHHHhhhhllllllhhHHHHHLL--LLEEEELLLlllllhh


DSSP  LHHHHHHHHHHHHLllLLLLEEEEELL--------LHHHHHHhlLLLHHHHHHHHH--HE
Query TREQQYHLVQLQSQehRPFRLIGIGDT--------SLVELAAsnHIIAELYYCFAX--TQ  135
ident  ||                  |                 ||                   
Sbjct QRELISYIITYRYN--NLKSTIITTNYslqrssvrISADLAS--RLGENVVSKIYEmnEL  173
DSSP  HHHHHHHHHHHHHH--LLLLEEEEEELlllllllhHHHHHHH--HHLHHHHHHHHHheEE


DSSP  EELLL--ll
Query IACLP--lt  142
ident          
Sbjct LVIKGsdlr  182
DSSP  EELLLllll


No 26: Query=mol1A Sbjct=2ce7D Z-score=9.7

back to top
DSSP  ----------llllhHHHHHHHHHHHHLLL--------------LLLEEEELLLLLLHHH
Query ----------igrseWINQYRRRLQQLSET--------------DIAVWLYGAPGTGRXT   36
ident                        |    |                    | | ||||   
Sbjct ykpsgnkrvtfkdvgGAEEAIEELKEVVEFlkdpskfnrigarmPKGILLVGPPGTGKTL   60
DSSP  llllllllllhhhllLLHHHHHHHHHHHHHhhlhhhhhhhllllLLEEEEELLLLLLHHH


DSSP  HHHHHHHLLLLlllLLEEEE--LLLL-----llLLHHHHHHHHL---LLLEEEELHHHL-
Query GARYLHQFGRNaqgEFVYRE--LTPD-----naPQLNDFIALAQ---GGTLVLSHPEHL-   85
ident  ||            |                     |  | |                 
Sbjct LARAVAGEANV---PFFHISgsDFVElfvgvgaARVRDLFAQAKahaPCIVFIDEIDAVg  117
DSSP  HHHHHHHHLLL---LEEEEEhhHLLLllllhhhHHHHHHHHHHHhhlLEEEEEELHHHLl


DSSP  ----LHHHHHHHHHHHHllLLLLLEEEEELLLhHHHHhhllllHHHHH--HHHHhEEELL
Query ----TREQQYHLVQLQSqeHRPFRLIGIGDTSlVELAasnhiiAELYY--CFAXtQIACL  139
ident     |  |                           |         |     |    |   
Sbjct ereqTLNQLLVEMDGFD-sKEGIIVMAATNRP-DILD------PALLRpgRFDK-KIVVD  168
DSSP  lhhhHHHHHHHHHHHLL-hHHLEEEEEEELLH-HHLL------HHHHLllLLLE-EEELL


DSSP  LLL---------------------------------------------------------
Query PLT---------------------------------------------------------  142
ident |                                                           
Sbjct PPDmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdki  228
DSSP  LLLhhhhhhhhhhllllllllllllhhhhhhllllllhhhhhhhhhhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct tmkdfeeaidrviaksllispaekriiayheaghavvstvvpngepvhrisiiprgyylv  288
DSSP  lhhhhhhhhhhhhlllllllhhhhhhhhhhhhhhhhhhhhlllllllleeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct srnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawg  348
DSSP  lhhhhhhhhhhhlhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct lrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleketiegdelrril  408
DSSP  lllllhhhhhhhhhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhhhhleeehhhhhhhh


DSSP  -----
Query -----  142
ident      
Sbjct seefe  413
DSSP  hhhhl


No 27: Query=mol1A Sbjct=1sxjD Z-score=9.7

back to top
DSSP  ----------llllHHHHHHHHHHHHHLL--LLLLEEEELLLLLLHHHHHHHHHHLLL--
Query ----------igrsEWINQYRRRLQQLSE--TDIAVWLYGAPGTGRXTGARYLHQFGR--   46
ident                        |              || ||||       |       
Sbjct pwvekyrpknldevTAQDHAVTVLKKTLKsaNLPHMLFYGPPGTGKTSTILALTKELYgp   60
DSSP  lhhhhlllllllllLLLLLLHHHHHHHLLllLLLLEEEELLLLLLHHHHHHHHHHHHHhh


DSSP  -lLLLLLEEEELLLlLLLL---hHHHHHHH------------------lLLLEEEELHhH
Query -nAQGEFVYRELTPdNAPQ---lNDFIALA------------------qGGTLVLSHPeH   84
ident                              |                        |     
Sbjct dlMKSRILELNASD-ERGIsivrEKVKNFArltvskpskhdlenypcppYKIIILDEAdS  119
DSSP  hhHLLLEEEELLLL-LLLHhhhlLHHHHHHhlllllllllhhhhlllllLEEEEELLHhH


DSSP  LLHHHHHHHHHHHHLLLLLLLEEEEELlLHHHhhhhllLLHHHHHHHhhHEEELLL----
Query LTREQQYHLVQLQSQEHRPFRLIGIGDtSLVElaasnhIIAELYYCFaxTQIACLP----  140
ident  |   |  |           |   |             ||  |                 
Sbjct MTADAQSALRRTMETYSGVTRFCLICN-YVTR------IIDPLASQC--SKFRFKAldas  170
DSSP  LLHHHHHHHHHHHHHLLLLEEEEEEEL-LHHH------LLHHHHHHL--EEEELLLllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct naidrlrfiseqenvkcddgvlerildisagdlrrgitllqsaskgaqylgdgknitstq  230
DSSP  hhhhhhhhhhhlllllllhhhhhhhhhhllllhhhhhhhhhhlhhhhhhhlllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct veelagvvphdilieivekvksgdfdeikkyvntfmksgwsaasvvnqlheyyitndnfd  290
DSSP  hhhhhlllllhhhhhhhhhhhlllhhhhhhhhhhhhhlllllllhhhhhhhhhhhlllll


DSSP  ------------------------------------ll
Query ------------------------------------lt  142
ident                                       
Sbjct tnfknqiswllfttdsrlnngtnehiqllnllvkisql  328
DSSP  hhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhl


No 28: Query=mol1A Sbjct=1qvrA Z-score=9.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct erwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkalkel   60
DSSP  llllhhhhhhhhhhhhhhhhlllleelhhhhhhhhllllllhhhhhhhlllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatpglp  120
DSSP  hhhhhhllllllhhhllleelhhhhhhhhhhhhhhhllllllllhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct glealkgalkelrggrtvqtehaestynaleqygidltrlaaegkldpvigrdeeirrvi  180
DSSP  lhhhhhhhhlllllllllllllllllllhhhhheeehhhhhhllllllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qillrrtknnpvligepgvgktaiveglaqrivkgdvpeglkgkrivslqmefeerlkav  240
DSSP  hhhhllllllleeeelllllhhhhhhhhhhhhhhlllllllllleeeeelllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct iqevvqsqgevilfidelkpalargelrligattldeyreiekdpalerrfqpvyvdept  300
DSSP  hhhhhllllleeeeelllhhhhhllllleeeeelhhhhhhhlllllllllllleeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct veetisilrglkekyevhhgvrisdsaiiaaatlshryiterrlpdkaidlideaaarlr  360
DSSP  hhhhhhhhhhhhhhhhhhllleelhhhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct malesapeeidalerkklqleierealkkekdpdsqerlkaieaeiaklteeiaklraew  420
DSSP  hllllhhhhhhhhhhhhhhhhhhhhhhlllllhhhhlllhhhhhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct erereilrklreaqhrldevrreielaerqydlnraaelrygelpkleaevealseklrg  480
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhllhhhhhhhhhhhhhhhlll


DSSP  ----------------------------------------llllhhhHHHHHHHHHHLLL
Query ----------------------------------------igrsewiNQYRRRLQQLSET   20
ident                                                             
Sbjct arfvrlevteediaeivsrwtgipvskllegerekllrleeelhkrvVGQDEAIRAVADA  540
DSSP  lllllleelhhhhhhhhhlllllhhhhllllhhhhhhlhhhhhhhhlLLLHHHHHHHHHH


DSSP  --------------LLLEEEELLLLLLHHHHHHHHHHLlLLLL-LLLEEEEL--LLLLLL
Query --------------DIAVWLYGAPGTGRXTGARYLHQFgRNAQ-GEFVYREL--TPDNAP   63
ident                      |  | |    |  |                         
Sbjct irraraglkdpnrpIGSFLFLGPTGVGKTELAKTLAAT-LFDTeEAMIRIDMteYMEKHA  599
DSSP  hhhhhhhlllllllLEEEEELLLLLLLHHHHHHHHHHH-HHLLhHHEEEELLllLLLLHH


DSSP  -LHHHHHHHH---LLLLEEEELHHHLLHHHHHHHHHHHHL-----------llLLLLEEE
Query -QLNDFIALA---QGGTLVLSHPEHLTREQQYHLVQLQSQ-----------ehRPFRLIG  108
ident                        |         | |                 |    | 
Sbjct vSRLQLTEAVrrrPYSVILFDEIEKAHPDVFNILLQILDDgrltdshgrtvdfRNTVIIL  659
DSSP  hHHLLHHHHHhhlLLEEEEELLHHHLLHHHHHHHHHHHLLleellllllleelLLEEEEE


DSSP  EELLL--------------------hHHHHHHlLLLHHHHHHHhHHEEELLLLL------
Query IGDTS--------------------lVELAASnHIIAELYYCFaXTQIACLPLT------  142
ident                                  |   |             |||      
Sbjct TSNLGsplileglqkgwpyerirdevFKVLQQ-HFRPEFLNRL-DEIVVFRPLTkeqirq  717
DSSP  ELLLLhhhhhhhhhllllhhhhhhhhHHHHHL-LLLHHHHHLL-LLLLLLLLLLhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct iveiqlsylrarlaekrislelteaakdflaergydpvfgarplrrviqreletplaqki  777
DSSP  hhhhhhhhhhhhhhlllleeeelhhhhhhhhhhhlllllllllhhhhhhhhlhhhhhhhh


DSSP  --------------------------
Query --------------------------  142
ident                           
Sbjct lagevkegdrvqvdvgpaglvfavpa  803
DSSP  hhllllllleeeeelllllleeelll


No 29: Query=mol1A Sbjct=1nsfA Z-score=9.6

back to top
DSSP  -------------------llLLHHHHHHHHHHHHHLLLL--------LLEEEELLLLLL
Query -------------------igRSEWINQYRRRLQQLSETD--------IAVWLYGAPGTG   33
ident                                    |              | | | |  |
Sbjct kpafgtnqedyasyimngiikWGDPVTRVLDDGELLVQQTknsdrtplVSVLLEGPPHSG   60
DSSP  lllllllllllllllllllllLLHHHHHHHHHHHHHHHHHhhllllleEEEEEELLLLLL


DSSP  HHHHHHHHHHLLLLllLLLEEEELL------LLLL-LLHHHHHHHHL---LLLEEEE---
Query RXTGARYLHQFGRNaqGEFVYRELT------PDNA-PQLNDFIALAQ---GGTLVLS---   80
ident     |                                        |        |     
Sbjct KTALAAKIAEESNF--PFIKICSPDkmigfsETAKcQAMKKIFDDAYksqLSCVVVDdie  118
DSSP  HHHHHHHHHHHHLL--LEEEEELHHhlllllHHHHhHHHHHHHHHHHlllEEEEEELlhh


DSSP  LHHH----------lLHHHHHHHHHHH-hLLLLlLLEEEEELLLhHHHHHhllllHHHHH
Query HPEH----------lTREQQYHLVQLQ-sQEHRpFRLIGIGDTSlVELAAsnhiiAELYY  129
ident                       |      |       ||        |        |   
Sbjct RLLDyvpigprfsnlVLQALLVLLKKAppQGRK-LLIIGTTSRK-DVLQE-----MEMLN  171
DSSP  HHLLlllllllllhhHHHHHHHHLLLLllLLLE-EEEEEEELLH-HHHHH-----LLHHH


DSSP  HHhHHEEELLL-------------------------------------------------
Query CFaXTQIACLP-------------------------------------------------  140
ident  |  | |                                                     
Sbjct AF-STTIHVPNiatgeqllealellgnfkdkerttiaqqvkgkkvwigikkllmliemsl  230
DSSP  LL-LEEEELLLeeehhhhhhhhhhhllllhhhhhhhhhhhllleeeelhhhhhhhhhhhl


DSSP  ---------------ll
Query ---------------lt  142
ident                  
Sbjct qmdpeyrvrkflallre  247
DSSP  lllhhhhhhhhhhhhhl


No 30: Query=mol1A Sbjct=1sxjC Z-score=9.6

back to top
DSSP  ------------llllhHHHHHHHHHHHHL--LLLLLEEEELLLLLLHHHHHHHHHHLLL
Query ------------igrseWINQYRRRLQQLS--ETDIAVWLYGAPGTGRXTGARYLHQFGR   46
ident                    |                    || ||||       |     
Sbjct nlpwvekyrpetldevyGQNEVITTVRKFVdeGKLPHLLFYGPPGTGKTSTIVALAREIY   60
DSSP  lllhhhhlllllhhhllLLHHHHHHHHHHHhlLLLLLEEEELLLLLLHHHHHHHHHHHHH


DSSP  --lLLLLLEEEELLLL-LLLLH-HHHHHHH--------lLLLEEEELH--HHLL--HHHH
Query --nAQGEFVYRELTPD-NAPQL-NDFIALA--------qGGTLVLSHP--EHLT--REQQ   90
ident                |       |     |              |               
Sbjct gknYSNMVLELNASDDrGIDVVrNQIKDFAstrqifskgFKLIILDEAdaMTNAaqNALR  120
DSSP  lllHHHHEEEELLLLLlLHHHHhLHHHHHHhllllllllLEEEEELLHhhLLHHhhHHHH


DSSP  HHHHHHHhlllLLLLEEEEELLlhHHHHhhlllLHHHHHHHhhHEEELL-----------
Query YHLVQLQsqehRPFRLIGIGDTslVELAasnhiIAELYYCFaxTQIACL-----------  139
ident               |                     |      |                
Sbjct RVIERYT----KNTRFCVLANY--AHKL-----TPALLSQC--TRFRFQplpqeaierri  167
DSSP  HHHHHLL----LLEEEEEEELL--HHHL-----LHHHHLLL--EEEELLlllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct anvlvheklklspnaekalielsngdmrrvlnvlqsckatldnpdedeisddviyeccga  227
DSSP  hhhhhlllllllhhhhhhhhhhhlllhhhhhhhlllllllllllllllllhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct prpsdlkavlksileddwgtahytlnkvrsakglalidliegivkiledyelqneetrvh  287
DSSP  llhhhhhhhhhhhhlllhhhhhhhhhhhhhlllllhhhhhhhhhhhhlllllllhhhhhh


DSSP  --------------------------------lll
Query --------------------------------plt  142
ident                                    
Sbjct lltkladieysiskggndqiqgsavigaikasfen  322
DSSP  hhhhhhhhhhhhlllllhhhhhhhhhhhhhhhlll


No 31: Query=mol1A Sbjct=3d8bA Z-score=9.4

back to top
DSSP  --------------------------llllhHHHHHHHHHHH-HLLL-------------
Query --------------------------igrseWINQYRRRLQQ-LSET-------------   20
ident                                                             
Sbjct erlknlepkmielimneimdhgppvnwediaGVEFAKATIKEiVVWPmlrpdiftglrgp   60
DSSP  lllllllhhhhhhhhhhlllllllllhhhllLLHHHHHHHHHhLHHHhhllllllhhhll


DSSP  LLLEEEELLLLLLHHHHHHHHHHLLLLlllLLEEEELLllLLLL---------HHHHHHH
Query DIAVWLYGAPGTGRXTGARYLHQFGRNaqgEFVYRELTpdNAPQ---------LNDFIAL   71
ident      | | ||||                  |                          | 
Sbjct PKGILLFGPPGTGKTLIGKCIASQSGA---TFFSISAS--SLTSkwvgegekmVRALFAV  115
DSSP  LLEEEEELLLLLLHHHHHHHHHHHLLL---EEEEEEHH--HHLLllllhhhhhHHHHHHH


DSSP  HL---LLLEEEELHHH--------lLHHHHHHHHHHhhlLLLLLLEEEEELLLhHHHHhh
Query AQ---GGTLVLSHPEH--------lTREQQYHLVQLqsqEHRPFRLIGIGDTSlVELAas  120
ident |                                              |       |    
Sbjct ARcqqPAVIFIDEIDSllsqessrrIKTEFLVQLDG---SEDRILVVGATNRP-QEID--  169
DSSP  HHhllLEEEEEELHHHhllllhhhhHHHHHHHHHHL---LLLLEEEEEEELLH-HHLL--


DSSP  llllHHHHHHHHhHEEELLLLL--------------------------------------
Query nhiiAELYYCFAxTQIACLPLT--------------------------------------  142
ident                                                             
Sbjct ----EAARRRLV-KRLYIPLPEasarkqivinlmskeqcclseeeieqivqqsdafsgad  224
DSSP  ----HHHHLLLL-EEEELLLLLhhhhhhhhhhhhhlllllllhhhhhhhhhhlllllhhh


DSSP  ---------------------------------------------------------
Query ---------------------------------------------------------  142
ident                                                          
Sbjct mtqlcreaslgpirslqtvrpiayidfenafrtvrpsvspkdlelyenwnktfgcgk  281
DSSP  hhhhhhhhhlhhhhhllllllllhhhhhhhhhhhhhhlllllhhhhhhhhhhhllll


No 32: Query=mol1A Sbjct=2dhrA Z-score=9.4

back to top
DSSP  ------------llllhHHHHHHHHHHHHLL--------------LLLLEEEELLLLLLH
Query ------------igrseWINQYRRRLQQLSE--------------TDIAVWLYGAPGTGR   34
ident                          |    |                  | | | || | 
Sbjct rarvlteapkvtfkdvaGAEEAKEELKEIVEflknpsrfhemgarIPKGVLLVGPPGVGK   60
DSSP  lleeellllllllllllLLHHHHHHHHHHHHhhhlhhhlllllllLLLEEEEELLLLLLH


DSSP  HHHHHHHHHLLLLlllLLEEEELLllLLLL---------HHHHHHHHL---LLLEEEELH
Query XTGARYLHQFGRNaqgEFVYRELTpdNAPQ---------LNDFIALAQ---GGTLVLSHP   82
ident    ||      |     |                       |    |             
Sbjct THLARAVAGEARV---PFITASGS--DFVEmfvgvgaarVRDLFETAKrhaPCIVFIDEI  115
DSSP  HHHHHHHHHHLLL---LEEEEEHH--HHLLllllhhhhhHHHHLLLLLlllLLEEEEELH


DSSP  HHL--------------LHHHHHHHHHHHH--LLLLLLLEEEEELLlhHHHHhhlllLHH
Query EHL--------------TREQQYHLVQLQS--QEHRPFRLIGIGDTslVELAasnhiIAE  126
ident                         |                                   
Sbjct DAVgrkrgsgvgggndeREQTLNQLLVEMDgfEKDTAIVVMAATNR--PDIL-----DPA  168
DSSP  HHLllllllllllllhhHHHHHHHHHHHHHhlLLLLLLEEEELLLL--HHHL-----LLL


DSSP  HHH--HHHHhEEELLLLL------------------------------------------
Query LYY--CFAXtQIACLPLT------------------------------------------  142
ident |     |   |||                                               
Sbjct LLRpgRFDR-QIAIDAPDvkgreqilrihargkplaedvdlallakrtpgfvgadlenll  227
DSSP  LLLllLLLL-EEELLLLLhhhhhhhhhhlllllllllllllhhhhlllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct neaallaaregrrkitmkdleeaadrvmmlpakkslvlsprdrritayheaghalaahfl  287
DSSP  hhhhhhhllllllllllhhhhhhhhhhllllllllllllllhhhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct ehadgvhkvtivprgralgfmmprredmlhwsrkrlldqiavalagraaeeivfddvttg  347
DSSP  lllllllleelllllllllllhhhhlllllllhhhhhhhhhhhhhhhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct aendfrqatelarrmitewgmhpefgpvayavredtylggydvrqyseetakrideavrr  407
DSSP  llhhhhhhhhhhhhhhlllllllllllllllllllllllllllllllhhhhhhhhhhhhh


DSSP  ---------------------------------------------------
Query ---------------------------------------------------  142
ident                                                    
Sbjct lieeqyqrvkalllekrevlervaetlleretltaeefqrvveglpleape  458
DSSP  hhhhhhhhhhhhhhhlhhhhhhhhhhhhhhleelhhhhhhhhlllllllll


No 33: Query=mol1A Sbjct=1xwiA Z-score=9.3

back to top
DSSP  ----------llllhHHHHHHHHHHHHLL--------------lLLLEEEELLLLLLHHH
Query ----------igrseWINQYRRRLQQLSE--------------tDIAVWLYGAPGTGRXT   36
ident                        |                         | | ||||   
Sbjct aivierpnvkwsdvaGLEGAKEALKEAVIlpikfphlftgkrtpWRGILLFGPPGTGKSY   60
DSSP  lleeelllllhhhllLLHHHHHHHHHHHHhhhhlhhhlllllllLLEEEEELLLLLLHHH


DSSP  HHHHHHHLLLLLllLLEEEELL-------lLLLLLHHHHHHHHL---LLLEEEE-LHHH-
Query GARYLHQFGRNAqgEFVYRELT-------pDNAPQLNDFIALAQ---GGTLVLS-HPEH-   84
ident  |        |    |                         ||                 
Sbjct LAKAVATEANNS--TFFSISSSdlvskwlgESEKLVKNLFQLARenkPSIIFIDeIDSLc  118
DSSP  HHHHHHHHLLLL--EEEEEELLllllllllLLHHHHHHHHHHHHhllLEEEEEElLLHHh


DSSP  ------------lLHHHHHHHHHHhhLLLLLLLEEEEELLLhHHHHhhllllHHHHHHHh
Query ------------lTREQQYHLVQLqsQEHRPFRLIGIGDTSlVELAasnhiiAELYYCFa  132
ident                       |            |        |             | 
Sbjct gsrseneseaarrIKTEFLVQMQGvgVDNDGILVLGATNIP-WVLD------SAIRRRF-  170
DSSP  lllllllllhhhhHHHHHHHHHHLllLLLLLEEEEEEELLL-LLLL------HHHHHLL-


DSSP  HHEEELLLLL--------------------------------------------------
Query XTQIACLPLT--------------------------------------------------  142
ident    |                                                        
Sbjct EKRIYIPLPEpharaamfklhlgttqnslteadfrelgrktdgysgadisiivrdalmqp  230
DSSP  LEEEELLLLLhhhhhhhhhhhhllllllllhhhhhhhhhllllllhhhhhhhhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct vrkvqsathfkkvrgpsradpnhlvddlltpcspgdpgaiemtwmdvpgdkllepvvsms  290
DSSP  hhhhhhlleeeeeeeellllllleeeeeeeellllllleeellhhhllhhhlllllllhh


DSSP  --------------------------------
Query --------------------------------  142
ident                                 
Sbjct dmlrslsntkptvnehdllklkkftedfgqeg  322
DSSP  hhhhhhhlllllllhhhhhhhhhhhhllllll


No 34: Query=mol1A Sbjct=3b9pA Z-score=9.3

back to top
DSSP  ------------------llllhHHHHHHHHHHH-HLLL-------------LLLEEEEL
Query ------------------igrseWINQYRRRLQQ-LSET-------------DIAVWLYG   28
ident                                ||                        | |
Sbjct klvqlildeiveggakvewtdiaGQDVAKQALQEmVILPsvrpelftglrapAKGLLLFG   60
DSSP  lhhhhhhlllllllllllhhhllLLHHHHHHHHHhLHHHhhlhhhllhhhllLLEEEEEL


DSSP  LLLLLHHHHHHHHHHLLLLlllLLEEEEL--LLLL-----lLLHHHHHHHHL---LLLEE
Query APGTGRXTGARYLHQFGRNaqgEFVYREL--TPDN-----aPQLNDFIALAQ---GGTLV   78
ident  || |    ||            |                        | |         
Sbjct PPGNGKTLLARAVATECSA---TFLNISAasLTSKyvgdgeKLVRALFAVARhmqPSIIF  117
DSSP  LLLLLHHHHHHHHHHHLLL---EEEEEELllLLLLllllhhHHHHHHHHHHHhllLEEEE


DSSP  EE-LHHH---------LLHHHHHHHHHHHhllllLLLEEEEELLLhHHHHhhllllHHHH
Query LS-HPEH---------LTREQQYHLVQLQsqehrPFRLIGIGDTSlVELAasnhiiAELY  128
ident                 |  |       |                   ||           
Sbjct IDeVDSLlsereasrrLKTEFLVEFDGLP-----RIVVLAATNRP-QELD------EAAL  165
DSSP  EElHHHLlllllllhhHHHHHHHHHHHLL-----LEEEEEEELLH-HHLL------HHHH


DSSP  HHHHhHEEELLLLL----------------------------------------------
Query YCFAxTQIACLPLT----------------------------------------------  142
ident   |                                                         
Sbjct RRFT-KRVYVSLPDeqtrelllnrllqkqgspldtealrrlakitdgysgsdltalakda  224
DSSP  HHLL-EEEELLLLLhhhhhhhhhhhhhhhlllllhhhhhhhhhhlllllhhhhhhhhhhh


DSSP  --------------------------------------------
Query --------------------------------------------  142
ident                                             
Sbjct alepirelnisamraiteqdfhsslkrirrsvapqslnsyekws  268
DSSP  llhhhhlllllllllllhhhhhhhlllllllllhhhhhhhhhhl


No 35: Query=mol1A Sbjct=2qbyB Z-score=9.3

back to top
DSSP  ------------llllHHHHHHHHHHHHHLL------LLLLEEEELLLLLLHHHHHHHHH
Query ------------igrsEWINQYRRRLQQLSE------TDIAVWLYGAPGTGRXTGARYLH   42
ident                        |                     |  |||      |  
Sbjct knpkvfidplsvfkeiPFREDILRDAAIAIRyfvkneVKFSNLFLGLTGTGKTFVSKYIF   60
DSSP  llllllllhhhhllllLLLHHHHHHHHHHHHhhhlllLLLEEEEEELLLLLHHHHHHHHH


DSSP  HLL--------lllLLLLEEEEL-LLLLL-LLHHHHHHHHL-------------------
Query QFG--------rnaQGEFVYREL-TPDNA-PQLNDFIALAQ-------------------   73
ident                    |                 |                      
Sbjct NEIeevkkedeeykDVKQAYVNCrEVGGTpQAVLSSLAGKLtgfsvpkhginlgeyidki  120
DSSP  HHHhhhhhhlllllLLEEEEEEHhHHLLLhHHHHHHHHHHHhlllllllllllhhhhhhh


DSSP  -------LLLEEEELHHHL--LHHHHHHHHHHHHLLLLlLLEEEEELLLhhHHHHhlLLL
Query -------GGTLVLSHPEHL--TREQQYHLVQLQSQEHRpFRLIGIGDTSlvELAAsnHII  124
ident             |     |   |     | ||          | |               
Sbjct kngtrniRAIIYLDEVDTLvkRRGGDIVLYQLLRSDAN-ISVIMISNDI--NVRD--YME  175
DSSP  hhhhlllLEEEEEELLHHHhhLLLLHHHHHHHHLLLLL-EEEEEELLLL--LLLL--LLL


DSSP  HHHHHHHhHHEEELLL--------------------------------------------
Query AELYYCFaXTQIACLP--------------------------------------------  140
ident                |                                            
Sbjct PRVLSSL-GPSVIFKPydaeqlkfilskyaeyglikgtyddeilsyiaaisakehgdark  234
DSSP  HHHHHLL-LLEEEELLllhhhhhhhhhhhhhhlllllllllhhhhhhhhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct avnllfraaqlasgggiirkehvdkaivdyeqerlieavkalpfhyklalrsliesedvm  294
DSSP  hhhhhhhhhhhllllllllhhhhhhhhhhhhhhhhhhhhhlllhhhhhhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct sahkmytdlcnkfkqkplsyrrfsdiiseldmfgivkiriinrgraggvkkyalvedkek  354
DSSP  hhhhhhhhhhhhlllllllhhhhhhhhhhhhhllleeeeeelllllllleeeeeelllhh


DSSP  ------------ll
Query ------------lt  142
ident               
Sbjct vlralnetfedsis  368
DSSP  hhhhhhhhhhhlll


No 36: Query=mol1A Sbjct=2r65A Z-score=9.3

back to top
DSSP  ---------llllhHHHHHHHHHHHHLLL--------------LLLEEEELLLLLLHHHH
Query ---------igrseWINQYRRRLQQLSET--------------DIAVWLYGAPGTGRXTG   37
ident                                               | | | ||||    
Sbjct inaekpnvrfkdmaGNEEAKEEVVEIVDFlkyperyanlgakiPKGVLLVGPPGTGKTLL   60
DSSP  lllllllllhhhllLLHHHHHLLHHHHHHhhllhhhhllllllLLLEEEELLLLLLHHHH


DSSP  HHHHHHLLLLlllLLEEEE-LLLL------LLLLHHHHHHHHL---LLLEEEE-LHHH--
Query ARYLHQFGRNaqgEFVYRE-LTPD------NAPQLNDFIALAQ---GGTLVLS-HPEH--   84
ident |             |                |    |    |                  
Sbjct AKAVAGEAHV---PFFSMGgSSFIemfvglGASRVRDLFETAKkqaPSIIFIDeIDAIgk  117
DSSP  HHHHHHHHLL---LEEEELlHHHHllllllLLLLHHHHHHHHHhllLEEEEELlHHHLll


DSSP  ------LLHHHHHHHHHHhhLLLLlLLEEEEELLLhHHHHhhllllHHHHH--HHHHhEE
Query ------LTREQQYHLVQLqsQEHRpFRLIGIGDTSlVELAasnhiiAELYY--CFAXtQI  136
ident                                       |         |     |   | 
Sbjct ndereqTLNQLLAEMDGFgsENAP-VIVLAATNRP-EILD------PALMRpgRFDR-QV  168
DSSP  llllllLLLLHHHHLLLLllLLLL-EEEEEEELLL-LLLL------HHHHLllLLLE-EE


DSSP  ELLLLL------------------------------------------------------
Query ACLPLT------------------------------------------------------  142
ident                                                             
Sbjct LVDKPDfngrveilkvhikgvklandvnlqevakltaglagadlaniineaallagrnnq  228
DSSP  ELLLLLhhhhhhhhhhhhllllllllllhhhhhhhllllllhhhhhhhhhhhhhhhhhll


DSSP  ---------------------
Query ---------------------  142
ident                      
Sbjct kevrqqhlkeavergiaglek  249
DSSP  llllhhhhhhlllllllllll


No 37: Query=mol1A Sbjct=3co5A Z-score=9.3

back to top
DSSP  llLLHHHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHllllLLLLLEEEELLLl
Query igRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRXTGARYLHQfgrnAQGEFVYRELTPd   60
ident    |  |    |           | | |  |    | ||| |          |       
Sbjct -gNSAAIQEXNREVEAAAKRTSPVFLTGEAGSPFETVARYFHK----NGTPWVSPARVEy   55
DSSP  -lLLHHHHHHHHHHHHHHLLLLLEEEEEELLLLHHHHHHHHLL----LLLLEELLLLLLh


DSSP  lLLLHHHHHHHHLLLLEEEELH--HHLL-HHHHHHHHHHHhllLLLLLEEEEELL--lhh
Query nAPQLNDFIALAQGGTLVLSHP--EHLT-REQQYHLVQLQsqeHRPFRLIGIGDT--slv  115
ident            | || |                              | |          
Sbjct lIDXPXELLQKAEGGVLYVGDIaqYSRNiQTGITFIIGKA--eRCRVRVIASCSYaagsd  113
DSSP  hHHLHHHHHHHLLLLEEEEEELllLLHHhHHHHHHHHHHH--lLLLLEEEEEEEElllll


DSSP  HHHHhllllHHHHHHhhhheeelllll
Query ELAAsnhiiAELYYCfaxtqiaclplt  142
ident          | |               
Sbjct SCEE---klAGLFSE---svvrippls  134
DSSP  LHHH---hhHHHLLL---eeeeellll


No 38: Query=mol1A Sbjct=1um8A Z-score=9.2

back to top
DSSP  ---------------llllhHHHHHHHHHHHHLLLL------------------------
Query ---------------igrseWINQYRRRLQQLSETD------------------------   21
ident                        |                                    
Sbjct llsyipapkelkavldnyviGQEQAKKVFSVAVYNHykrlsfkeklkkqdnqdsnveleh   60
DSSP  lllllllhhhhhhhhhllllLLHHHHHHHHHHHHHHhhhhhhhhhhhhhllhhhhhhhhh


DSSP  --------LLEEEELLLLLLHHHHHHHHHHLlllLLLLLEEEELLllLLLLhHHHHHHH-
Query --------IAVWLYGAPGTGRXTGARYLHQFgrnAQGEFVYRELTpdNAPQlNDFIALA-   72
ident             | |  | |    |  |                |               
Sbjct leevelskSNILLIGPTGSGKTLMAQTLAKH---LDIPIAISDAT--SLTV-ENILTRLl  114
DSSP  hhhlllllLLEEEELLLLLLHHHHHHHHHHH---LLLLEEEEEHH--HLLL-LHHHHHHh


DSSP  ----------LLLLEEEELHHHLLHHHHHHHHHH-HHLL-----lLLLLEEEEELL----
Query ----------QGGTLVLSHPEHLTREQQYHLVQL-QSQE-----hRPFRLIGIGDT----  112
ident           | |              |  |                   |  |      
Sbjct qasdwnvqkaQKGIVFIDEIDKIGEGVQQALLKIvEGSLvnqidtSDILFICAGAFdgla  174
DSSP  hhllllhhhhLLLEEEEELHHHLLHHHHHHHHHHhHLLEelleelLLLEEEEEELLllhh


DSSP  ------------------------------lhHHHHHHLLLLHHHHHHHhHHEEELLL--
Query ------------------------------slVELAASNHIIAELYYCFaXTQIACLP--  140
ident                                          | ||               
Sbjct eiikkrttqnvlgftqekmskkeqeailhlvqTHDLVTYGLIPELIGRL-PVLSTLDSis  233
DSSP  hhlllllllllllllllllllllllllhhhllHHHHHHLLLLHHHHLLL-LEEEELLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct leamvdilqkpknalikqyqqlfkmdevdlifeeeaikeiaqlalerktgarglraiied  293
DSSP  hhhhhhhhhlllllhhhhhhhhhhlllleeeelhhhhhhhhhhhhhllllhhhhhhhhhh


DSSP  --------------------------------ll
Query --------------------------------lt  142
ident                                   
Sbjct fcldimfdlpklkgsevritkdcvlkqaepliia  327
DSSP  hhhhhhhlhhhhllleeeelhhhhlllllleeel


No 39: Query=mol1A Sbjct=2v1uA Z-score=9.2

back to top
DSSP  --------------llllhhhHHHHHHHHHHLLL---------LLLEEEELLLLLLHHHH
Query --------------igrsewiNQYRRRLQQLSET---------DIAVWLYGAPGTGRXTG   37
ident                            |  | |               |||  |||    
Sbjct leskifrkrwvllpdyvpdvlPHREAELRRLAEVlapalrgekPSNALLYGLTGTGKTAV   60
DSSP  llllllllhhhhlllllllllLLLHHHHHHHHHLlhhhlllllLLLEEELLLLLLLHHHH


DSSP  HHHHHHLLL------llLLLLEEEEL-LLLLLLL-HHHHHHH------------------
Query ARYLHQFGR------naQGEFVYREL-TPDNAPQ-LNDFIAL------------------   71
ident ||                    |                                     
Sbjct ARLVLRRLEarasslgvLVKPIYVNArHRETPYRvASAIAEAvgvrvpftglsvgevyer  120
DSSP  HHHHHHHHHhhhhhhllLEEEEEEELlLLLLHHHhHHHHHHHhllllllllllhhhhhhh


DSSP  --------hlLLLEEEELHHHL-----LHHHHHHHHHHHHLLlllLLEEEEELLLhhHHH
Query --------aqGGTLVLSHPEHL-----TREQQYHLVQLQSQEhrpFRLIGIGDTSlvELA  118
ident               ||     |          |              | ||         
Sbjct lvkrlsrlrgIYIIVLDEIDFLpkrpgGQDLLYRITRINQEL---VSLVGITNSL--GFV  175
DSSP  hhhhhlllllEEEEEEELLLHHhhlllHHHHHHHHHHHHHLL---LEEEEELLLL--LLL


DSSP  HhlLLLHHHHHHHHHHEEELLLLL------------------------------------
Query AsnHIIAELYYCFAXTQIACLPLT------------------------------------  142
ident                      | |                                    
Sbjct E--NLEPRVKSSLGEVELVFPPYTapqlrdiletraeeafnpgvldpdvvplcaalaare  233
DSSP  L--LLLHHHHLLLLLEELLLLLLLhhhhhhhhhhhhhhhlllllllllhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct hgdarraldllrvageiaerrreervrrehvysaraeierdrvsevvrtlplhaklvlls  293
DSSP  lllhhhhhhhhhhhhhhhhhlllllllhhhhhhhhhhhhhhhhhhhhhlllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct immledggrpastgeiyerykeltstlglehvtlrrvsgiiseldmlgivksrvvsrgry  353
DSSP  hhhhlllllleehhhhhhhhhhhhhhlllllllhhhhhhhhhhhhhllleeeeeeelhhh


DSSP  -----------------------------
Query -----------------------------  142
ident                              
Sbjct gktrevsldadrlavenalsedpfvarll  382
DSSP  leeeeeeelllhhhhhhhhhhlllhhhhl


No 40: Query=mol1A Sbjct=1ofhA Z-score=9.1

back to top
DSSP  -----------llllhhHHHH-HHHHHHHLLL----------------LLLEEEELLLLL
Query -----------igrsewINQY-RRRLQQLSET----------------DIAVWLYGAPGT   32
ident                        |                               |  | 
Sbjct semtpreivseldqhiiGQADaKRAVAIALRNrwrrmqlqeplrhevtPKNILMIGPTGV   60
DSSP  llllhhhhhhhhhllllLLHHhHHHHHHHHHHhhhlllllhhhhhhllLLLEEEELLLLL


DSSP  LHHHHHHHHHHLlllLLLLLEEEELLL-----lllLLHHHHHHHHL------------LL
Query GRXTGARYLHQFgrnAQGEFVYRELTP-----dnaPQLNDFIALAQ------------GG   75
ident |    || |      |   |   | |               |                 |
Sbjct GKTEIARRLAKL---ANAPFIKVEATKftevgyvgKEVDSIIRDLTdsaggaidaveqNG  117
DSSP  LHHHHHHHHHHH---HLLLEEEEEHHHhlllllhhHLLLHHHHHHHhlllllhhhhhhHL


DSSP  LEEEELHHHL------------LHHHHHHHHHHHHLL----------LLLLLEEEEELLl
Query TLVLSHPEHL------------TREQQYHLVQLQSQE----------HRPFRLIGIGDTs  113
ident                           |  |  |                    |  |   
Sbjct IVFIDEIDKIckkgeysgadvsREGVQRDLLPLVEGStvstkhgmvkTDHILFIASGAFq  177
DSSP  EEEEELHHHHlllllllllhhhHHHHHHHHHHHHHLLeeeelleeeeLLLLEEEEEELLl


DSSP  hHHHHhhlLLLHHHHHHHhHHEEELL----------------------------------
Query lVELAasnHIIAELYYCFaXTQIACL----------------------------------  139
ident           | ||                                              
Sbjct vARPS---DLIPELQGRL-PIRVELTalsaadferiltephaslteqykalmategvnia  233
DSSP  lLLHH---HLLHHHHHLL-LEEEELLlllhhhhhhhhhlllllhhhhhhhhhhhllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct fttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvad  293
DSSP  elhhhhhhhhhhhhhhhhhllllllhhhhhhhhhhlhhhhhhhhhlllleeeelhhhhhh


DSSP  -------------lll
Query -------------plt  142
ident                 
Sbjct algevvenedlsrfil  309
DSSP  hlllllllllllllll


No 41: Query=mol1A Sbjct=1ksfX Z-score=9.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea   60
DSSP  lllhhhhhhhhhhhhhhlllllleelhhhhhhhhlllhhhhhhhhhllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa  120
DSSP  hhhhhllllllllllllleelhhhhhhhhhhhhhhhhhllllllhhhhhhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ayllrkhevsrldvvnfishgtrlenfttnlnqlarvggidpligrekeleraiqvlcrr  180
DSSP  hhhhhhllllhhhhhhhhhlllllllllllhhhhhhllllllllllhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct rknnpllvgesgvgktaiaeglawrivqgdvpevmadctiysldigagtkyrgdfekrfk  240
DSSP  llleeeeellllllhhhhhhhhhhhhhllllllllllleeeellllllllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct allkqleqdtnsilfideihtiigagaasggqvdaanlikpllssgkirvigsttyqefs  300
DSSP  hhhhhlllllleeeeelllllllllllllllhhhhhlllllllllllleeeeeelhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nifekdralarrfqkiditepsieetvqiinglkpkyeahhdvrytakavraavelavky  360
DSSP  hhhhhllllhhheeeeelllllhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct indrhlpdkaidvideagararlmpvskrkktvnvadiesvvariaripeksvsqsdrdt  420
DSSP  lllllhhhhhhhhhhhhhhhhhllllllllllllhhhhhhhhhhhhlllllllllhhhhh


DSSP  --------llllhHHHHHHHHHHHHLL-----------lLLLEEEELLLLLLHHHHHHHH
Query --------igrseWINQYRRRLQQLSE-----------tDIAVWLYGAPGTGRXTGARYL   41
ident                      |                        |  | |       |
Sbjct lknlgdrlkmlvfGQDKAIEALTEAIKmaraglghehkpVGSFLFAGPTGVGKTEVTVQL  480
DSSP  hhhhhhhhlllllLLHHHHHHHHHHHHhhhlllllllllLEEEEEELLLLLLHHHHHHHH


DSSP  HHLlllLLLLLEEEELLL---------------lLLLLHH--HHHHHH---LLLLEEEEL
Query HQFgrnAQGEFVYRELTP---------------dNAPQLN--DFIALA---QGGTLVLSH   81
ident          |                                             | |  
Sbjct SKA---LGIELLRFDMSEymerhtvsrligappgYVGFDQggLLTDAVikhPHAVLLLDE  537
DSSP  HHH---HLLEEEEEEHHHllllllllllllllllLHHHHLllHHHHHHhhlLLEEEEEEL


DSSP  HHHLLHHHHHHHHHHHHLL-----------lLLLLEEEEELLL-------hhHHHHhlLL
Query PEHLTREQQYHLVQLQSQE-----------hRPFRLIGIGDTS-------lvELAAsnHI  123
ident  |         | |                 |   |                |       
Sbjct IEKAHPDVFNILLQVMDNGtltdnngrkadfRNVVLVMTTNAGvrnstdameEIKK--IF  595
DSSP  HHHLLHHHHHHHHHHHHHLeellllllleelLLEEEEEEELLLllllllllhHHHH--HL


DSSP  LHHHHHHHhHHEEELLLLL-----------------------------------------
Query IAELYYCFaXTQIACLPLT-----------------------------------------  142
ident   |         |    |                                          
Sbjct TPEFRNRL-DNIIWFDHLStdvihqvvdkfivelqvqldqkgvslevsqearnwlaekgy  654
DSSP  LHHHHLLL-LEEEELLLLLhhhhhhhhhhhhhhhhhhhhhlleeeeelhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct dramgarpmarviqdnlkkplanellfgslvdggqvtvaldkekneltygfqsaqkhkae  714
DSSP  llllllllhhhhhhhhhlhhhhhhhhhlllllleeeeeeeehhhleeeeeeeelllllll


No 42: Query=mol1A Sbjct=1jr3D Z-score=9.1

back to top
DSSP  llllhhhHHHHHHHHHhlLLLLLEEEELLLLLLHHHHHHHHHHLL--LLLLlLLEEEELL
Query igrsewiNQYRRRLQQlsETDIAVWLYGAPGTGRXTGARYLHQFG--RNAQgEFVYRELT   58
ident         | |  |        |  | |              |         |       
Sbjct -mirlypEQLRAQLNE--GLRAAYLLLGNDPLLLQESQDAVRQVAaaQGFE-EHHTFSID   56
DSSP  -leeellLLHHHHHHH--LLLLEEEEEELLHHHHHHHHHHHHHHHhhHLLL-EEEEEELL


DSSP  LLLLL-LHHHHHHHH----lLLLEEEEL---hHHLL-HHHHHHHHHHHhllLLLLLEEEE
Query PDNAP-QLNDFIALA----qGGTLVLSH---pEHLT-REQQYHLVQLQsqeHRPFRLIGI  109
ident |                     || |            ||   |  |    |    ||  
Sbjct PNTDWnAIFSLCQAMslfasRQTLLLLLpengPNAAiNEQLLTLTGLL---HDDLLLIVR  113
DSSP  LLLLHhHHHHHHHHHhhlllLEEEEEELllllLLLLhHHHHHHHHLLL---LLLEEEEEE


DSSP  ELLlhhhHHHHLLLLHHHHHHHH-HHEEEL------------------------------
Query GDTslveLAASNHIIAELYYCFA-XTQIAC------------------------------  138
ident |      |       |          |  |                              
Sbjct GNK----LSKAQENAAWFTALANrSVQVTCqtpeqaqlprwvaarakqlnlelddaanqv  169
DSSP  ELL----LLLLLLLLHHHHHHLLlLEEEEEllllllhhhhhhhhhhhhllleelhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  138
ident                                                             
Sbjct lcycyegnllalaqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskra  229
DSSP  hhhlllllhhhhhhhhhhhhhhlllleelhhhhhhhhhhhllllhhhhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  138
ident                                                             
Sbjct lhilqqlrlegsepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgea  289
DSSP  hhhhlllllllllhhhhhhhhhhhhhhhhhhhlllllllhhhhhhhhlllllhhhhhhhh


DSSP  ---------------------------------------------llll
Query ---------------------------------------------lplt  142
ident                                                  
Sbjct lnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslllchkplad  338
DSSP  hhhllhhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhllllllll


No 43: Query=mol1A Sbjct=1jr3E Z-score=8.7

back to top
DSSP  llllHHHHHHHHHHHHHL---LLLLLEEEELLLLLLHHHHHHHHHHLLL-----------
Query igrsEWINQYRRRLQQLS---ETDIAVWLYGAPGTGRXTGARYLHQFGR-----------   46
ident      |       |           |      || |       |                
Sbjct mrwyPWLRPDFEKLVASYqagRGHHALLIQALPGMGDDALIYALSRYLLcqqpqghkscg   60
DSSP  llllLLHHHHHHHHHLLLlllLLLLEEEEELLLLLLHHHHHHHHHHHHLlllllllllll


DSSP  ----------llLLLLEEEELLL---lLLLL-HHHHHHHH-------lLLLEEEELH-HH
Query ----------naQGEFVYRELTP---dNAPQ-LNDFIALA-------qGGTLVLSHP-EH   84
ident                                                             
Sbjct hcrgcqlmqagtHPDYYTLAPEKgkntLGVDaVREVTEKLneharlggAKVVWVTDAaLL  120
DSSP  llhhhhhhhlllLLLEEEELLLLllllLLHHhHHHHHHHHllllllllLEEEEELLHhHL


DSSP  LLH--HHHHHHHHHHhllLLLLLEEEEELLlHHHHhhhlllLHHHHHHHhhHEEELLL--
Query LTR--EQQYHLVQLQsqeHRPFRLIGIGDTsLVELaasnhiIAELYYCFaxTQIACLP--  140
ident                                   |       | |            |  
Sbjct TDAaaNALLKTLEEP---PAETWFFLATRE-PERL------LATLRSRC--RLHYLAPpp  168
DSSP  LHHhhHHHHHHHHLL---LLLEEEEEEELL-LLLL------LLLLLLLL--EEEELLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct eqyavtwlsrevtmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgd  228
DSSP  hhhhhhhhhhhllllhhhhhhhhhlllllhhhhhhhhlllhhhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct wysllaalnheqaparlhwlatllmdalkrhhgaaqvtnvdvpglvaelanhlspsrlqa  288
DSSP  hhhhhhhhllllhhhhhhhhhhhhhhhhhhhlllllllllllhhhhhhhhhhllhhhhhh


DSSP  --------------------------------------------ll
Query --------------------------------------------lt  142
ident                                               
Sbjct ilgdvchireqlmsvtginrellitdlllriehylqpgvvlpvphl  334
DSSP  hhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhllllllllllll


No 44: Query=mol1A Sbjct=1w5sB Z-score=8.6

back to top
DSSP  --------------llllHHHHHHHHHHHHHLL--------lLLLEEEEL---LLLLLHH
Query --------------igrsEWINQYRRRLQQLSE--------tDIAVWLYG---APGTGRX   35
ident                            |                    ||     | |  
Sbjct glfkdrrvfdenyippelRVRRGEAEALARIYLnrllsgaglSDVNMIYGsigRVGIGKT   60
DSSP  lllllhhhhlllllllllLLLLHHHHHHHHHHHhhhhhlleeLLEEEEEElllLLLLLHH


DSSP  HHHHH-HHHLL-----lllLLLLEEEELLlLLLL--LHHHHHHHHL--------------
Query TGARY-LHQFG-----rnaQGEFVYRELTpDNAP--QLNDFIALAQ--------------   73
ident | |                     |                |                  
Sbjct TLAKFtVKRVSeaaakeglTVKQAYVNAF-NAPNlyTILSLIVRQTgypiqvrgapaldi  119
DSSP  HHHHHhHHHHHhhhhhlllLEEEEEEEHH-HLLLhhHHHHHHHHHHllllllllllhhhh


DSSP  -------------LLLEEEE---LHHH---LLHHHHHHHHHHHH-----lLLLLLLEEEE
Query -------------GGTLVLS---HPEH---LTREQQYHLVQLQS-----qEHRPFRLIGI  109
ident                   |              |  | |                     
Sbjct lkalvdnlyvenhYLLVILDefqSMLSsprIAAEDLYTLLRVHEeipsrdGVNRIGFLLV  179
DSSP  hhhhhhhhhhhllEEEEEEEllhHHHLlllLLHHHHHHHHLHHHhlllllLLEEEEEEEE


DSSP  ELLL-HHHHHHhlLLLHHHHHHHhHHEEELL-----------------------------
Query GDTS-LVELAAsnHIIAELYYCFaXTQIACL-----------------------------  139
ident                |                                            
Sbjct ASDVrALSYMR--EKIPQVESQI-GFKLHLPayksrelytileqraelglrdtvweprhl  236
DSSP  EEELhHHHHHH--HHLHHHHLLL-LEEEELLlllhhhhhhhhhhhhhhhllhhhllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct elisdvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneaasiqthe  296
DSSP  hhhhhhhlhhhlllllhhhhhhhhhhhhhhhhhhllllllhhhhhhhhhhllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct lealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylkhl  356
DSSP  hhhllhhhhhhhhhhhhhhlllllleehhhhhhhhhhhhllllllllllhhhhhhhhhhh


DSSP  -------------------------------------lll
Query -------------------------------------plt  142
ident                                         
Sbjct tslglvdakpsttlfrlaphlpadrlievvdniiqakmas  396
DSSP  hhllleeeelllleeeelllllhhhhhhhhhhhhhhhhhl


No 45: Query=mol1A Sbjct=3crvA Z-score=8.4

back to top
DSSP  llllhhHHHHHHHHHHHLLLL---LLEEEELLLLLLHHHHHHHHHHLllLLLLlLEEEEL
Query igrsewINQYRRRLQQLSETD---IAVWLYGAPGTGRXTGARYLHQFgrNAQGeFVYREL   57
ident                   |       | |    | |                        
Sbjct --mvklRDWQEKLKDKVIEGLrnnFLVALNAPTGSGKTLFSLLVSLE--VKPK-VLFVVR   55
DSSP  --llllLHHHHHHHHHHHHHHhllLEEEEELLLLLLHHHHHHHHHHH--HLLE-EEEEEL


DSSP  L-----------------------------------------------------------
Query T-----------------------------------------------------------   58
ident |                                                           
Sbjct Thnefypiyrdltkirekrnitfsflvgkpssclyaekgaesedipckycelkgsivevk  115
DSSP  Lhhhhhhhhhhhlllllllllleeelllhhhhlllllllllhhhllhhhlllllllllll


DSSP  -------------------------------------llLLLLHH------hhhHHHLLL
Query -------------------------------------pdNAPQLN------dfiALAQGG   75
ident                                          |                  
Sbjct tddsplslvkklkkdglqdkfcpyysllnslykadvialTYPYFFidryrefidIDLREY  175
DSSP  llllhhhhhhhhhhhhhhhlllhhhhhhhhhhhlleeeeELHHHHlhhhhllllLLLLLE


DSSP  LEEEE---LHHHL-----------------------------------------------
Query TLVLS---HPEHL-----------------------------------------------   85
ident   |                                                         
Sbjct MIVIDeahNLDKVneleerslseitiqmaikqskseesrrilskllnqlrevvlpdekyi  235
DSSP  EEEELlhhHHHHHhhhhleeeehhhhhhhhhhlllhhhhhhhhhhhhhhlllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   85
ident                                                             
Sbjct kvenvpklskeeleiladdyedirkdslkqgkvnkihigsilrffsllsigsfipfsysk  295
DSSP  ellllllllhhhhhhhhhhhhhhhhhhhhlllllllhhhhhhhhhhhhhhllleeeeell


DSSP  --------LHHHHHhHHHHHhllllLLLEEEEELLLHHHHHhhLLLLhhHHHHHhhHEEE
Query --------TREQQYhLVQLQsqehrPFRLIGIGDTSLVELAasNHIIaeLYYCFaxTQIA  137
ident                |             |    |                         
Sbjct rlviknpeISYYLN-LLNDN-----ELSIILMSGTLPPREYmeKVWG--IKRNM--LYLD  345
DSSP  eeeeelllLHHHHH-HHHLL-----LLEEEEEELLLLLHHHhhHLLL--LLLLE--EEEE


DSSP  LL----------------------------------------------------------
Query CL----------------------------------------------------------  139
ident                                                             
Sbjct VEreiqkrvsgsyecyigvdvtskydmrsdnmwkryadyllkiyfqakanvlvvfpsyei  405
DSSP  HHhhllllllleeeeeeelllllllllllhhhhhhhhhhhhhhhhhllleeeeeellhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct mdrvmsrislpkyvesedssvedlysaisannkvligsvgkgklaegielrnndrslisd  465
DSSP  hhhhhlllllleeellllllhhhhhhhllllllleeeeellllllllllleelleeleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct vvivgipypppddylkilaqrvslkmnreneeflfkipalvtikqaigrairdvndkcnv  525
DSSP  eeeellllllllhhhhhhhhhlllllllllhhhhlhhhhhhhhhhhhhlllllllleeee


DSSP  -----------------------lll
Query -----------------------plt  142
ident                           
Sbjct wlldkrfeslywkknlkclnankmkl  551
DSSP  eeelhhhhlhhhhhhlllllleeell


No 46: Query=mol1A Sbjct=1im2A Z-score=8.3

back to top
DSSP  ------------llllhHHHHHHHHHHHHLLL----------------LLLEEEELLLLL
Query ------------igrseWINQYRRRLQQLSET----------------DIAVWLYGAPGT   32
ident                        |                               |  | 
Sbjct sextpreivseldqhiiGQADAKRAVAIALRNrwrrxqlqeplrhevtPKNILXIGPTGV   60
DSSP  llllhhhhhhhhhllllLLHHHHHHHHHHHHHhhhhhhllllhhhhllLLLEEEELLLLL


DSSP  LHHHHHHHHHHLlllLLLLLEEEEL-LLLL----lLLHHHHHHHHL--------------
Query GRXTGARYLHQFgrnAQGEFVYREL-TPDN----aPQLNDFIALAQ--------------   73
ident |    || |      |   |   |                 |                  
Sbjct GKTEIARRLAKL---ANAPFIKVEAtKFTEvgyvgKEVDSIIRDLTdsaxklvrqqeiak  117
DSSP  LHHHHHHHHHHH---LLLLLLEEEHhHHLLlllllLLLHHHHHHHHhhhhhhhhhhhhll


DSSP  -------------------------------------LLLEEEELHHHL----------L
Query -------------------------------------GGTLVLSHPEHL----------T   86
ident                                       |                     
Sbjct nraraedvaeerliddeaaklinpeelkqkaidaveqNGIVFIDEIDKIckeysgadvsR  177
DSSP  lllllllllllllllllllllllhhhhhhhhhhhhhhHLEEEEELHHHHlllllllllhH


DSSP  HHHHHHHHHHHHLL----------lLLLLEEEEELLlhhHHHHhlLLLHHHHHHHhHHEE
Query REQQYHLVQLQSQE----------hRPFRLIGIGDTslvELAAsnHIIAELYYCFaXTQI  136
ident    |  |  |                    |  |             | ||         
Sbjct EGVQRDLLPLVEGStvstkhgxvktDHILFIASGAF-qvARPS--DLIPELQGRL-PIRV  233
DSSP  HHHHHHHHHHHLLLeeeelleeeehHHLEEEEEELL-llLLHH--HLLHHHHHLL-LEEE


DSSP  ELLLLL------------------------------------------------------
Query ACLPLT------------------------------------------------------  142
ident     |                                                       
Sbjct ELTALSaadferiltephaslteqykalxategvniafttdavkkiaeaafrvnekteni  293
DSSP  ELLLLLhhhhhhhlllllllhhhhhhhhhhlllllleelhhhhhhhhhhhhhhhhhllll


DSSP  -----------------------------------------------------
Query -----------------------------------------------------  142
ident                                                      
Sbjct garrlhtvxerlxdkisfsasdxngqtvnidaayvadalgevvenedlsrfil  346
DSSP  hhhhhhhhhhhhlhhhhhhlhhhllllleelhhhhhhhhhhhlllhhhhhhhl


No 47: Query=mol1A Sbjct=1jbkA Z-score=8.3

back to top
DSSP  -----------------llllhhhHHHHHHHHHHLLLL-----LLEEEELLLLLLHHHHH
Query -----------------igrsewiNQYRRRLQQLSETD-----IAVWLYGAPGTGRXTGA   38
ident                                                | | || |     
Sbjct hmqalkkytidlteraeqgkldpvIGRDEEIRRTIQVLqrrtkNNPVLIGEPGVGKTAIV   60
DSSP  llhhhhhheeehhhhhhlllllllLLLHHHHHHHHHHHlllllLEEEEELLLLLLHHHHH


DSSP  HHHHHLL-------LLLLLLLEEEELL---------llLLLLHHHHHHHH----LLLLEE
Query RYLHQFG-------RNAQGEFVYRELT---------pdNAPQLNDFIALA----QGGTLV   78
ident   | |                                     |               | 
Sbjct EGLAQRIingevpeGLKGRRVLALDMGalvagakyrgeFEERLKGVLNDLakqeGNVILF  120
DSSP  HHHHHHHhhllllhHHLLLEEEEELHHhhhlllllhhhHHHHHHHHHHHHhhllLLEEEE


DSSP  EELHHHL--lHHHHHHHHHHHHLllLLLLEEEEELL-LHHHHHhhllLLHHHHHHHhhHE
Query LSHPEHL--tREQQYHLVQLQSQehRPFRLIGIGDT-SLVELAasnhIIAELYYCFaxTQ  135
ident                 |              |                 | |   |    
Sbjct IDELHTMvgaMDAGNMLKPALAR--GELHCVGATTLdEYRQYI---eKDAALERRF--QK  173
DSSP  EELHHHHlllLLLHHHHHHHHHL--LLLLEEEEELHhHHHHHL---lLLHHHHLLE--EE


DSSP  EELLLLL---------
Query IACLPLT---------  142
ident                 
Sbjct VFVAEPSvedtiailr  189
DSSP  EELLLLLhhhhhllll


No 48: Query=mol1A Sbjct=2w58A Z-score=8.3

back to top
DSSP  ---------------------lllLHHHhHHHHH-HHHHLLL---------LLLEEEELL
Query ---------------------igrSEWInQYRRR-LQQLSET---------DIAVWLYGA   29
ident                                |                        | | 
Sbjct krqesliqsmfmpreilraslsdvDLND-DGRIKaIRFAERFvaeyepgkkMKGLYLHGS   59
DSSP  llhhhheeeelllhhhhlllllllLLLL-HHHHHhHHHHHHHhhhllllllLLEEEEELL


DSSP  LLLLHHHHHHHHHHllLLLL--LLLEEEEL--LLLL-------llLHHHHHHHHlllLEE
Query PGTGRXTGARYLHQfgRNAQ--GEFVYREL--TPDN-------apQLNDFIALAqggTLV   78
ident  | |              |                           |           | 
Sbjct FGVGKTYLLAAIAN--ELAKrnVSSLIVYVpeLFRElkhsqtmneKLDYIKKVP---VLM  114
DSSP  LLLLHHHHHHHHHH--HHHLllLLEEEEEHhhHHHHhhhllllhhHHHHHHHLL---EEE


DSSP  EELH-------hhLLHHHHHHHHHHHhlllllLLEEEEELLLHHHHHHHL--------LL
Query LSHP-------ehLTREQQYHLVQLQsqehrpFRLIGIGDTSLVELAASN--------HI  123
ident |                                            ||             
Sbjct LDDLgaeswvrddVFGPILQYRMFEN------LPTFFTSNFDMQQLAHHLtysqkvkaAR  168
DSSP  EEEElllllhhhlLHHHHHHHHHHLL------LLEEEEELLLHHHHHHHLllllllhhHH


DSSP  LHHH-HHHHhhHEEELLLLL--
Query IAEL-YYCFaxTQIACLPLT--  142
ident | |   |      |        
Sbjct IMERiRYLA--YPIEITGPNrr  188
DSSP  HHHHhHHHE--EEEELLLLLll


No 49: Query=mol1A Sbjct=1sxjA Z-score=8.2

back to top
DSSP  ------------llllhHHHHHHHHHHHHLLLL-------------------LLEEEELL
Query ------------igrseWINQYRRRLQQLSETD-------------------IAVWLYGA   29
ident                          |                           |  ||| 
Sbjct dklwtvkyaptnlqqvcGNKGSVMKLKNWLANWenskknsfkhagkdgsgvfRAAMLYGP   60
DSSP  lllhhhhlllllhhhllLLHHHHHHHHHHHHLHhhhhhllllllllllllllLEEEEELL


DSSP  LLLLHHHHHHHHHHLLLLLlllLEEEELLLlLLLL--HHHHHHHHLL-------------
Query PGTGRXTGARYLHQFGRNAqgeFVYRELTPdNAPQ--LNDFIALAQG-------------   74
ident || |  | |    |                       ||     |               
Sbjct PGIGKTTAAHLVAQELGYD---ILEQNASD-VRSKtlLNAGVKNALDnmsvvgyfkhqnl  116
DSSP  LLLLHHHHHHHHHHHLLLE---EEEELLLL-LLLHhhHHHLHHHHLLlllllllllllll


DSSP  ----LLEEEELHHHL---lhHHHHHHHHHhhlllLLLLEEEEELlLHHHhhhhlLLLHHH
Query ----GTLVLSHPEHL---trEQQYHLVQLqsqehRPFRLIGIGDtSLVElaasnHIIAEL  127
ident                          | |          || |                  
Sbjct ngkhFVIIMDEVDGMsggdrGGVGQLAQF--crkTSTPLILICN-ERNL-----PKMRPF  168
DSSP  llllEEEEELLHHHLlllllLHHHHHHHH--hhhLLLLEEEEEL-LLLL-----LLLHHH


DSSP  HHHHhhHEEELLLL----------------------------------------------
Query YYCFaxTQIACLPL----------------------------------------------  141
ident         |                                                   
Sbjct DRVC--LDIQFRRPdansiksrlmtiairekfkldpnvidrliqttrgdirqvinllsti  226
DSSP  LLLL--EEEELLLLlhhhhhhhhhhhhhhhlllllllhhhhhhhhllllhhhhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct stttktinhenineiskaweknialkpfdiahkmldgqiysdigsrnftlndkialyfdd  286
DSSP  hhhlllllllhhhhhhhhhhlllllhhhhhhhhhllhhhllllhhhlllhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct fdftplmiqenylstrpsvlkpgqshleavaeaancislgdivekkirsseqlwsllplh  346
DSSP  lllhhhhhhhhlllleellllllllhhhhhhhhhhhhhhhhhhhhhhllllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct avlssvypaskvaghmagrinftawlgqnsksakyyrllqeihyhtrlgxxxxxxxxxxx  406
DSSP  hhhhlhhhhhllleelllllllllhhhhhhhhhhhhhhhhhhhllllllllhhhhhlllh


DSSP  ----------------------------------l
Query ----------------------------------t  142
ident                                    
Sbjct xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx  441
DSSP  hhhhhhhlllllhhhhhhllllllhhhhhhhhhhl


No 50: Query=mol1A Sbjct=1g3iA Z-score=8.1

back to top
DSSP  ---------llllhhhHHHHHHHHhHLLL-------------------LLLEEEELLLLL
Query ---------igrsewiNQYRRRLQqLSET-------------------DIAVWLYGAPGT   32
ident                                                        |  | 
Sbjct semtpreivseldqhiIGQADAKRaVAIAlrnrwrrmqlqeplrhevtPKNILMIGPTGV   60
DSSP  llllhhhhhhhhhlllLLLHHHHHhHHHHhhhhhhlllllhhhhhhllLLLEEEELLLLL


DSSP  LHHHHHHHHHHLlllLLLLLEEEELLllLLLLHHHHHHHHL-------------------
Query GRXTGARYLHQFgrnAQGEFVYRELTpdNAPQLNDFIALAQ-------------------   73
ident |    || |      |   |   | |          |                       
Sbjct GKTEIARRLAKL---ANAPFIKVEAT--KFTEVDSIIRDLTdsamklvrqqeiaknridd  115
DSSP  LHHHHHHHHHHH---LLLLEEEEEHH--HHLLLHHHHHHHHhhhhhhhhlllllllllll


DSSP  ---------------------LLLEEEELH------------hHLLHhHHHHHHHH----
Query ---------------------GGTLVLSHP------------eHLTReQQYHLVQL----   96
ident                       |                       |     ||      
Sbjct eaaklinpeelkqkaidaveqNGIVFIDEIdkickkgadvsreGVQR-DLLPLVEGstvs  174
DSSP  lllllllhhhhhhhhhhhhhhHLEEEEELHhhhlllllllllhHHHH-HHHHHHHLleee


DSSP  ---hhlllLLLLEEEEELLlhHHHHHhllLLHHHHHHHHhHEEELLLLL-----------
Query ---qsqehRPFRLIGIGDTslVELAAsnhIIAELYYCFAxTQIACLPLT-----------  142
ident              |  |             | ||             |            
Sbjct tkhgmvktDHILFIASGAFqvARPSD---LIPELQGRLP-IRVELTALSaadferiltep  230
DSSP  elleeeelLLLEEEEEELLllLLHHH---LLHHHHLLLL-EEEELLLLLhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct haslteqykalmategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkis  290
DSSP  lllhhhhhhhhhhhllleeeelhhhhhhhhhhhhhhhhhllllllhhhhhhhhhhlhhhh


DSSP  ------------------------------------
Query ------------------------------------  142
ident                                     
Sbjct fsasdmngqtvnidaayvadalgevvenedlsrfil  326
DSSP  hhhhhlllleeeelhhhhhhhhlllllllllhhhll


No 51: Query=mol1A Sbjct=2p65A Z-score=8.1

back to top
DSSP  ---------------llllhhhHHHHHHHHHHLLLL-----LLEEEELLLLLLHHHHHHH
Query ---------------igrsewiNQYRRRLQQLSETD-----IAVWLYGAPGTGRXTGARY   40
ident                                              | | || |       
Sbjct qalekysrdltalaragkldpvIGRDTEIRRAIQILsrrtkNNPILLGDPGVGKTAIVEG   60
DSSP  lllllleeehhhhhhlllllllLLLHHHHHHHHHHHlllllLEEEEELLHHHLHHHHHHH


DSSP  HHHLL-------LLLLLLLEEEELLLLL---------llLHHHHHHHH----LLLLEEEE
Query LHQFG-------RNAQGEFVYRELTPDN---------apQLNDFIALA----QGGTLVLS   80
ident |                  |   |                |                   
Sbjct LAIKIvqgdvpdSLKGRKLVSLDLSSLIagakyrgdfeeRLKSILKEVqdaeGQVVMFID  120
DSSP  HHHHHhllllllLLLLLEEEEELHHHHHhhlllhhhhhhHHHHHHHHHhhllLLEEEEEL


DSSP  LHHHL-------------LHHHHHHHHHHHhlllllLLEEEEELL-LHHHHHHhlllLHH
Query HPEHL-------------TREQQYHLVQLQsqehrpFRLIGIGDT-SLVELAAsnhiIAE  126
ident                          |           | ||                   
Sbjct EIHTVvgagavaegaldaGNILKPMLARGE------LRCIGATTVsEYRQFIE---kDKA  171
DSSP  LHHHHlllllllllllllHHHHHHHHHLLL------LLEEEEELHhHHHHHLL---lLHH


DSSP  HHHHHhhHEEELLLLL
Query LYYCFaxTQIACLPLT  142
ident |   |   ||      
Sbjct LERRF--QQILVEQPS  185
DSSP  HHHHE--EEEELLLLL


No 52: Query=mol1A Sbjct=1g6oA Z-score=7.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lsaedkkfleveralkeaalnplrhateelfgdflkxeniteicyngnkvvwvlknngew   60
DSSP  lhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllleeeeeelllleeeeeelllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpfdvrdrkafslsrlxhfarccasfkkktidnyenpilssnlangervqivlspvtvnd  120
DSSP  eeeellllhhhlhhhhhhhhhhhhhhllllllllllleeeeellllleeeeellllllll


DSSP  -------------------llLLHHHHH---hhHHHHHHLLL---LLLEEEELLLLLLHH
Query -------------------igRSEWINQ---yrRRLQQLSET---DIAVWLYGAPGTGRX   35
ident                           |                     |   |  | |  
Sbjct etisisiripskttyphsffeEQGFYNLldnkeQAISAIKDGiaiGKNVIVCGGTGSGKT  180
DSSP  llleeeeellllllllhhhhhHLLLLLLlllhhHHHHHHHHHhhhLLLEEEEELLLLLHH


DSSP  HHHHHHHHLLLlLLLLLEEEE------------------lllLLLLL-HHHHHHHHLLlL
Query TGARYLHQFGRnAQGEFVYRE------------------ltpDNAPQ-LNDFIALAQGgT   76
ident |       |           |                           |           
Sbjct TYIKSIXEFIP-KEERIISIEdteeivfkhhknytqlffggnITSADcLKSCLRXRPD-R  238
DSSP  HHHHHHHHHLL-LLLLEEEEElllllllllllleeeeellllLLHHHhHHHHLLLLLL-E


DSSP  EEE-ELHHHLLHhHHHHHHHHHhllllLLLEEEEELL----lHHHHHHHLL---------
Query LVL-SHPEHLTReQQYHLVQLQsqehrPFRLIGIGDT----sLVELAASNH---------  122
ident   |            |                               |            
Sbjct IILgELRSSEAY-DFYNVLCSG-----HKGTLTTLHAgsseeAFIRLANXSssnsaarni  292
DSSP  EEElLLLLLHHH-HHHHHHHLL-----LLLEEEEELLllhhhHHHHHHHHHhllhhhlll


DSSP  ----lLHHHHHHHhHHEEELL--------lll
Query ----iIAELYYCFaXTQIACL--------plt  142
ident      |                          
Sbjct kfeslIEGFKDLI-DXIVHINhhkqcdefyik  323
DSSP  lhhhhHHHHHHHL-LEEEEELlllleeeeeel


No 53: Query=mol1A Sbjct=1svlA Z-score=7.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana   60
DSSP  lllllhhhhhhhhhhhllllhhhhhhhhhlllllllllhhhhllllhhhhllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi  120
DSSP  hhhlllllhhhhhhhhhhhhhhhhhhhhhhllhhhhhhhhhhhhhhhhhhhllllllllh


DSSP  -------lllLHHHHHHHHHHHHHLLLL-------LLEEEELLLLLLHHHHHHHHHHLLl
Query -------igrSEWINQYRRRLQQLSETD-------IAVWLYGAPGTGRXTGARYLHQFGr   46
ident                                          |    |  | |  |     
Sbjct eewmagvawlHCLLPKMDSVVYDFLKCMvynipkkRYWLFKGPIDSGKTTLAAALLELC-  179
DSSP  hhhhhhhhhhLLLLLLHHHHHHHHHHHHhhlllllLEEEEELLLLLLHHHHHHHHHHHH-


DSSP  lllllLEEEELLllLLLL-HHHHHHHHLLL-LEEEEL---------------HHHLlhhh
Query naqgeFVYRELTpdNAPQ-LNDFIALAQGG-TLVLSH---------------PEHLtreq   89
ident                    ||     |      |                          
Sbjct ----gGKALNVN--LPLDrLNFELGVAIDQfLVVFEDvkgtggesrdlpsgqGINN----  229
DSSP  ----lLEEELLL--LLHHhHHHHHHHHLLLlLEEELLllllllhhhllllllHHHH----


DSSP  HHHHHHHHHLLL--------------LLLLEEEEELLlhhhhhhhLLLLHHHHHHHhHHE
Query QYHLVQLQSQEH--------------RPFRLIGIGDTslvelaasNHIIAELYYCFaXTQ  135
ident    |                           |                   |   |   |
Sbjct LDNLRDYLDGSVkvnlekkhlnkrtqIFPPGIVTMNE--------YSVPKTLQARF-VKQ  280
DSSP  HLLLHHHHHLLLleeellllllleeeLLLLEEEEELL--------LLLLHHHHLLL-LEE


DSSP  EELL--------------------------------------------------------
Query IACL--------------------------------------------------------  139
ident |                                                           
Sbjct IDFRpkdylkhclersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerld  340
DSSP  EELLllhhhhhhhhlllhhhhllllllhhhhhhhhhhhllhhhlllllhhhhhhhhhhhh


DSSP  --------------------lll
Query --------------------plt  142
ident                        
Sbjct kefslsvyqkmkfnvamgigvld  363
DSSP  hhllhhhhhhhhhhhhhllllll


No 54: Query=mol1A Sbjct=1g4aE Z-score=7.5

back to top
DSSP  ------------llllhhHHHH-HHHHHHHLLL----------------LLLEEEELLLL
Query ------------igrsewINQY-RRRLQQLSET----------------DIAVWLYGAPG   31
ident                         |                               |  |
Sbjct msemtpreivseldkhiiGQDNaKRSVAIALRNrwrrmqlneelrhevtPKNILMIGPTG   60
DSSP  lllllhhhhhhhhhhhllLLHHhHHHHHHHHHHhhhhllllhhhhllllLLLEEEELLLL


DSSP  LLHHHHHHHHHHLlllLLLLLEEEEL-LLLL----lLLHHHHHHHHL-------------
Query TGRXTGARYLHQFgrnAQGEFVYREL-TPDN----aPQLNDFIALAQ-------------   73
ident  |    || |      |   |   |                 |                 
Sbjct VGKTEIARRLAKL---ANAPFIKVEAtKFTEvgyvgKEVDSIIRDLTdaavkmvrvqaie  117
DSSP  LLHHHHHHHHHHH---HLLLEEEEELlHHHLlllllLLHHHHHHHHLlhhhhllllllll


DSSP  ---------------------------------------------LLLEEEELH------
Query ---------------------------------------------GGTLVLSHP------   82
ident                                               |             
Sbjct knryraeelaeerildamkllieeeaaklvnpeelkqdaidaveqHGIVFIDEIdkickr  177
DSSP  llhhhhhlhhhhlllllllhhhhlhhhhlllllhhhhllllhhhhLLEEEEELLllllll


DSSP  ----------hHLLHhHHHHHHHH-------hhlllLLLLEEEEELLlhHHHHHhllLLH
Query ----------eHLTReQQYHLVQL-------qsqehRPFRLIGIGDTslVELAAsnhIIA  125
ident               |     ||                   |  |             | 
Sbjct gessgpdvsreGVQR-DLLPLVEGctvstkhgmvktDHILFIASGAFqiAKPSD---LIP  233
DSSP  llllllllhhhHHHH-LLHHHHHLleeeelleeeehHHLEEEELLLLllLLHHH---LLH


DSSP  HHHHHHhHHEEELLLLL-------------------------------------------
Query ELYYCFaXTQIACLPLT-------------------------------------------  142
ident ||             ||                                           
Sbjct ELQGRL-PIRVELQALTtsdferiltepnasitvqykalmategvnieftdsgikriaea  292
DSSP  HHHHLL-LEEEELLLLLhhhhhhhhhlllllhhhhhhhhlllllllllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct awqvnestenigarrlhtvlerlmeeisydasdlsgqnitidadyvskhldalvadedls  352
DSSP  hhhhhhhllllllhhhhhhhhhllhhhhhhllllllllllllhhhhhhhlhhhhhllllh


DSSP  ----
Query ----  142
ident     
Sbjct rfil  356
DSSP  hhhl


No 55: Query=mol1A Sbjct=2gxaE Z-score=7.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gslqtekfdfgtmvqwaydhkyaeeskiayeyalaagsdsnaraflatnsqakhvkdcat   60
DSSP  lllllllllhhhhhhhhhhlllllhhhhhhhhhhlllllhhhhhhhhlllhhhhhhhhhh


DSSP  --------------------------------llllHHHH--HHHH-HHHHHLLLL----
Query --------------------------------igrsEWIN--QYRR-RLQQLSETD----   21
ident                                        |                    
Sbjct mvrhylraetqalsmpayikarcklatgegswksilTFFNyqNIELiTFINALKLWlkgi  120
DSSP  hhhhhhhhhhhhllhhhhhhhhhhhllllllhhhhhHHHHhlLLLHhHHHHHHHHHhhll


DSSP  ---LLEEEELLLLLLHHHHHHHHHHlllllLLLLEEEELLllLLLL--HHHHHHHHllLL
Query ---IAVWLYGAPGTGRXTGARYLHQfgrnaQGEFVYRELTpdNAPQ--LNDFIALAqgGT   76
ident          | | ||       |                   |          |      
Sbjct pkkNCLAFIGPPNTGKSMLCNSLIH-----FLGGSVLSFA--NHKShfWLASLADT--RA  171
DSSP  lllLEEEEELLLLLLHHHHHHHHHH-----HHLLEEELHH--HLLLhhHHHHHHLL--LL


DSSP  EEEE-LHHHLlhHHHH-HHHHHHHLLL-------------LLLLEEEEELLLHHHHHhhl
Query LVLS-HPEHLtrEQQY-HLVQLQSQEH-------------RPFRLIGIGDTSLVELAasn  121
ident                   |                         |               
Sbjct ALVDdATHAC-wRYFDtYLRNALDGYPvsidrkhkaavqiKAPPLLVTSNIDVQAED---  227
DSSP  EEEEeELHHH-hHHHHhLHHHLLLLLLeeellllllleeeLLLLEEEEELLLLLLLL---


DSSP  LLLHhHHHHHhhHEEEL-LLLL----------------------------
Query HIIAeLYYCFaxTQIAC-LPLT----------------------------  142
ident      |             | |                            
Sbjct RYLY-LHSRV--QTFRFeQPCTdesgeqpfnitdadwksffvrlwgrldl  274
DSSP  LLHH-HHLLL--EEEELlLLLLlllllllllllhhhhhhhhhhhllllll


No 56: Query=mol1A Sbjct=2vl7A Z-score=7.4

back to top
DSSP  llllhhHHHHHHHHHHHLLLL---LLEEEELLLLLLHHHHHHHHHHLLLLlllLLEEEEL
Query igrsewINQYRRRLQQLSETD---IAVWLYGAPGTGRXTGARYLHQFGRNaqgEFVYREL   57
ident              |              |   || |       |                
Sbjct ------RQWQAEKLGEAINALkhgKTLLLNAKPGLGKTVFVEVLGMQLKK---KVLIFTR   51
DSSP  ------LLHHHHHHHHHHHHHhllLEEEEELLLLLLHHHHHHHHHHHHLL---EEEEEEL


DSSP  L-------------------------------llLLLLHH------------hhhHHHLL
Query T-------------------------------pdNAPQLN------------dfiALAQG   74
ident |                                   | |                     
Sbjct ThsqldsiyknakllglktgflranlkdkdviamTYPYLFqkpirnsvfcnkddcLKLED  111
DSSP  LhhhhhhhhhhhhhhllleeellllhhhlleeeeELHHHHlhhhhhhhlllllllLLHHH


DSSP  LLEEEE---LHHHL----------------------------------------------
Query GTLVLS---HPEHL----------------------------------------------   85
ident    |                                                        
Sbjct YLIVIDeahNLLEAdkwftrkisrkmleralkeieiverlnridakkvkdyinllidyms  171
DSSP  EEEEELlhhHHHHHhhhhleeelhhhhhhhhhhhhhhhhllllllhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   85
ident                                                             
Sbjct klikdgrchelslmplpdretngelivvtraylnidegpvkksslksllkfvemkgdlyn  231
DSSP  llllllleeeelllllllhhhhhhhhhhhhhhhllllllllllhhhhhhhhhhllleeee


DSSP  -----------LHHHHHHHHHHhhllllLLLEEEEELLLhHHHHhhllllhhHHHHHhhH
Query -----------TREQQYHLVQLqsqehrPFRLIGIGDTSlVELAasnhiiaeLYYCFaxT  134
ident                                      |   |                  
Sbjct cngslvkvpsdVNQLIEDALNV------KTFKVLMSGTL-PESL--------TLTNS--Y  274
DSSP  elleeeeelllHHHHHHHHLLL------LLLEEEEELLL-LLLL--------LLLLE--E


DSSP  EEELLL------------------------------------------------------
Query QIACLP------------------------------------------------------  140
ident  |                                                          
Sbjct KIVVNEsgrgeyyycpnvtselrkrnsnipiysillkriyenssksvlvffpsyemlesv  334
DSSP  EEELLLlllleeeelllllllhhhhhhhhhhhhhhhhhhhhlllleeeeeellhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct rihlsgipvieenkktrheevlelmktgkylvmlvmlfeslvlaglpypnvsddmvrkri  394
DSSP  hllllllleeellllllhhhhhhhhhlllleeeeelleeeeeeelllllllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct erlskltgkdedsiihdltaivikqtigrafrdpndyvkiylcdsryreyfadlgiseke  454
DSSP  hhhhhhhlllhhhhhhhhhhhhhhhhhhhhlllllllleeeeelhhhhhhllllllllll


DSSP  ---ll
Query ---lt  142
ident      
Sbjct iklfa  459
DSSP  leell


No 57: Query=mol1A Sbjct=1w4rA Z-score=7.2

back to top
DSSP  llllhhhhhhhhhhhhhlllLLLEEEELLLLLLHHHHHHHHHHLLLllLLLLEEEELLL-
Query igrsewinqyrrrlqqlsetDIAVWLYGAPGTGRXTGARYLHQFGRnaQGEFVYRELTP-   59
ident                            |    |  |            |           
Sbjct -------------------rGQIQVILGPMFSGKSTELMRRVRRFQiaQYKCLVIKYAKd   41
DSSP  -------------------lLEEEEEEELLLLLHHHHHHHHHHHHHhlLLLEEEEEELLl


DSSP  -----------------lLLLLHHHHHHHHL-LLLEEEELHHHLLhhHHHHH-HHHHHll
Query -----------------dNAPQLNDFIALAQ-GGTLVLSHPEHLTreQQYHL-VQLQSqe  100
ident                    |  | |    |                              
Sbjct trysssfcthdrntmealPACLLRDVAQEALgVAVIGIDEGQFFP--DIVEFcEAMAN--   97
DSSP  llhhhlllhhhhhhleeeEELLHHHHHHHHHlLLEEEELLHHHLL--LHHHHhHHHHH--


DSSP  lLLLLEEEEELLlhhhhhHHLLLlhHHHHHHhHHEEELL---------------------
Query hRPFRLIGIGDTslvelaASNHIiaELYYCFaXTQIACL---------------------  139
ident       |                   |                                 
Sbjct -AGKTVIVAALD-gtfqrKPFGAilNLVPLA-ESVVKLTavcmecfreaaytkrlgteke  154
DSSP  -LLLEEEEEEEL-lllllLLLLLhhHHHHHL-LEEEELLeelllllleeleeeellllll


DSSP  -----------------lll
Query -----------------plt  142
ident                     
Sbjct veviggadkyhsvcrlcyfk  174
DSSP  llllllllleeeelhhhhll


No 58: Query=mol1A Sbjct=2orwB Z-score=7.2

back to top
DSSP  llllhhhhhhhhhhhhhlllLLLEEEELLLLLLHHHHHHHHHHLLLLLLLLLEEEELLLL
Query igrsewinqyrrrlqqlsetDIAVWLYGAPGTGRXTGARYLHQFGRNAQGEFVYRELTPD   60
ident                            |    |  |                       |
Sbjct -------------------sGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKID   41
DSSP  -------------------lLLEEEEEELLLLLHHHHHHHHHHHHHHLLLEEEEEEELLL


DSSP  -----------LLLLHHHHHHH--hlLLLEEEELHHHLLHhHHHHHHHHHHLllLLLLEE
Query -----------NAPQLNDFIAL--aqGGTLVLSHPEHLTReQQYHLVQLQSQehRPFRLI  107
ident                                               |       |     
Sbjct tmivshgveahVIERPEEMRKYieedTRGVFIDEVQFFNP-SLFEVVKDLLD--RGIDVF   98
DSSP  leelllleeleEELLHHHHHHHllllEEEEEELLHHHLLL-LHHHHHHHHHH--LLLEEE


DSSP  EEELLlhhhhhhHLLL-lhHHHHHHhHHEEELLL--------------------------
Query GIGDTslvelaaSNHI-iaELYYCFaXTQIACLP--------------------------  140
ident   |                 |      | |                              
Sbjct CAGLD--lthkqNPFEttaLLLSLA-DTVIKKKAvchrcgeynatltlkvaggeeeidvg  155
DSSP  EEEEL--lllllLLLHhhhHHHHHL-LEEEELLLllllllllllleeeelllllllllll


DSSP  ----------------ll
Query ----------------lt  142
ident                   
Sbjct gqekyiavcrdcyntlkk  173
DSSP  lllleeeelhhhhhhhhl


No 59: Query=mol1A Sbjct=2oap2 Z-score=7.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct hydilrrhirsedlletpefgsgsriveeywiqepftkaiivenedefrnvyyaleptvs   60
DSSP  lhhhhhhhlllllllllllllllleeeeeeeeellleeeeeeeehhhleelleeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct seeaevisalyddlkkilvlqdvsvdleeraevlvraieklskeyavsftdnfysrxlyy  120
DSSP  hhhhhhhhhhhhhhllllhhhlllllhhhhlhhhhhhhhhhhhhllllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lfrdffgyglidplxedtnvediscdgynipifiyhqkygnvetnivldqekldrxvlrl  180
DSSP  hhhhhlllhhhhhhhhllleeeeeellllllleeeellleeeellllllhhhhhhhhhhh


DSSP  ------------------------------------------------------llLLHH
Query ------------------------------------------------------igRSEW    6
ident                                                             
Sbjct tqrsgkhisianpivdatlpdgsrlqatfgtevtprgssftirkftiepltpidliEKGT  240
DSSP  hhllllllllllleeeeellllleeeeelllllllllleeeeellllllllhhhhhHLLL


DSSP  HHhhHHHHHHHLLL---LLLEEEELLLLLLHHHHHHHHHHLLLllLLLLEEEELL-----
Query INqyRRRLQQLSET---DIAVWLYGAPGTGRXTGARYLHQFGRnaQGEFVYRELT-----   58
ident        |  |             |    |  |       |        |  | |     
Sbjct VP--SGVLAYLWLAiehKFSAIVVGETASGKTTTLNAIXXFIP-pDAKVVSIEDTreikl  297
DSSP  LL--HHHHHHHHHHhhlLLLEEEEELLLLLHHHHHHHHHHHLL-lLLLEEEEELLlllll


DSSP  -------------lLLLLLH-HHHHHHhLLLLEEEELHHHLlhhHHHHHHHHHHLlllLL
Query -------------pDNAPQL-NDFIALaQGGTLVLSHPEHLtreQQYHLVQLQSQehrPF  104
ident                    |                            | |  |      
Sbjct yhenwiaevtrtgeIDXYDLlRAALRQ-RPDYIIVGEVRGR---EAQTLFQAXST---GH  350
DSSP  lllleeeeelllllLLHHHHhHHHLLL-LLLEEELLLLLLL---HHHHHHHHHHL---LL


DSSP  LEEEEELL----lHHHHHHH--lLLLHHHHHHHhHHEEELLL------------------
Query RLIGIGDT----sLVELAAS--nHIIAELYYCFaXTQIACLP------------------  140
ident               |    |                                        
Sbjct ASYSTLHAgdinqXVYRLESeplKVPRSXLQFL-DIALVQTXwvrgntrlrrtkevneil  409
DSSP  EEEEEEELlllhhHHHHHHLlllLLLHHHHHHL-LEEEEEEEeelllleeeeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gidpvdknllvnqfvkwdpkedkhievsxpkklekxadflgvsvqevydexlsrkrylel  469
DSSP  eelllllleeeeeeeeeelllleeeelllllhhhhhhhhhlllhhhhhhhhhhhhhhhhh


DSSP  --------------------------------ll
Query --------------------------------lt  142
ident                                   
Sbjct xlkrgirnykevtryihayyrnpelaxtkxeegl  503
DSSP  hhhlllllhhhhhhhhhhhhhlhhhhhhhhhlll


No 60: Query=mol1A Sbjct=1xp8A Z-score=7.1

back to top
DSSP  -----------------------------------llllhhhHHHHHH-hHHHLlLLLLE
Query -----------------------------------igrsewiNQYRRR-lQQLSeTDIAV   24
ident                                                             
Sbjct akerskaietamsqiekafgkgsimklgaeskldvqvvstgsLSLDLAlgVGGIpRGRIT   60
DSSP  llhhhhhhhhhhhhhhhhhllllllllllllllllleellllHHHHHHllLLLEeLLLEE


DSSP  EEELLLLLLHHHHHHHHHHLLlllLLLLEEEEL----------------------LLLLL
Query WLYGAPGTGRXTGARYLHQFGrnaQGEFVYREL----------------------TPDNA   62
ident   ||    |  | |           |                              ||| 
Sbjct EIYGPESGGKTTLALAIVAQAqkaGGTCAFIDAehaldpvyaralgvntdellvsQPDNG  120
DSSP  EEEELLLLLHHHHHHHHHHHHhhlLLLEEEEELlllllhhhhhhllllhhhleeeLLLLH


DSSP  LL-HHHHHHHHL---LLLEEEELHHHL---------LHHHHHHHHH-HHHL-LLLLLLEE
Query PQ-LNDFIALAQ---GGTLVLSHPEHL---------TREQQYHLVQ-LQSQ-EHRPFRLI  107
ident  | |     |         |      |                    |           |
Sbjct EQaLEIMELLVRsgaIDVVVVDSVAALtpraeipglQARLMSQALRkLTAIlSKTGTAAI  180
DSSP  HHhHHHHHHHHLlllLLEEEEELLLLLllllllllhHHHHHHHHHHhHHHHhLLLLLEEE


DSSP  EEELLlhhhhhhhllLLHHHHHHHhHHEEELLL---------------------------
Query GIGDTslvelaasnhIIAELYYCFaXTQIACLP---------------------------  140
ident  |                 |                                        
Sbjct FINQV----------GGRALKFYA-SVRLDVRKigqptvantvkiktvknkvaapfkeve  229
DSSP  EEEEL----------LHHHHHHHL-LEEEEEEEellllleeeeeeeeeeellllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct lalvygkgfdqlsdlvglaadmdiikkagsfysygderigqgkektiayiaerpemeqei  289
DSSP  eeeellleelhhhhhhhhhhhlllleeelleeelllleeeelhhhhhhhhlllhhhhhhh


DSSP  -------ll
Query -------lt  142
ident          
Sbjct rdrvmaair  298
DSSP  hhhhhhhhl


No 61: Query=mol1A Sbjct=3crw1 Z-score=7.1

back to top
DSSP  llllhhhhhhHHHHHHHLLLL---LLEEEELLLLLLHHHHHHHHHHlLLLLllLLEEEEL
Query igrsewinqyRRRLQQLSETD---IAVWLYGAPGTGRXTGARYLHQfGRNAqgEFVYREL   57
ident                   |       | |    | |                        
Sbjct ----------EKLKDKVIEGLrnnFLVALNAPTGSGKTLFSLLVSL-EVKP--KVLFVVR   47
DSSP  ----------LLHHHHHHHHHhllLEEEEELLLLLLHHHHHHHHHL-LLLL--EEEEEEL


DSSP  L------------------------------------------llLLLLHH------hhh
Query T------------------------------------------pdNAPQLN------dfi   69
ident |                                              |            
Sbjct ThnefypiyrdltkireitfsflvgkpssclesenslykadvialTYPYFFidryrefid  107
DSSP  LlhhhhhhhhhhhlllllleelllllllllllllllllllleeeeELHHHHlhhhhllll


DSSP  HHHLLLLEEEE---LHHHLL----------------------------------------
Query ALAQGGTLVLS---HPEHLT----------------------------------------   86
ident         |                                                   
Sbjct IDLREYMIVIDeahNLDKVNeleerslseitiqmaikqskseesrrilskllnqlrevvl  167
DSSP  LLLLLEEEEEElhhHLHHHHhhhleeeellhhhhhhhllllllhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   86
ident                                                             
Sbjct pdekyikvenvpklskeeleiladdyedirkdslkqkihigsilrffsllsigsfipfsy  227
DSSP  llllleellllllllhhhhhhhhlhhhhhhhhlllllllllhhhhhhhhhhhllleeeee


DSSP  -----------HHHHHhHHHHHhllllLLLEEEEELLLHHHHHhhLLLLhhHHHHHhhHE
Query -----------REQQYhLVQLQsqehrPFRLIGIGDTSLVELAasNHIIaeLYYCFaxTQ  135
ident                  |             |    |                       
Sbjct skrlviknpeiSYYLN-LLNDN-----ELSIILMSGTLPPREYmeKVWG--IKRNM--LY  277
DSSP  lleeeeellllLLLLH-HHHLL-----LLLEEEEELLLLLHHHhhHLLL--LLLLE--EE


DSSP  EELL--------------------------------------------------------
Query IACL--------------------------------------------------------  139
ident                                                             
Sbjct LDVEreiqkrvsgsyecyigvdvtskydmrsdnmwkryadyllkiyfqakanvlvvfpsy  337
DSSP  EEHHhhllllllllleeeeelllllllllllhhhhhhhhhhhhhhhhlllleeeeeellh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct eimdrvmsrislpkyvesedssvedlysaisannkvligsvgkgklaegielrnndrsli  397
DSSP  hhhhhhhlllllleeellllllhhhhhllllllllleeeeelllllllllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct sdvvivgipypppddylkilaqrvslkmnreneeflfkipalvtikqaigrairdvndkc  457
DSSP  eeeeeellllllllhhhhhhhhllllllllllhhhhlhhhhhhhhhhhhhllllllllll


DSSP  -------------------------lll
Query -------------------------plt  142
ident                             
Sbjct nvwlldkrfeslywkknlkclnankmkl  485
DSSP  eeeeelhhhhlhhhhhhllllleeeell


No 62: Query=mol1A Sbjct=2qgzA Z-score=7.1

back to top
DSSP  ---------------------------llllhhhhhHHHHHHHHLL-----lLLLEEEEL
Query ---------------------------igrsewinqYRRRLQQLSE-----tDIAVWLYG   28
ident                                              |           |||
Sbjct qkqaaiseriqlvslpksyrhihlsdidvnnasrmeAFSAILDFVEqypsaeQKGLYLYG   60
DSSP  llllhhhhleeeelllhhhhlllhhhlllllhhhhhHHHHHHHHHHhlllllLLEEEEEL


DSSP  LL-LLLHHHHHHHH---hhLLLLlllLLEEEEL---LLLL-----llLHHHHHHhhllLL
Query AP-GTGRXTGARYL---hqFGRNaqgEFVYREL---TPDN-----apQLNDFIAlaqgGT   76
ident           |                           |                     
Sbjct DMgIGKSYLLAAMAhelseKKGV---STTLLHFpsfAIDVknaiskeEIDAVKN---vPV  114
DSSP  LLlLLHHHHHHHHHhhhhhHLLL---LEEEEEHhhhHHHHhllllllLLHHHHL---lLE


DSSP  EEEELHHHLLHHHHHHHHHHHHLllLLLLEEEEELLLHHHHHHHL----llLHHH-HHHH
Query LVLSHPEHLTREQQYHLVQLQSQehRPFRLIGIGDTSLVELAASN----hiIAEL-YYCF  131
ident | |        |      |                 |   |            |   |  
Sbjct LILDDIGAVRDEVLQVILQYRML--EELPTFFTSNYSFADLERKWawqakrVMERvRYLA  172
DSSP  EEEELLLLLLLLLHHHHHHHHHH--HLLLEEEEELLLHHHHHLLLllllllHHHHhHHHE


DSSP  hhHEEEL--llll
Query axTQIAC--lplt  142
ident              
Sbjct --REFHLeganrr  183
DSSP  --EEEELllllll


No 63: Query=mol1A Sbjct=3gp8A Z-score=7.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qglerrllaglqglgltinqaqravkhfgadaldrlekdlftltevegigfltadklwqa   60
DSSP  llllhhhhhhhhhllllhhhhhhhhhhhlllhhhhhhhlhhhhhhlllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct rggalddprrltaaavyalqlagtqaghsflprsraekgvvhytrvtpgqarlavetave  120
DSSP  lllllllhhhhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhlllhhhhhhhhhhhhh


DSSP  -------------------------------------------------------llllh
Query -------------------------------------------------------igrse    5
ident                                                             
Sbjct lgrlseddsplfaeaaatgegriylphvlraekklaslirtllatppadddwavpkkark  180
DSSP  lllleeelllllllllllllleeelhhhhhhhhhhhhhhhhhhhlllllllllllhhhhl


DSSP  hHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHLLllLLLLLEEEELLLL-----
Query wINQYRRRLQQLSETDIAVWLYGAPGTGRXTGARYLHQFGrnAQGEFVYRELTPD-----   60
ident                   | | | ||||  |              |      |       
Sbjct gLSEEQASVLDQLAGHRLVVLTGGPGTGKSTTTKAVADLAesLGLEVGLCAPTGKaarrl  240
DSSP  lLLHHHHHHHHHHHHLLEEEEEELLLLLHHHHHHHHHHHHhhLLLLEEEEELLHHhhhhh


DSSP  ---------LLLLHHH-----------hhHHHLllLEEEELHHHLLHHHHHHHHHHHhll
Query ---------NAPQLND-----------fiALAQggTLVLSHPEHLTREQQYHLVQLQsqe  100
ident              |               |      |               |       
Sbjct gevtgrtasTVHRLLGygpqgfrhnhlepAPYD--LLIVDEVSMMGDALMLSLLAAV---  295
DSSP  hhhhllleeEHHHHLLeelleelllllllLLLL--EEEELLHHHLLHHHHHHHHHLL---


DSSP  lLLLLEEEEELLlhhHHHH--hLLLLhhhHHHH-HHHEEELLLLL---------------
Query hRPFRLIGIGDTslvELAA--sNHIIaelYYCF-AXTQIACLPLT---------------  142
ident     |    |||                      |   |                     
Sbjct pPGARVLLVGDT---DQLPpvdAGLP--lLALAqAAPTIKLTQVYrqaaknpiiqaahgl  350
DSSP  lLLLEEEEEELL---LLLLlllLLLH--hHHHHhHLLEEEELLLLhhhhllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct lhgeapawgdkrlnlteiepdggarrvalmvrelggpgavqvltpmrkgplgmdhlnyhl  410
DSSP  lllllllllllleeeeelllllhhhhhhhhhhhhlllllleeeellllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct qalfnpgeggvriaegearpgdtvvqtknifngtlgmvlkaegarltvdnvveltgaelf  470
DSSP  hhhhlllllleelllleellllleeellllllllllleeeeelleeeelllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct nlqlgyaltvhraqgsewgtvlgvlheahmpmlsrnlvytaltrardrffsagsasawqi  530
DSSP  heeelleeehhhhlllleeeeeeeelhhhhhhllhhhhhhhhhleeeeeeeeelhhhhhh


DSSP  ---------------------
Query ---------------------  142
ident                      
Sbjct aaarqrearntallerirahl  551
DSSP  hhhlllllllllhhhhhhhhl


No 64: Query=mol1A Sbjct=1s9hA Z-score=6.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct agmelvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapd   60
DSSP  llllhhhhhhhhllllhhhhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhlllhh


DSSP  ---------LLLLHHHHHHHH-------hHHHHLLLL--------LLEEEELLLLLLHHH
Query ---------IGRSEWINQYRR-------rLQQLSETD--------IAVWLYGAPGTGRXT   36
ident             |  |                                || |   ||   
Sbjct ylvgqqpveDISSNRIYKILElngydpqyAASVFLGWatkkfgkrNTIWLFGPATTGKTN  120
DSSP  hhlllllllLHHHLHHHHHHHhllllhhhHHHHHHHHhhllllllLEEEEELLLLLLHHH


DSSP  HHHHHHHllllLLLLLEEEELLllLLLLHHHHHHHHllLLEEEELHHhLLHHHHHHHHHH
Query GARYLHQfgrnAQGEFVYRELTpdNAPQLNDFIALAqgGTLVLSHPEhLTREQQYHLVQL   96
ident  |                   |  |                        |          
Sbjct IAEAIAH----TVPFYGCVNWT--NENFPFNDCVDK--MVIWWEEGK-MTAKVVESAKAI  171
DSSP  HHHHHHH----HLLLEEELLLL--LLLLLLLLLLLL--LEEEELLLL-LLLLLHHHHHHH


DSSP  --HHLL-----------lLLLLEEEEELLLHH----hhhhhLLLLHHHHHHHhhHEEELL
Query --QSQE-----------hRPFRLIGIGDTSLV----elaasNHIIAELYYCFaxTQIACL  139
ident    |               |   |    |                  |            
Sbjct lgGSKVrvdqkckssaqiDPTPVIVTSNTNMCavidgnsttFEHQQPLQDRM--FKFELT  229
DSSP  hhLLLEeellllllleeeLLLLEEEEELLLLLleelllleeLLLHHHHHLLE--EEEELL


DSSP  LLL------------------------------------
Query PLT------------------------------------  142
ident                                        
Sbjct RRLdhdfgkvtkqevkdffrwakdhvvevehefyvkkgg  268
DSSP  LLLllllllllhhhhhhhhhhhhhlllllllllllllll


No 65: Query=mol1A Sbjct=2qenA Z-score=6.9

back to top
DSSP  -------llllhhhHHHHHHHHHHLLLL---LLEEEELLLLLLHHHHHHHHHHLLlllll
Query -------igrsewiNQYRRRLQQLSETD---IAVWLYGAPGTGRXTGARYLHQFGrnaqg   50
ident                        | |         | |    |     |           
Sbjct mlfdlrpktrrediFDREEESRKLEESLenyPLTLLLGIRRVGKSSLLRAFLNER-----   55
DSSP  llllllllllhhhlLLLHHHHHHHHHHHhhlLEEEEELLLLLLHHHHHHHHHHHL-----


DSSP  LLEEEEL----------lLLLLL---------------------------------LHHH
Query EFVYREL----------tPDNAP---------------------------------QLND   67
ident                                                          |  
Sbjct PGILIDCrelyaerghitREELIkelqstispfqkfqskfkislnlkfltleprklSLRE  115
DSSP  LEEEEEHhhhhhllllllHHHHHhhhhhhlllhhhhhhhhllllllhhhlllhhhlLHHH


DSSP  HHHHHL-------LLLEEEE--LHHH-----lLHHHHHHHHHHHHLllLLLLEEEEELLL
Query FIALAQ-------GGTLVLS--HPEH-----lTREQQYHLVQLQSQehRPFRLIGIGDTS  113
ident                                   |                  |  |   
Sbjct VFRELNdlgeelgEFIVAFDeaQYLRfygsrgGKELLALFAYAYDS-lPNLKIILTGSEV  174
DSSP  HHHHHHhhhhhhlLEEEEEElhHHHHhlllllLHHHHHHHHHHHHH-lLLEEEEEEELLH


DSSP  hHHHHhhLLLLH------hhHHHHhhHEEELLLLL-------------------------
Query lVELAasNHIIA------elYYCFaxTQIACLPLT-------------------------  142
ident    |                            |                           
Sbjct -GLLH--DFLKItdyesplyGRIA--GEVLVKPFDkdtsveflkrgfrevnldvpeneie  229
DSSP  -HHHH--HHHLLllllllllLLLL--EEEELLLLLhhhhhhhhhhhhhlllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct eavelldgipgwlvvfgveylrngdfgramkrtlevakglimgeleelrrrspryvdilr  289
DSSP  hhhhhhlllhhhhhhhhhhhhhhllhhhhhhhhhhhhhhhhhhhhhhhhhhlhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct aialgynrwslirdylavkgtkipeprlyallenlkkmnwiveedntykiadpvvatvlr  349
DSSP  hhhlllllhhhhhhhhhhllllllhhhhhhhhhhhhhllleeeelleeeellhhhhhhhl


DSSP  -
Query -  142
ident  
Sbjct i  350
DSSP  l


No 66: Query=mol1A Sbjct=1cr1A Z-score=6.9

back to top
DSSP  ------------llllhhhhhHHHHhhHHLLLL--LLEEEELLLLLLHHHHHHHHHHLL-
Query ------------igrsewinqYRRRlqQLSETD--IAVWLYGAPGTGRXTGARYLHQFG-   45
ident                                             | |  |  |       
Sbjct mrerirehlsseesvgllfsgCTGIndKTLGARggEVIMVTSGSGMGKSTFVRQQALQWg   60
DSSP  lhhhhhhhhhhllllllllllLLLHhhHHLLLLllLEEEEEELLLLLHHHHHHHHHHHHh


DSSP  llLLLLLEEEEL------------------------------------------------
Query rnAQGEFVYREL------------------------------------------------   57
ident            |                                                
Sbjct taMGKKVGLAMLeesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt  120
DSSP  hlLLLLEEEEELlllhhhhhhhhhhhhllllhhhlhhhhhhhhhhlhhhhhhhhhhllll


DSSP  ------LLLLLL-LHHHHHHHHL----LLLEEEELHH--hLLHHHHHHHHHHHHLllLLL
Query ------TPDNAP-QLNDFIALAQ----GGTLVLSHPE--hLTREQQYHLVQLQSQehRPF  104
ident               |    |            | |             |           
Sbjct fhlydsFAEAETdRLLAKLAYMRsglgCDVIILDHISirkMIDNLMTKLKGFAKS--TGV  178
DSSP  eeeellLLLLLHhHHHHHHHHHHhlllLLEEEEEEEEllhHHHHHHHHHHHHHHH--HLL


DSSP  LEEEEELL-lhHHHHhhllllHHHHHHHhHHEEELL------------------------
Query RLIGIGDT-slVELAasnhiiAELYYCFaXTQIACL------------------------  139
ident  |  |                  |      | ||                          
Sbjct VLVVICHLktdLRGS------GALRQLS-DTIIALErnqlvlvrilkcrftgdtgiagym  231
DSSP  EEEEEEELlllLLLL------HHHHHHL-LEEEEEEellleeeeeeeelllllleeeeee


DSSP  -----------lll
Query -----------plt  142
ident               
Sbjct eynketgwlepssy  245
DSSP  eelllllleeelll


No 67: Query=mol1A Sbjct=1mo4A Z-score=6.8

back to top
DSSP  --------------------------------------llllhhhHHHHHHHHHHLLLL-
Query --------------------------------------igrsewiNQYRRRLQQLSETD-   21
ident                                                    |        
Sbjct mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsIALDVALGIGGLPRg   60
DSSP  llllhhhhhhhhhhhhhhhhhhllllllllllllllllleellllHHHHLLLLLLLEELl


DSSP  LLEEEELLLLLLHHHHHHHHHHllLLLL--LLLEEEELL---------------------
Query IAVWLYGAPGTGRXTGARYLHQfgRNAQ--GEFVYRELT---------------------   58
ident      ||    |  | |             |                             
Sbjct RVIEIYGPESSGKTTVALHAVA--NAQAagGVAAFIDAEhaldpdyakklgvdtdsllvs  118
DSSP  LEEEEELLLLLLHHHHHHHHHH--HHHHllLLEEEEELLllllhhhhhhllllhhhleee


DSSP  -lLLLLL-HHHHHHH---hLLLLEEEELHHH----------------LLHHHHHHHHHHH
Query -pDNAPQ-LNDFIAL---aQGGTLVLSHPEH----------------LTREQQYHLVQLQ   97
ident   |   | |     |         |                      |            
Sbjct qpDTGEQaLEIADMLirsgALDIVVIDSVAAlvpraeleghvglqarLMSQALRKMTGAL  178
DSSP  llLLHHHhHHHHHHHhhllLLLEEEEELHHHlllllllllllllhhhHHHHHHHHHHHHH


DSSP  HLllLLLLEEEEELL--------lhHHHHhhLLLLhhHHHHHhHHEEELLL---------
Query SQehRPFRLIGIGDT--------slVELAasNHIIaeLYYCFaXTQIACLP---------  140
ident          | |              |          |                      
Sbjct NN--SGTTAIFINQLrdkigvmfgsPETT--TGGK-aLKFYA-SVRMDVRRvetlkdgtn  232
DSSP  HH--HLLEEEEEELLllllllllllLLLL--LLLL-hHHHHL-LEEEEEEEeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct avgnrtrvkvvknkclapfkqaefdilygkgisregslidmgvdqglirksgawftyege  292
DSSP  lleeeeeeeeeeellllllleeeeeeellleelhhhhhhhhhhlllleeeelleeeelll


DSSP  ------------------------------ll
Query ------------------------------lt  142
ident                                 
Sbjct qlgqgkenarnflvenadvadeiekkikeklg  324
DSSP  eeeelhhhhhhhhhhlhhhhhhhhhhhhhlll


No 68: Query=mol1A Sbjct=3e2iA Z-score=6.8

back to top
DSSP  llllhhhhhhhhhhhhhlllLLLEEEELLLLLLHHHHHHHHHHLLllLLLLLEEEELL--
Query igrsewinqyrrrlqqlsetDIAVWLYGAPGTGRXTGARYLHQFGrnAQGEFVYRELT--   58
ident                            |    |           |  |    |       
Sbjct -------------------sGWIECITGSXFSGKSEELIRRLRRGiyAKQKVVVFKPAsh   41
DSSP  -------------------lLEEEEEEELLLLLHHHHHHHHHHHHhhLLLLEEEEEELll


DSSP  ---------LLLLLLHHHHhHHHLLLLEEEELHHHLLHHHHHHHHHHHHlllLLLLEEEE
Query ---------PDNAPQLNDFiALAQGGTLVLSHPEHLTREQQYHLVQLQSqehRPFRLIGI  109
ident             |        |                |       |        | |  
Sbjct ngnaieainISKASEIXTH-DLTNVDVIGIDEVQFFDDEIVSIVEKLSA---DGHRVIVA   97
DSSP  llllleeeeELLHHHHHHL-LLLLLLEEEELLHHHLLLHHHHHHHHHHH---LLLEEEEE


DSSP  ELLlhhhhhHHLLLlhHHHHHHhHHEEELLL-----------------------------
Query GDTslvelaASNHIiaELYYCFaXTQIACLP-----------------------------  140
ident |                |                                          
Sbjct GLD-xdfrgEPFEPxpKLXAVS-EQVTKLQAvcavcgssssrtqrlingkpakiddpiil  155
DSSP  EEL-lllllLLLLLhhHHHHHL-LEEEEELEelllllleeleeeeeelleelllllllll


DSSP  ------------------ll
Query ------------------lt  142
ident                     
Sbjct vganesyeprcrahhivaps  175
DSSP  lllleeeeeelhhhllllll


No 69: Query=mol1A Sbjct=3b85A Z-score=6.7

back to top
DSSP  llllhhHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHllLLLL----LLLEEEE
Query igrsewINQYRRRLQQLSETDIAVWLYGAPGTGRXTGARYLHQfgRNAQ----GEFVYRE   56
ident                    |   |   |  | |    |          |           
Sbjct --virpKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAXAKAV--QALQskqvSRIILTR   56
DSSP  --llllLLHHHHHHHHHHHHLLEEEEELLLLLLLLHHHHHHHH--HHHHllllLEEEEEE


DSSP  LLL------------------------------------------lLLLLHHHhhHHHLL
Query LTP------------------------------------------dNAPQLNDfiALAQG   74
ident                                                             
Sbjct PAVeageklgflpgdpylrplhdalrdxvepevipklxeagivevaPLAYXRG--RTLND  114
DSSP  LLLlllllllllllllllhhhhhhhlllllllhhhhhhhllleeeeEHHHHLL--LLLLL


DSSP  LLEEEELHHHLLHHHHHHHHHHHhlllLLLLEEEEELllHHHHHhhllllhhhHHHHhhH
Query GTLVLSHPEHLTREQQYHLVQLQsqehRPFRLIGIGDtsLVELAasnhiiaelYYCFaxT  134
ident     |      |  |                    ||  |                    
Sbjct AFVILDEAQNTTPAQXKXFLTRL---gFGSKXVVTGD-gLRLVR----hilrgVDDV--H  164
DSSP  EEEEELLHHHLLHHHHHHHHLLL---lLLLEEEEEEL-lLHHHH----hhlllLLLE--E


DSSP  EEEL---LLLL------------
Query QIAC---LPLT------------  142
ident                        
Sbjct FSELtssDVVRhqlvghivdaye  187
DSSP  EEELlhhHLLLlhhhhhhhhhhl


No 70: Query=mol1A Sbjct=2ja1A Z-score=6.7

back to top
DSSP  llllhhhhhhhhhhhhhlllLLLEEEELLLLLLHHHHHHHHHHLLLlLLLLLEEEELLL-
Query igrsewinqyrrrlqqlsetDIAVWLYGAPGTGRXTGARYLHQFGRnAQGEFVYRELTP-   59
ident                            |    |              |            
Sbjct -----------gsmylinqnGWIEVICGSMFSGKSEELIRRVRRTQfAKQHAIVFKPCId   49
DSSP  -----------lllllllllLEEEEEEELLLLLHHHHHHHHHHHHHhLLLLEEEEEELLl


DSSP  ---------------------LLLLLHHHHHHhhLLLLEEEELHHHLLHhHHHHH-HHHH
Query ---------------------DNAPQLNDFIAlaQGGTLVLSHPEHLTReQQYHL-VQLQ   97
ident                               |                           | 
Sbjct nryseedvvshnglkvkavpvSASKDIFEHIT-eELDVIAIDEVQFFDG-DIVEVvQVLA  107
DSSP  lllllleeellllleeeleeeLLHHHHHHHLL-lLLLEEEELLHHHLLL-LHHHHhHHHH


DSSP  HlllLLLLEEEEELLlhhhhhHHLLLlhHHHHHHhHHEEELLL-----------------
Query SqehRPFRLIGIGDTslvelaASNHIiaELYYCFaXTQIACLP-----------------  140
ident     |  | |  |                |                              
Sbjct N---RGYRVIVAGLD-qdfrgLPFGQvpQLMAIA-EHVTKLQAvcsvcgspasrtqrlid  162
DSSP  H---LLLEEEEEEEL-lllllLLLLLhhHHHHHL-LEEEELLLlllllllllleeeeeel


DSSP  -----------------------------ll
Query -----------------------------lt  142
ident                                
Sbjct gepaafddpiilvgasesyeprcrhchavpa  193
DSSP  leellllllllllllleeeeeelllllllll


No 71: Query=mol1A Sbjct=2qe7D Z-score=6.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast   60
DSSP  leeeeeeeelleeeeelllllllllleeeeellllllleeeeeeeeeelleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel  120
DSSP  llllllleeeeeeeeleeelhhhhllleellllllllllllllllleeelllllllhhhl


DSSP  llllhhhhhhHHHHHH-HLLLL-LLEEEELLLLLLHHHHHHHHHHLLL-lLLLLLEEEEL
Query igrsewinqyRRRLQQ-LSETD-IAVWLYGAPGTGRXTGARYLHQFGR-nAQGEFVYREL   57
ident                            | |  | |       |         |  |    
Sbjct stadeiletgIKVIDLlAPYAKgGKIGLFGGAGVGKTVLIQELINNVAqeHGGLSVFAGV  180
DSSP  llllleelllLHHHHHhLLEELlLEEEEELLLLLLHHHHHHHHHHHHHhhLLLLEEEEEL


DSSP  L--------------------------------LLLLLLH-HHHHHHHL--------LLL
Query T--------------------------------PDNAPQL-NDFIALAQ--------GGT   76
ident                                  |             |            
Sbjct GertregndlyhemkdsgvisktsmvfgqmnepPGARLRVaLTGLTMAEyfrdregqDVL  240
DSSP  LllhhhhhhhhhhlllllhhhheeeeellllllHHHHHHHhHHHHHHHHhhhhllllLLL


DSSP  EEEELHHHLL-----------------------HHHHHHHHHHH-hLLLLLLLEEEEELl
Query LVLSHPEHLT-----------------------REQQYHLVQLQ-sQEHRPFRLIGIGDt  112
ident |        |                             |              |     
Sbjct LFIDNIFRFTqagsevsallgrmpsavgyqptlATEMGQLQERItsTKKGSITSIQAIY-  299
DSSP  LEEELHHHHHhhhhhhhhhlllllllllllllhHHHHHHHHLLLllLLLLLLLEEEELL-


DSSP  lhhHHHHhLLLLHHHHHHHhHHEEELL---------------------------------
Query slvELAAsNHIIAELYYCFaXTQIACL---------------------------------  139
ident             |                                               
Sbjct vpaDDYT-DPAPATTFAHL-DATTNLErklaemgiypavdplastsrilspavvgeehyr  357
DSSP  lllLLLL-LHHHHHHHLLL-LEEEELLhhhhllllllllllllleellllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct vargvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpg  417
DSSP  hhhhhhhhhhhhhhhhhhhhhhllllllllllhhhhhhhhhhhhlllllhhhllllllll


DSSP  -----------------------------------------lll
Query -----------------------------------------plt  142
ident                                             
Sbjct kyvpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl  461
DSSP  llllhhhhhhhhhhhhhlllllllhhhllllllhhhhhhlllll


No 72: Query=mol1A Sbjct=2g88A Z-score=6.5

back to top
DSSP  -----------------------------------llllhhhhhhHHHHHH----hLLLL
Query -----------------------------------igrsewinqyRRRLQQ----lSETD   21
ident                                                 |           
Sbjct maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgSISLDValgigGLPR   60
DSSP  llllllllhhhhhhhhhhhhhhhllllllllllllllllllllllLHHHHHhhlllLLLL


DSSP  -LLEEEELLLLLLHHHHHHHHHHLLLlLLLLLEEEEL----------------------L
Query -IAVWLYGAPGTGRXTGARYLHQFGRnAQGEFVYREL----------------------T   58
ident       ||    |  | |         | |                              
Sbjct gRVIEIYGPESSGKTTVALHAVANAQaAGGIAAFIDAehaldpeyakklgvdtdsllvsQ  120
DSSP  lLEEEEELLLLLLHHHHHHHHHHHHHhLLLEEEEELLlllllhhhhhlllllhhhleeeL


DSSP  LLLLLL-HHHHHHH---hLLLLEEEELHHHL---------------lHHHHHHHHHHHHL
Query PDNAPQ-LNDFIAL---aQGGTLVLSHPEHL---------------tREQQYHLVQLQSQ   99
ident ||   | |     |         |      |                             
Sbjct PDTGEQaLEIADMLvrsgALDIIVIDSVAALvpraeiegvglqarlmSQALRKMTGALNN  180
DSSP  LLLHHHhLHHHHHHhlllLEEEEEELLLLLLllllllllllhhhhhhHHHHHHHHHHHHL


DSSP  llLLLLEEEEELLlhhhhhhhLLLLHHHHHHHhHHEEELLL-------------------
Query ehRPFRLIGIGDTslvelaasNHIIAELYYCFaXTQIACLP-------------------  140
ident        | |                 |                                
Sbjct --SGTTAIFINQL-------rTTGGKALKFYA-SVRLDVRRietlkdgtdavgnrtrvkv  230
DSSP  --LLLEEEEEELL-------lLLLHHHHHHHL-LEEEEEEEeellllllllllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct vknkvsppfkqaefdilygqgisregslidmgvehgfirksgswftyegeqlgqgkenar  290
DSSP  eeelllllleeeeeeeellleelhhhhhhhhhhlllllllllllleelleellllhhhhh


DSSP  ---------------------------------------ll
Query ---------------------------------------lt  142
ident                                          
Sbjct kfllentdvaneiekkikeklgigavvtaeaddvlpapvdf  331
DSSP  hhhlllhhhhhhhhhhhhlllllllllllllllllllllll


No 73: Query=mol1A Sbjct=2is6A Z-score=6.5

back to top
DSSP  ---llllhhHHHHHHHHHHHllLLLLEEEELLLLLLHHHHHHHHHHLL---LLLLL-LLE
Query ---igrsewINQYRRRLQQLseTDIAVWLYGAPGTGRXTGARYLHQFG---RNAQG-EFV   53
ident           |   |                  | |                |       
Sbjct mdvsylldsLNDKQREAVAA--PRSNLLVLAGAGSGKTRVLVHRIAWLmsvENCSPySIM   58
DSSP  llhhhhhllLLHHHHHHHLL--LLLLEEEELLLLLLHHHHHHHHHHHHhhlLLLLHhHEE


DSSP  EEELLL-----------------------lLLLLH-------------------------
Query YRELTP-----------------------dNAPQL-------------------------   65
ident     |                             |                         
Sbjct AVTFTNkaaaemrhrigqlmgtsqggmwvgTFHGLahrllrahhmdanlpqdfqildsed  118
DSSP  EEELLHhhhhhhhhhhhhhhllllllleeeEHHHHhhhhhhhllllllllllleeelhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   65
ident                                                             
Sbjct qlrllkrlikamnldekqwpprqamwyinsqkdeglrphhiqsygnpveqtwqkvyqayq  178
DSSP  hhhhhhhhhhhlllllllllhhhhhhhhhhhhhlllllllllllllhhhhhhhhhhhhhh


DSSP  -----------------------------hhhhHHHLllLEEEELHhHLLHHHHHHHHHH
Query -----------------------------ndfiALAQggTLVLSHPeHLTREQQYHLVQL   96
ident                                                     |      |
Sbjct eacdraglvdfaelllrahelwlnkphilqhyrERFT--NILVDEFqDTNNIQYAWIRLL  236
DSSP  hhhhhhleeehhhhhhhhhhhhhhlhhhhhhhhHHLL--EEEELLHhHLLHHHHHHHHHH


DSSP  HHlllLLLLEEEEELL---lhhhhhhHLLLlHHHHHHH-hHHEEELLLLL----------
Query QSqehRPFRLIGIGDT---slvelaaSNHIiAELYYCF-aXTQIACLPLT----------  142
ident              ||                      |     |                
Sbjct AG---DTGKVMIVGDDdqsiygwrgaQVENiQRFLNDFpgAETIRLEQNYrstsnilsaa  293
DSSP  HL---LLLEEEEEELHhhlllhhhllLLHHhHHHHHHLllLEEEELLLLLlllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct naliennngrlgkklwtdgadgepislycafneldearfvvnriktwqdnggalaecail  353
DSSP  hhhhhllllllllllllllllllleeeeeeeehhhhhhhhhhhhhhhhhllllhhheeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct yrsnaqsrvleeallqasmpyriyggmrfferqeikdalsylrlivnrnddaafervvnt  413
DSSP  ellhhhhhhhhhhhhhlllleeelllllhhhlhhhhhhhhhhhhhhllllhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct ptrgigdrtldvvrqtsrdrqltlwqacrellqekalagraasalqrfmelidalaqeta  473
DSSP  llllllhhhhhhhhhhhhhhlllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct dmplhvqtdrvikdsglrtmyeqekgekgqtrienleelvtatrqfsyneedlmplqafl  533
DSSP  lllhhhhhhhhhhhllhhhhhhllllhhhhhhhhhhhhhhhhhhhlllllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct shaaleagegqadtwqdavqlmtlhsakglefpqvfivgmeegmfpsqmsldeggrleee  593
DSSP  hhhhhlhhhllllllllleeeeehhhhlllleeeeeellllllllllhhhhlllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct rrlayvgvtramqkltltyaetrrlygkevyhrpsrfigelpeecveevrlratvsrpvs  653
DSSP  hhhhhhhhlleeeeeeeeeeeeeeelleeelllllhhhhhllhhheeellllllllllll


DSSP  -
Query -  142
ident  
Sbjct h  654
DSSP  l


No 74: Query=mol1A Sbjct=1xx6A Z-score=6.5

back to top
DSSP  llllhhhhhhhhhhhhhllllLLEEEELLLLLLHHHHHHHHHHLLLLLLLLLEEEELL--
Query igrsewinqyrrrlqqlsetdIAVWLYGAPGTGRXTGARYLHQFGRNAQGEFVYRELT--   58
ident                            |    |              |            
Sbjct --------------yrpkdhgWVEVIVGPXYSGKSEELIRRIRRAKIAKQKIQVFKPEed   46
DSSP  --------------lllllllEEEEEELLLLLLHHHHHHHHHHHHHHLLLLEEEEEELle


DSSP  -------------lLLLLLHHHHHHHhLLLLEEEELH-HHLLHhHHHHHHHHHHlllLLL
Query -------------pDNAPQLNDFIALaQGGTLVLSHP-EHLTReQQYHLVQLQSqehRPF  104
ident                |                                            
Sbjct vvshxgekeqavaiKNSREILKYFEE-DTEVIAIDEVqFFDDE-IVEIVNKIAE---SGR  101
DSSP  eellllleeeleeeLLLLHHHHHLLL-LLLEEEELLHhHLLLH-HHHHHHHHHH---LLL


DSSP  LEEEEELLlhhhhhHHLLLlhhhHHHHhHHEEELLL------------------------
Query RLIGIGDTslvelaASNHIiaelYYCFaXTQIACLP------------------------  140
ident | |  |                                                      
Sbjct RVICAGLD-xdfrgKPFGPipelXAIA-EFVDKIQAicvvcgnpatrtqrlingkpafyd  159
DSSP  EEEEEELL-lllllLLLLLhhhhHHHL-LEEEELLEelllllleeleeeeeelleellll


DSSP  -----------------ll
Query -----------------lt  142
ident                    
Sbjct dpvxesyearcrkchvvpq  178
DSSP  lllleeeeeelllllllll


No 75: Query=mol1A Sbjct=1xmrB Z-score=6.5

back to top
DSSP  llllhhhhhhhhhhhhhllllLLEEEELLLLLLHHHHHHHHHHLLLllLLLLEEEELLL-
Query igrsewinqyrrrlqqlsetdIAVWLYGAPGTGRXTGARYLHQFGRnaQGEFVYRELTP-   59
ident                            |    |                           
Sbjct -------------------igWIEFITGPMFAGKTAELIRRLHRLEyaDVKYLVFKPKId   41
DSSP  -------------------llEEEEEELLLLLLHHHHHHHHHHHHHllLLLEEEEEELLl


DSSP  -----------------lLLLL---HHHHHH----hhlLLLEEEELHHHLLHhHHHHH-H
Query -----------------dNAPQ---LNDFIA----laqGGTLVLSHPEHLTReQQYHL-V   94
ident                              |                              
Sbjct trsirniqsrtgtslpsvEVESapeILNYIMsnsfndeTKVIGIDEVQFFDD-RICEVaN  100
DSSP  llllleeellllleeeleEELLlhhHHHHHHlllllllLLEEEELLHHHLLL-HHHHHhH


DSSP  HHHHlllLLLLEEEEELLlhhhhhHHLLLlhHHHHHHhHHEEELLL--------------
Query QLQSqehRPFRLIGIGDTslvelaASNHIiaELYYCFaXTQIACLP--------------  140
ident  |       |  |  |                |                           
Sbjct ILAE---NGFVVIISGLD-knfkgEPFGPiaKLFTYA-DKITKLTAicnecgaeathslr  155
DSSP  HHHH---LLLEEEEELLL-lllllLLLLLhhHHHHHL-LEEEELLEelllllleeleeee


DSSP  --------------------------------------------------ll
Query --------------------------------------------------lt  142
ident                                                     
Sbjct kidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnseefikffknk  207
DSSP  eelleellllllllllllllleeeellllllllllllllllhhhhhhhhhll


No 76: Query=mol1A Sbjct=2ewvA Z-score=6.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct elkileiikeaielgasdihltagappavridgyikflkdfprltpedtqklaysvmsek   60
DSSP  lllhhhhhhhhhhhllleeeelllllleeeelleeeellllllllllllhhhhhllllll


DSSP  --------------------------------------------llllHHHHhHHHHHHH
Query --------------------------------------------igrsEWINqYRRRLQQ   16
ident                                                             
Sbjct hrqkleengqvdfsfgvrgvgrfranvfyqrgsvaaalrslpaeipefKKLG-LPDKVLE  119
DSSP  lllhhhhlleeeeeeellllleeeeeeellllllleeelllllllllhHHHL-LLLLHHH


DSSP  HLLLL-LLEEEELLLLLLHHHHHHHHHHLLL-lLLLLLEEEEL-----------------
Query LSETD-IAVWLYGAPGTGRXTGARYLHQFGR-nAQGEFVYREL-----------------   57
ident |           |  | |  |                    |                  
Sbjct LCHRKmGLILVTGPTGSGKSTTIASMIDYINqtKSYHIITIEDpieyvfkhkksivnqre  179
DSSP  HLLLLlEEEEEELLLLLLHHHHHHHHHHHHHhhLLLEEEEEELllllllllllleeeeee


DSSP  ---llLLLLLH-HHHHHHHLlLLEEEELHHHLLhhhhhHHHHHHHlllLLLLEEEEELL-
Query ---tpDNAPQL-NDFIALAQgGTLVLSHPEHLTreqqyHLVQLQSqehRPFRLIGIGDT-  112
ident                                |                      |   | 
Sbjct vgedtKSFADAlRAALREDP-DVIFVGEMRDLE--tveTALRAAE---TGHLVFGTLHTn  233
DSSP  lllllLLLHHHhHHHLLLLL-LEEEELLLLLHH--hhhHHHHHHL---LLLEEEELLLLl


DSSP  ---lHHHHHHHLL-------lLHHHHHHHhHHEEELLL----------------------
Query ---sLVELAASNH-------iIAELYYCFaXTQIACLP----------------------  140
ident                         |        |                          
Sbjct taidTIHRIVDIFplnqqeqvRIVLSFIL-QGIISQRLlpkigggrvlayellipntair  292
DSSP  lhhhHHHHHHHLLllllhhhhHHHHHHLL-LEEEEEEEeellllleeeeeeelllllhhh


DSSP  -------------------------------------------------ll
Query -------------------------------------------------lt  142
ident                                                    
Sbjct nlirenklqqvyslmqmqtmnqtlyklykqglitledameaspdpkelerm  343
DSSP  hhhhhllhhhhhhhllllllhhhhhhlllllllllllllllllllllllll


No 77: Query=mol1A Sbjct=3kx2A Z-score=6.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mgskrrfssehpdpvetsipeqaaeiaeelskqhplpseeplvhhdagefkglqrhhtsa   60
DSSP  llllllllllllllllllhhhhhhhhhhhhhllllllllllllllllllllllllllllh


DSSP  ----------------------------llllhhhHHHHHHHHHHLLLLLLEEEELLLLL
Query ----------------------------igrsewiNQYRRRLQQLSETDIAVWLYGAPGT   32
ident                                       |     |          |  | 
Sbjct eeaqkledgkinpftgreftpkyvdilkirrelpvHAQRDEFLKLYQNNQIMVFVGETGS  120
DSSP  hhhhhhhhllllllllllllhhhhhhhhhhlllhhHHHHHHHHHHHHHLLEEEEELLLLL


DSSP  LHH-HHHHHhHHLLLLLL---LLLEEEELLL-----------------------------
Query GRX-TGARYlHQFGRNAQ---GEFVYRELTP-----------------------------   59
ident |           |                                               
Sbjct GKTtQIPQF-VLFDEMPHlenTQVACTQPRRvaamsvaqrvaeemdvklgeevgysirfe  179
DSSP  LHHhHHHHH-HHHHHLHHhhlLEEEEEELLHhhhhhhhhhhhhhlllllllleeeeelle


DSSP  -----------lLLLL-HHHH-----HHHHllLLEEEELH--HHLL-HHHHHHHHHHHHL
Query -----------dNAPQ-LNDF-----IALAqgGTLVLSHP--EHLT-REQQYHLVQLQSQ   99
ident                  |                  |       |        | |    
Sbjct nktsnktilkymTDGMlLREAmedhdLSRY--SCIILDEAheRTLAtDILMGLLKQVVKR  237
DSSP  eelllllleeeeEHHHhHHHHhhlllLLLE--EEEEELLHhhLLHHhHHHHHHHHHHHHH


DSSP  lLLLLLEEEEELL-LHHHhhhhllllhhhHHHHHHHEEELL-------------------
Query eHRPFRLIGIGDT-SLVElaasnhiiaelYYCFAXTQIACL-------------------  139
ident        |    |                 |       |                     
Sbjct -RPDLKIIIMSATlDAEK---------fqRYFNDAPLLAVPgrtypvelyytpefqrdyl  287
DSSP  -LLLLEEEEEELLlLLHH---------hhHHLLLLLEEELLllllleeeeelllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct dsairtvlqihateeagdillfltgedeiedavrkislegdqlvreegcgplsvyplygs  347
DSSP  hhhhhhhhhhhhhlllleeeeelllhhhhhhhhhhhhhhhhhhhhhhlllleeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct lpphqqqrifepapeshngrpgrkvvistniaetsltidgivyvvdpgfskqkvynprir  407
DSSP  llhhhhhhhhlllllllllllleeeeeellhhhhlllllleeeeeelleeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct vesllvspiskasaqqragragrtrpgkcfrlyteeafqkelieqsypeilrsnlsstvl  467
DSSP  eeeeeeeellhhhhhhhhhhhhlllleeeeelllhhhhhhllllllllhhhhlllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct elkklgiddlvhfdfmdppapetmmraleelnylaclddegnltplgrlasqfpldpmla  527
DSSP  hhhhllllllllllllllllhhhhhhhhhhhhhlllllllllllhhhhhhllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct vmligsfefqcsqeiltivamlsvpnvfirptkdkkraddaknifahpdgdhitllnvyh  587
DSSP  hhhhhhhhhllhhhhhhhhhhhllllllllllllhhhhhhhhhlllllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct afksdeayeygihkwcrdhylnyrslsaadnirsqlerlmnrynlelnttdyespkyfdn  647
DSSP  hhllhhhhhhlhhhhhhhllllhhhhhhhhhhhhhhhhhhhhllllllllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct irkalasgffmqvakkrsgakgyitvkdnqdvlihpstvlghdaewviynefvltsknyi  707
DSSP  hhhhhhhhhllleeeelllllleeellllleeeellllllllllleeeeeeeeellleee


DSSP  ---------------------------------------------lll
Query ---------------------------------------------plt  142
ident                                                 
Sbjct rtvtsvrpewlieiapayydlsnfqkgdvklslerikekvdrlnelkq  755
DSSP  eeeeellhhhhhhhllllllhhhllllllhhhhhhhhhhhhhhhhhhl


No 78: Query=mol1A Sbjct=1tueD Z-score=6.4

back to top
DSSP  ---------------llllHHHHHHHH-------hhhhHLLLL-------LLEEEELLLL
Query ---------------igrsEWINQYRR-------rlqqLSETD-------IAVWLYGAPG   31
ident                      | |  |                             |   
Sbjct nmsqwirfrcskideggdwRPIVQFLRyqqiefitflgALKSFlkgtpkkNCLVFCGPAN   60
DSSP  lhhhhhhhhhhllllllllHHHHHHHHhllllhhhhhhHHHHHhllllllLEEEEELLHH


DSSP  LLHHHHHHHHHHLLllllllLEEEELlllLLLLhHHHHHHHL-LLLEEEE-LHHHLlhhh
Query TGRXTGARYLHQFGrnaqgeFVYRELtpdNAPQlNDFIALAQ-GGTLVLS-HPEHLtreq   89
ident ||          |                                   |           
Sbjct TGKSYFGMSFIHFI-----qGAVISF---VNSTsHFWLEPLTdTKVAMLDdATTTCwtyf  112
DSSP  HLHHHHHHHHHHHH-----lLEELLL---LLLLlHHHHHHHLlLLLEEEEeELHHHhhhh


DSSP  hHHHHHHHHL-------------llLLLLEEEEELLLHHhhHHHLllLHHHHHHHhhHEE
Query qYHLVQLQSQ-------------ehRPFRLIGIGDTSLVelAASNhiIAELYYCFaxTQI  136
ident                                                   |      |  
Sbjct dTYMRNALDGnpisidrkhkpliqlKCPPILLTTNIHPA--KDNR--WPYLESRI--TVF  166
DSSP  hHHLHHHHLLlleeellllllleeeLLLLEEEEELLLLL--LLLL--LHHHHLLL--EEE


DSSP  EL-LLLL-----------------------------
Query AC-LPLT-----------------------------  142
ident                                     
Sbjct EFpNAFPfdkngnpvyeindknwkcffertwsrldl  202
DSSP  ELlLLLLllllllllllllhhhhhhhhhhhhhhhll


No 79: Query=mol1A Sbjct=3cmvA Z-score=6.4

back to top
DSSP  llllhhhhhhHHHHHH---hlLLLL--LEEEELLLLLLHHHHHHHHHHLLLllLLLLEEE
Query igrsewinqyRRRLQQ---lsETDI--AVWLYGAPGTGRXTGARYLHQFGRnaQGEFVYR   55
ident              |              |  ||    |  |                   
Sbjct ---vetistgSLSLDIalgagGLPMgrIVEIYGPESSGKTTLTLQVIAAAQreGKTCAFI   57
DSSP  ---lleelllLHHHHHhhlllLEELllEEEEELLLLLLHHHHHHHHHHHHHllLLLEEEE


DSSP  EL----------------------llLLLLL-HHHHHHH---hLLLLEEEELH-------
Query EL----------------------tpDNAPQ-LNDFIAL---aQGGTLVLSHP-------   82
ident                           |   | |    ||         |           
Sbjct DAehaldpiyarklgvdidnllcsqpDTGEQaLEICDALarsgAVDVIVVDSVaaltpka  117
DSSP  ELlllllhhhhhhhlllhhheeeellLLHHHhHHHHHHHhhllLLLEEEEELHhhlllhh


DSSP  --------------hhLLHHHHHHHHHHHHLllLLLLEEEEELllhhhhhhhLLLLhhHH
Query --------------ehLTREQQYHLVQLQSQehRPFRLIGIGDtslvelaasNHIIaeLY  128
ident                         |     |      || |                 | 
Sbjct eiegeigdshmglaarMMSQAMRKLAGNLKQ--SNTLLIFINQ---------GGNA--LK  164
DSSP  hhlllllllllllhhhHHHHLLHHHHHLLLL--LLLEEEEEEL---------LLLL--HH


DSSP  HHHhHHEEELLL------------------------------------------------
Query YCFaXTQIACLP------------------------------------------------  140
ident                                                             
Sbjct FYA-SVRLDIRRigavkegenvvgsetrvkvvknkiaapfkqaefqilygeginfygelv  223
DSSP  HHE-EEEEEEEEllllllllllllleeeeeeeeellllllleeeeeeellleelhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct dlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelllkqkalaa  283
DSSP  hhhhhlllleeelleeeelleeeeehhhhhhhhhlllhhhhhhhhhhhhlllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct algqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiygpessgk  343
DSSP  hhhhhhhhlllllleelllllllllleellllhhhhhhhlllleellleeeeellllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqaleicdal  403
DSSP  hhhhhhhhhhhhlllllleeeellllllhhhhhhhlllhhhleeellllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct arsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnlkqsntllifi  463
DSSP  hlllllleeeeelhhhlllhhhhhllllllllllllhhhhhhhhhhhhhhhlllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct nqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgsetrvkvvknkia  523
DSSP  elllllllllllllllllllllhhhhlleeeeelllllleelleeleeeeeeeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct apfkqaefqilygeginfygelvdlgvkekliekagawysykgekigqgkanatawlkdn  583
DSSP  lllleeeeeeellleelhhhhhhhhhhhlllleeelleeeelleeeeehhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct petakeiekkvrelllkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldi  643
DSSP  hhhhhhhhhhhhhhlllhhhhhhhhhhhhhhlllllleelllllllllleellllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct algagglpmgriveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgv  703
DSSP  hhlllleellleeeeellllllhhhhhhhhhhhhhllllleeeeellllllhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct didnllcsqpdtgeqaleicdalarsgavdvivvdsvaaltpkaeiglaarmmsqamrkl  763
DSSP  lhhhleeellllhhhhhhhhhhhhlllllleeeeelhhhlllllllllllhhhhhlhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct agnlkqsntllifinqggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaap  823
DSSP  hhhlllllleeeeeelllllhhhheeeeeeeeellleelllleeeeeeeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct fkqaefqilygeginfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpe  883
DSSP  lleeeeeeellleelhhhhhhhhhhhlllleeelleeeelleeeeelhhhhhhhhlllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct takeiekkvrelllkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldial  943
DSSP  hhhhhhhhhhhhhlllllhhhhhhhhhhhlllllleelllllllllleellllllhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gagglpmgriveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdi 1003
DSSP  lllleellleeeeellllllhhhhhhhhhhhhhllllleeeelllllllhhhhhhhlllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct dnllcsqpdtgeqaleicdalarsgavdvivvdsvaaltplaarmmsqamrklagnlkqs 1063
DSSP  hhllllllllhhhhhhhhhhhhlllllleeeellhhhllllllllhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ntllifinqggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefq 1123
DSSP  lleeeeeelllllhhhhlleeeeeeellllllllllleeeeeeeeeeellllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ilygeginfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiek 1183
DSSP  eellleelhhhhhhhhhhhlllleeelleeeelleeeeehhhhhhhhhlllhhhhhhhhh


DSSP  -----ll
Query -----lt  142
ident        
Sbjct kvrelll 1190
DSSP  hhhhhhl


No 80: Query=mol1A Sbjct=2j87D Z-score=6.4

back to top
DSSP  llllhhhhhhhhhhhhhllllLLEEEELLLLLLHHHHHHHHHHlLLLL-LLLLEEEELL-
Query igrsewinqyrrrlqqlsetdIAVWLYGAPGTGRXTGARYLHQfGRNA-QGEFVYRELT-   58
ident                            |    |  |             |   |      
Sbjct --------------------gHIQLIIGPMFSGKSTELIRRVR-RYQIaQYKCVTIKYSn   39
DSSP  --------------------lEEEEEELLLLLLHHHHHHHHHH-HHHLlLLLEEEEELLl


DSSP  ------------------LLLLLLHHHHHHHHllLLEEEELHHHLLhhhHHHHHHHHHll
Query ------------------PDNAPQLNDFIALAqgGTLVLSHPEHLTreqQYHLVQLQSqe  100
ident                             |                               
Sbjct dnrygtwthdknnfealeATKLCDVLQSITDF--SVIGIDEGQFFP-diVEFCERMAN--   94
DSSP  llllllllllllllllllLLLHHHHLLLHHHL--LEEEEELHHHLL-lhHHHHHHHHH--


DSSP  lLLLLEEEEELLlhhhhhHHLLLlhHHHHHHhHHEEELLL--------------------
Query hRPFRLIGIGDTslvelaASNHIiaELYYCFaXTQIACLP--------------------  140
ident       |                   |                                 
Sbjct -EGKIVIVAALD-gtfqrKPFNNilNLLILS-EMVVKLTAvcmkcfkeasfskrlgeete  151
DSSP  -LLLEEEEELLL-lllllLLLLLlhHHHHLL-LEEEELLEelllllleeleeeellllll


DSSP  ------------------ll
Query ------------------lt  142
ident                     
Sbjct ieiiggndmyqsvcrkcyvg  171
DSSP  llllllllleeeelhhhhll


No 81: Query=mol1A Sbjct=2r2aA Z-score=6.3

back to top
DSSP  llllhhhhhhhhhhhhhllLLLLEEEELLLLLLHHHHHHHHHHLLLLL-------LLLLE
Query igrsewinqyrrrlqqlseTDIAVWLYGAPGTGRXTGARYLHQFGRNA-------QGEFV   53
ident                            | || |                           
Sbjct -------------------XAEICLITGTPGSGKTLKXVSXXANDEXFkpdengiRRKVF   41
DSSP  -------------------LLLEEEEELLLLLLHHHHHHHHHHHLHHHlllllllLLLEE


DSSP  EE-----------eLLLL----------LLLLH-HHHHH-hhLLLLEEEELHHHL-----
Query YR-----------eLTPD----------NAPQL-NDFIA-laQGGTLVLSHPEHL-----   85
ident                              |             |                
Sbjct TNikglkiphtyieTDAKklpkstdeqlSAHDXyEWIKKpenIGSIVIVDEAQDVwpars  101
DSSP  ELlllllllleeeeLLLLllllllllleEHHHHhHHLLLhhhLLLEEEELLHHHLlllll


DSSP  ----lHHHHHHhHHHHHLllLLLLEEEEELLlhHHHHhhlllLHHHHHHHhHHEEELL--
Query ----tREQQYHlVQLQSQehRPFRLIGIGDTslVELAasnhiIAELYYCFaXTQIACL--  139
ident       |                            |         |              
Sbjct agskiPENVQW-LNTHRH--QGIDIFVLTQG--PKLL-----DQNLRTLV-RKHYHIAsn  150
DSSP  lllllLHHHHH-HHHLLL--LLLEEEEEELL--HHHL-----LHHHHLLE-EEEEEEEel


DSSP  --------------------------------------lll
Query --------------------------------------plt  142
ident                                          
Sbjct kxgxrtllewkicaddpvkxassafssiytldkkvydlyes  191
DSSP  lllleeeeeellllllllllhhhleeeellllllhhhllll


No 82: Query=mol1A Sbjct=2awnA Z-score=6.3

back to top
DSSP  ------------LLLLhhHHHHhhhhhHHLLLL-LLEEEELLLLLLHHHHHHHHHH----
Query ------------IGRSewINQYrrrlqQLSETD-IAVWLYGAPGTGRXTGARYLHQ----   43
ident                             |       |   |  | |  |  |        
Sbjct asvqlqnvtkawGEVV-vSKDI-----NLDIHEgEFVVFVGPSGCGKSTLLRMIAGleti   54
DSSP  lleeeeeeeeeeLLEE-eEEEE-----EEEELLlLEEEEELLLLLLHHHHHHHHHLllll


DSSP  ---lLLLL----------LLLLEEEELLLL------------lllLHHHHHHHHLlLLEE
Query ---fGRNA----------QGEFVYRELTPD------------napQLNDFIALAQgGTLV   78
ident                                                             
Sbjct tsgdLFIGekrmndtppaERGVGMVFQSYAlevinqrvnqvaevlAIGRTLVAEP-SVFL  113
DSSP  leeeEEELllllllllhhHLLEEEELLLLLllhhhhhhhhhhhhlLHHHHHHLLL-LEEE


DSSP  EELHH---------hLLHHHHHHHHHHHhlllllLLEEEEELLLHhhhhhhllllhhhHH
Query LSHPE---------hLTREQQYHLVQLQsqehrpFRLIGIGDTSLvelaasnhiiaelYY  129
ident |  |              |       |          |                      
Sbjct LDEPLsnldaalrvqMRIEISRLHKRLG------RTMIYVTHDQV-----------eaMT  156
DSSP  EELLLllllhhhhhhHHHHHHHHHHHLL------LEEEEEELLHH-----------hhHH


DSSP  HHhHHEEELLLL------------------------------------------------
Query CFaXTQIACLPL------------------------------------------------  141
ident                                                             
Sbjct LA-DKIVVLDAGrvaqvgkplelyhypadrfvagfigspkmnflpvkvtataidqvqvel  215
DSSP  HL-LEEEEEELLeeeeeelhhhhhhllllhhhhhhlllllleeeeeeeeellllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct pmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvilegevqvveqlgnetqihi  275
DSSP  lllllleeeellllllllllleeeeeelhhhllllllllleeeeeeeeeeellleeeeee


DSSP  ------------------------------------------------------l
Query ------------------------------------------------------t  142
ident                                                        
Sbjct qipsirqnlvyrqndvvlveegatfaiglpperchlfredgtacrrlhkepgvas  330
DSSP  ellllllleeeeeellllllllleeeeellhhhleeellllllllllllllllll


No 83: Query=mol1A Sbjct=2iutA Z-score=6.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lpplslldpaevkqksyspesleamsrlleiklkefgvevsvdsvhpgpvitrfeiqpaa   60
DSSP  lllhhhllllllllllllhhhhhhhhhhhhhhhhhlllllleeeeeellleeeeeellll


DSSP  ------------------------------------LLLL-------------------h
Query ------------------------------------IGRS-------------------e    5
ident                                     |                       
Sbjct gvkvsrisnlakdlarslavisvrvvevipgkttvgIEIPnedrqmvrfsevlsspeyde  120
DSSP  lllhhhhhhlhhhhhhhhllllleeelllllllleeEEEEllllllllhhhhhllhhhhl


DSSP  hhhhhhhHHHH-------hLLLL--LLEEEELLLLLLHHHHHHHHHHLL----lllLLLL
Query winqyrrRLQQ-------lSETD--IAVWLYGAPGTGRXTGARYLHQFG----rnaQGEF   52
ident         |                      |  | |   |                   
Sbjct hkstvplALGHdiggrpiiTDLAkmPHLLVAGTTGSGKSVGVNAMLLSIlfkstpsEARL  180
DSSP  llllleeEEEEelllleeeEEHHhlLLEEEELLLLLLHHHHHHHHHHHHhllllllLEEE


DSSP  EEEELL-----------------llLLLLHHHHHHH------------------------
Query VYRELT-----------------pdNAPQLNDFIAL------------------------   71
ident                                                             
Sbjct IMIDPKmlelsiyegiphllcpvvtDMKEAANALRWsvaemerryrlmaamgvrnlagfn  240
DSSP  EEELLLlhhhhllllllllllllllLHHHHHHHHHHhhhhhhhhhhhhhhhllllhhhhh


DSSP  --------------------------------hlLLLEEEELHHHL----LHHHHHHHHH
Query --------------------------------aqGGTLVLSHPEHL----TREQQYHLVQ   95
ident                                       |                     
Sbjct rkvkdaeeagtpltdplfrrespddeppqlstlpTIVVVVDEFADMmmivGKKVEELIAR  300
DSSP  hhhhhhhhllllllllllllllllllllllllllEEEEEELLLLLHhhhlLHHHHHHHHH


DSSP  HHHL-lLLLLLEEEEELLlhhHHHHhllLLHHHHHHHhHHEEEL----------------
Query LQSQ-eHRPFRLIGIGDTslvELAAsnhIIAELYYCFaXTQIAC----------------  138
ident            ||               |          | ||                 
Sbjct IAQKarAAGIHLILATQR---PSVD--vITGLIKANI-PTRIAFqvsskidsrtildqgg  354
DSSP  HHHHllLLLEEEEEEELL---LLLL--lLLHHHHHLL-LEEEEEllllhhhhhhhhllll


DSSP  -----LLLL---------------------------------------------
Query -----LPLT---------------------------------------------  142
ident                                                       
Sbjct aeqllGHGDmlylppgtglpirvhgafvsddevhrvveawklrgapdyiedila  408
DSSP  hhhllLLLEeeeellllllleeeeellllhhhhhhhhhhhhlllllllllllll


No 84: Query=mol1A Sbjct=1q57A Z-score=6.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mtynvwnfgesngrysaltargisketcqkagywiakvdgvmyqvadyrdqngnivsqkv   60
DSSP  llllllllllllllllllllllllhhhhhhhleeellllllleeeeeeellllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct rdkdknfkttgshksdalfgkhlwnggkkivvtegeidmltvmelqdckypvvslghgas  120
DSSP  eellleeeeeelllllleelhhhllleeeeeeellhhhhhhhllllllllleeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aakktcaanyeyfdqfeqiilmfdmdeagrkaveeaaqvlpagkvrvavlpckdanechl  180
DSSP  lhhhhhhllhhhhhleeeeeeellllhhhhhhhhhhhhhllhhheeelllllllhhhhhl


DSSP  ---------------------------------------llllhhhhhHHHHHHhHLLLL
Query ---------------------------------------igrsewinqYRRRLQqLSETD   21
ident                                                             
Sbjct nghdreimeqvwnagpwipdgvvsalslrerirehlsseesvgllfsgCTGINDkTLGAR  240
DSSP  lllhhhhhhhhlllllllllleeehhhhhhhhhhhhhhllllllllllLLLHHHhHLLLL


DSSP  --LLEEEELLLLLLHHHHHHHHHHLL-lllLLLLEEEELL--------------------
Query --IAVWLYGAPGTGRXTGARYLHQFG-rnaQGEFVYRELT--------------------   58
ident            |    |  |                  |                     
Sbjct ggEVIMVTSGSGMVMSTFVRQQALQWgtamGKKVGLAMLEesveetaedliglhnrvrlr  300
DSSP  llLEEEEEELLLHHHHHHHHHHHHHHllllLLLEEEEELLllhhhhhhhhhhhhllllll


DSSP  --------------------------------lLLLLLH-HHHHHHH---LLLLEEEELH
Query --------------------------------pDNAPQL-NDFIALA---QGGTLVLSHP   82
ident                                       |                 | | 
Sbjct qsdslkreiiengkfdqwfdelfgndtfhlydsFETDRLlAKLAYMRsglGCDVIILDHI  360
DSSP  llhhhhhhhhhllhhhhhhhhhhlllleeeellLLHHHHhHHHHHHHhllLLLEEEEELL


DSSP  HHL------------LHHHHHHHHHHHHLllLLLLEEEEELL---------------lhH
Query EHL------------TREQQYHLVQLQSQehRPFRLIGIGDT---------------slV  115
ident                       |            |  |                     
Sbjct SIVvsasgesderkmIDNLMTKLKGFAKS--TGVVLVVICHLknpdkgkaheegrpvsiT  418
DSSP  LLLllllllllhhhhHHHHHHHHHHHHHH--HLLEEEEEEELlllllllllllllllllL


DSSP  HHHhhllLLHHHHHHHhHHEEELL------------------------------------
Query ELAasnhIIAELYYCFaXTQIACL------------------------------------  139
ident  |         |      | ||                                      
Sbjct DLR----GSGALRQLS-DTIIALErnqqgdmpnlvlvrilkcrftgdtgiagymeynket  473
DSSP  LLL----LLLHHHHHL-LEEEEEEelllllllleeeeeeeeelllllleeeeeeeellll


DSSP  -------lll
Query -------plt  142
ident           
Sbjct gwlepssysg  483
DSSP  lleeeellll


No 85: Query=mol1A Sbjct=1z6tB Z-score=6.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi   60
DSSP  llhhhhhhhhhhhhhhhhhlllhhhhhhhhhhllllhhhhhhhhllllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkkdndsyvsfynallhegykdlaallhdgipvvssssgkdsvsgitsyvrtvlceggvp  120
DSSP  llllhhhhhhhhhhhhhlllhhhhhhhhllllhhhlllhhhhhhlllhhhhhhhhhhlll


DSSP  --llllhhHHHHHHHHHHHLLLL----LLEEEELLLLLLHHHHHHHHHHL-----lLLLL
Query --igrsewINQYRRRLQQLSETD----IAVWLYGAPGTGRXTGARYLHQF-----gRNAQ   49
ident                 ||           |   |  | |    |                
Sbjct qrpvvfvtRKKLVNAIQQKLSKLkgepGWVTIHGMAGCGKSVLAAEAVRDhsllegCFPG  180
DSSP  llllllllLHHHHHHHHHHHLLLllllEEEEEELLLLLLHHHHHHHHLLLhhhhhhHLLL


DSSP  LlLEEE--ELLLL-LLLL-HHHHHHH-----------------------------hlLLL
Query GeFVYR--ELTPD-NAPQ-LNDFIAL-----------------------------aqGGT   76
ident |                  |                                        
Sbjct G-VHWVsvGKQDKsGLLMkLQNLCTRldqdesfsqrlplnieeakdrlrilmlrkhpRSL  239
DSSP  L-EEEEelLLLLHhHHHHhHHHHHHHhlllllllllllllhhhhhhhhhhhhhhlllLLE


DSSP  EEE--ELHHHLlhhhHHHHHHHHhllllllLEEEEELLLHhhhhhhllllHHHHHHhhHH
Query LVL--SHPEHLtreqQYHLVQLQsqehrpfRLIGIGDTSLvelaasnhiiAELYYCfaXT  134
ident | |                                                         
Sbjct LILddVWDSWV----LKAFDSQC-------QILLTTRDKS--------vtDSVMGP--KY  278
DSSP  EEEelLLLHHH----HHLLLLLL-------EEEEEELLHH--------hhLLLLLL--EE


DSSP  EEELLLLL----------------------------------------------------
Query QIACLPLT----------------------------------------------------  142
ident                                                             
Sbjct VVPVESSLgkekgleilslfvnmkkadlpeqahsiikeckgsplvvsligallrdfpnrw  338
DSSP  EEELLLLLlhhhhhhhhhhhhlllhhhlllhhhhhhhhhlllhhhhhhhhhhhhhllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct eyylkqlqnkqfkrirksssydyealdeamsisvemlredikdyytdlsilqkdvkvptk  398
DSSP  hhhhhhhhlllllllllllllllhhhhhhhhhhhhlllhhhhhhhhhhhhlllllleehh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct vlcilwdmeteevedilqefvnksllfcdrngksfryylhdlqvdfltekncsqlqdlhk  458
DSSP  hhhhhhlllhhhhhhhhhhhhhlllleeeeelleeeeellhhhhhhhhhhlhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct kiitqfqryhqphtlspdqedcmywynflayhmasakmhkelcalmfsldwikaktelvg  518
DSSP  hhhhhhlllllhhhlllllllhhhhhhhhhhhhhhlllhhhhhhhhllhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct pahlihefveyrhildekdcavsenfqeflslnghllgrqpfpnivqlglcepetsevyq  578
DSSP  lhhhhhhhhhhhhhllhhhhhhhhhhhhhhhhllllllllllllhhhhhlllllllhhhh


DSSP  --------
Query --------  142
ident         
Sbjct qaklqakq  586
DSSP  hhhhhhhl


No 86: Query=mol1A Sbjct=1g8pA Z-score=6.1

back to top
DSSP  --llllhhhHHHHhHHHHH-LLLL-----LLEEEELLLLLLHHHHHHHHHHL--------
Query --igrsewiNQYRrRLQQL-SETD-----IAVWLYGAPGTGRXTGARYLHQF--------   44
ident                       |        |   |  |||  |  | |           
Sbjct rpvfpfsaiVGQE-DMKLAlLLTAvdpgiGGVLVFGDRGTGKSTAVRALAALlpeieave   59
DSSP  lllllhhhlLLLH-HHHHHhHHHHhlhhhLLEEEELLHHHLLLHHHHHHHHHllleeeel


DSSP  ----------------------lllllLLLEEEELLLlLLLLHHH---------------
Query ----------------------grnaqGEFVYRELTPdNAPQLND---------------   67
ident                               |   |                         
Sbjct gcpvsspnvemipdwatvlstnvirkpTPVVDLPLGV-SEDRVVGaldieraiskgekaf  118
DSSP  llllllllhhhllllllllllleeeelLLEEEELLLL-LHHHHHLeelhhhhhhhlhhhe


DSSP  ---HHHHHLLLLEEEELHHHLLHHHHHHHHHHHHL-------------llllLLEEEEEL
Query ---FIALAQGGTLVLSHPEHLTREQQYHLVQLQSQ-------------ehrpFRLIGIGD  111
ident      | |  | |       |       |                       | | | | 
Sbjct epgLLARANRGYLYIDECNLLEDHIVDLLLDVAQSgenvverdglsirhparFVLVGSGN  178
DSSP  ellHHHHHLLEEEEELLHHHLLHHHHHHHHHHHHHleeeelllllleeeellEEEEEEEL


DSSP  LlhhHHHHhllLLHHHHHHHhHHEEELLLLL-----------------------------
Query TslvELAAsnhIIAELYYCFaXTQIACLPLT-----------------------------  142
ident     |          |   |       |                                
Sbjct P---EEGD---LRPQLLDRF-GLSVEVLSPRdvetrvevirrrdtydadpkafleewrpk  231
DSSP  L---LLLL---LLHHHHLLL-LEEEELLLLLlhhhhhhhhhhhhhhhhlhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct dmdirnqilearerlpkveapntalydcaalcialgsdglrgeltllrsaralaalegat  291
DSSP  hhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhhllll


DSSP  ------------------------------
Query ------------------------------  142
ident                               
Sbjct avgrdhlkrvatmalshrlrvartveetlp  321
DSSP  lllhhhhhhhhhhhhhhhlllhhhhhhhll


No 87: Query=mol1A Sbjct=2ehvC Z-score=6.1

back to top
DSSP  --llllhhhHHHHHHhHHHLLLLLLEEEELLLLLLHHHHHHHHHHL-llllLLLLEEEEL
Query --igrsewiNQYRRRlQQLSETDIAVWLYGAPGTGRXTGARYLHQF-grnaQGEFVYREL   57
ident                          | | |  |||  | |               |   |
Sbjct pvrrvksgiPGFDELiEGGFPEGTTVLLTGGTGTGKTTFAAQFIYKgaeeyGEPGVFVTL   60
DSSP  llleellllLLLHHHlLLLEELLLEEEEELLLLLLHHHHHHHHHHHhhhhhLLLEEEEEL


DSSP  ---------------------------------------llLLLL-LHHHHHHHHL---L
Query ---------------------------------------tpDNAP-QLNDFIALAQ---G   74
ident                                           |    |            
Sbjct eerardlrrexasfgwdfekyekegkiaivdgvssvvglpsFNVDnFLRYIYRVVKainA  120
DSSP  lllhhhhhhhhhlllllhhhhhhllleeeelllllllllllLLHHhHHHHHHHHHHhhlL


DSSP  LLEEEELHHHL---------LHHHHHHHHHHHHLllLLLLEEEEELL-lhHHHHHhllll
Query GTLVLSHPEHL---------TREQQYHLVQLQSQehRPFRLIGIGDT-slVELAAsnhii  124
ident   ||                 ||    |             |                  
Sbjct KRLVIDSIPSIalrleeerkIREVLLKLNTILLE--XGVTTILTTEApgkLSRYG-----  173
DSSP  LEEEEELHHHHhhllllhhhHHHHHHHHHHHHHH--HLLEEEEEELLlllLLLLL-----


DSSP  hhHHHHHhHHEEEL-----------------------------LLLL--------
Query aeLYYCFaXTQIAC-----------------------------LPLT--------  142
ident            |                                           
Sbjct -iEEFIA-RGVIVLdlqeknielkryvlirkxretrhsxkkypFEIGpngivvyp  226
DSSP  -lHHHHL-LEEEEEeeeelllleeeeeeeeeellllllllleeEEEElleeeell


No 88: Query=mol1A Sbjct=3cmvG Z-score=6.1

back to top
DSSP  llllhhhhhHHHHHHHH---LLLL-LLEEEELLLLLLHHHHHHHHHHLLlllLLLLEEEE
Query igrsewinqYRRRLQQL---SETD-IAVWLYGAPGTGRXTGARYLHQFGrnaQGEFVYRE   56
ident                 |          |  ||    |  |                    
Sbjct --vetistgSLSLDIALgagGLPMgRIVEIYGPESSGKTTLTLQVIAAAqreGKTCAFID   58
DSSP  --lleelllLHHHHHHHlllLEELlLEEEEELLLLLLHHHHHHHHHHHHhllLLLEEEEE


DSSP  L----------------------llLLLLL-HHHHHHH---hLLLLEEEELHHH------
Query L----------------------tpDNAPQ-LNDFIAL---aQGGTLVLSHPEH------   84
ident                          |   | |    ||         |            
Sbjct AehaldpiyarklgvdidnllcsqpDTGEQaLEICDALarsgAVDVIVVDSVAAltpkae  118
DSSP  LlllllhhhhhhhlllhhheeeellLLHHHhHHHHHHHhhllLLLEEEEELHHHlllhhh


DSSP  ---------------LLHHHHHHHHHHHHLllLLLLEEEEELllhhhhhhhlLLLHhHHH
Query ---------------LTREQQYHLVQLQSQehRPFRLIGIGDtslvelaasnHIIAeLYY  129
ident                        |     |      || |               | |  
Sbjct iegeigdshmglaarMMSQAMRKLAGNLKQ--SNTLLIFINQ----------GGNA-LKF  165
DSSP  hhhlllllhhhlhhhHHHHLLHHHHHLLLL--LLLEEEEEEL----------LLLL-HHH


DSSP  HHhHHEEELLL-------------------------------------------------
Query CFaXTQIACLP-------------------------------------------------  140
ident                                                             
Sbjct YA-SVRLDIRRigavkegenvvgsetrvkvvknkiaapfkqaefqilygeginfygelvd  224
DSSP  HE-EEEEEEEEllllllllllllleeeeeeeeellllllleeeeeeellleelhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct lgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelllkqkalaaa  284
DSSP  hhhhlllleeelleeeelleeeeehhhhhhhhhlllhhhhhhhhhhhhlllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct lgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiygpessgkt  344
DSSP  hhhhhhhlllllleelllllllllleellllhhhhhhhlllleellleeeeellllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct tltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqaleicdala  404
DSSP  hhhhhhhhhhhlllllleeeellllllhhhhhhhlllhhhleeellllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct rsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntllifinqggnalkf  464
DSSP  lllllleeeeelhhhlllhhhhlllllhhhhhhhhhhhhhhhlllleeeeeelllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct yasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilygeginfygelvdl  524
DSSP  hlleeeeelllllleelleeleeeeeeeeeeellllllleeeeeeellleelhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelllkqkalaaal  584
DSSP  hhhlllleeelleeeelleeeeehhhhhhhhhlllhhhhhhhhhhhhhhlllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiygpessgktt  644
DSSP  hhhhhhlllllleelllllllllleellllhhhhhhhlllleellleeeeellllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqaleicdalar  704
DSSP  hhhhhhhhhhllllleeeeellllllhhhhhhhlllhhhleeellllhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct sgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntllifinqggnalkfy  764
DSSP  llllleeeeelhhhlllhhhhlllllhhhhhlhhhhhhhhhlllleeeeeelllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct asvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilygeginfygelvdlg  824
DSSP  eeeeeeeeellleelllleeeeeeeeeeeeellllllleeeeeeellleelhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct vkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelllkqkalaaalg  884
DSSP  hhlllleeelleeeelleeeeelhhhhhhhhlllhhhhhhhhhhhhhhhlllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct qiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiygpessgkttl  944
DSSP  hhhhhlllllleelllllllllleellllllhhhhllllleellleeeeellllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct tlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqaleicdalars 1004
DSSP  hhhhhhhhhllllleeeelllllllhhhhhhhlllhhhllllllllhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gavdvivvdsvaaltplaarmmsqamrklagnlkqsntllifinqggnalkfyasvrldi 1064
DSSP  lllleeeellhhhllllllllhhhhhhhhhhhhhhhlleeeeeelllllhhhhlleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct rrigavkegenvvgsetrvkvvknkiaapfkqaefqilygeginfygelvdlgvkeklie 1124
DSSP  eellllllllllleeeeeeeeeeellllllleeeeeeellleelhhhhhhhhhhhlllle


DSSP  -----------------------------------------ll
Query -----------------------------------------lt  142
ident                                            
Sbjct kagawysykgekigqgkanatawlkdnpetakeiekkvrelll 1167
DSSP  eelleeeelleeeeehhhhhhhhhlllhhhhhhhhhhhhhhhl


No 89: Query=mol1A Sbjct=1t5lA Z-score=6.1

back to top
DSSP  ----------llllhHHHHHHHHHHHHLL-LLLLEEEELLLLLLHHHHHHHHHHLLLLll
Query ----------igrseWINQYRRRLQQLSE-TDIAVWLYGAPGTGRXTGARYLHQFGRNaq   49
ident                   |    |            | || |||                
Sbjct vegrfqlvapyepqgDQPQAIAKLVDGLRrGVKHQTLLGATGTGKTFTISNVIAQVNK--   58
DSSP  lllllllllllllllLHHHHHHHHHHHHHhLLLEEEEEELLLLLHHHHHHHHHHHHLL--


DSSP  lLLEEEELL---------------------------------------------------
Query gEFVYRELT---------------------------------------------------   58
ident                                                             
Sbjct -PTLVIAHNktlagqlyselkeffphnaveyfvsyydyaqpeayvpqtdtyiekdakind  117
DSSP  -LEEEELLLhhhhhhhhhhhhhhlllleeeeellhhhllllleeelllleeelllllllh


DSSP  ---------------------llLLLLH--------------------------------
Query ---------------------pdNAPQL--------------------------------   65
ident                                                             
Sbjct eidklrhsatsalferrdviivaSVSCIyglgspeeyrelvvslrvgmeiernallrrlv  177
DSSP  hhhhhhhhhhhhhhhllleeeeeLHHHHlllllhhhhhhlleeeellllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   65
ident                                                             
Sbjct diqydrndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlge  237
DSSP  hllleelllllllleeeellleeeellllllleeeeeeelllleeeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   65
ident                                                             
Sbjct rehvaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemm  297
DSSP  lleeeelllllllllhhhhhhhhhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhhh


DSSP  --------------------------HHHHHHHLLLLEEEE----LHHHLLH--------
Query --------------------------NDFIALAQGGTLVLS----HPEHLTR--------   87
ident                                                  |          
Sbjct remgfcsgienysrhlalrppgstpyTLLDYFPDDFLIIVDeshvTLPQLRGmyngdrar  357
DSSP  hhhlllllhhhhhhhhhlllllllllLHHHHLLLLLEEEEElhhhHHHHHHHhhhhhhhh


DSSP  -------------------HHHHHHHHHHhlllllLLEEEEELLLHHhhhhhllllhhhH
Query -------------------EQQYHLVQLQsqehrpFRLIGIGDTSLVelaasnhiiaelY  128
ident                           |           |    |                
Sbjct kqvlvdhgfrlpsaldnrpLTFEEFEQKI------NQIIYVSATPGP----------yeL  401
DSSP  hhhhhhhllllhhhhhlllLLHHHHHHHL------LEEEEEELLLLH----------hhH


DSSP  HHHHHhEEELLLLL----------------------------------------------
Query YCFAXtQIACLPLT----------------------------------------------  142
ident                                                             
Sbjct EHSPG-VVEQIIRPtglldptidvrptkgqiddligeirervernertlvttltkkmaed  460
DSSP  HHLLL-LEEELLLLlllllleeeeellllhhhhhhhhhhhhhhllleeeeelllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct ltdylkeagikvaylhseiktlerieiirdlrlgkydvlvginllregldipevslvail  520
DSSP  hhhhhhllllleeeelllllhhhhhhhhhhhhhlllleeeelllllllllllleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct dadkegflrsersliqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrk  580
DSSP  llllllhhhlhhhhhhhhhhhlllllleeeeelllllhhhhhhhhhhhhhhhhhhhhhhh


DSSP  ---------------
Query ---------------  142
ident                
Sbjct hgivprtvkkeirdv  595
DSSP  hllllllllllllll


No 90: Query=mol1A Sbjct=1d2mA Z-score=6.1

back to top
DSSP  ------llllhhhHHHHHHHHHHLL-LLLLEEEELLLLLLHHHHHHHHHHLLLLlllLLE
Query ------igrsewiNQYRRRLQQLSE-TDIAVWLYGAPGTGRXTGARYLHQFGRNaqgEFV   53
ident                    |          | | || |||                    
Sbjct tfryrgpspkgdqPKAIAGLVEALRdGERFVTLLGATGTGKTVTMAKVIEALGR---PAL   57
DSSP  llllllllllllhHHHLLLHHHHHHlLLLEEEEEELLLLLHHHHHHHHHHHHLL---LEE


DSSP  EEELLL------------------------------------------------------
Query YRELTP------------------------------------------------------   59
ident                                                             
Sbjct VLAPNKilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeier  117
DSSP  EEELLHhhhhhhhhhhhhhlllleeeelllhhhllllleeehhhleeelllllllhhhhh


DSSP  ------------------lLLLLHH-----------------------------------
Query ------------------dNAPQLN-----------------------------------   66
ident                                                             
Sbjct lrhsttrslltrrdvivvaSVSAIYglgdpreyrarnlvvrevllerllelgyqrndidl  177
DSSP  hhhhhhhhhllllleeeeeEHHHLLllllhhhhhhlleelllllllllllllleelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   66
ident                                                             
Sbjct spgrfrakgevleifpayetepirvelgfvlfpathylspegleeilkeiekelwervry  237
DSSP  llleelllllleeelllllllleeelllleelllllllllllhhhhhhhhhhhhhhhhhh


DSSP  --------------------------------------------------HHHHHHL-LL
Query --------------------------------------------------DFIALAQ-GG   75
ident                                                             
Sbjct feergevlyaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppyTLLDYFPeDF  297
DSSP  hhhhllhhhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhlllllllllLHHHHLLlLL


DSSP  LEEEE----LHHHLLH---------------------------HHHHHHHHHHhlllllL
Query TLVLS----HPEHLTR---------------------------EQQYHLVQLQsqehrpF  104
ident    |         |                                              
Sbjct LVFLDeshvTVPQLQGmyrgdyarkktlvdygfrlpsaldnrpLRFEEFLERV------S  351
DSSP  EEEEElhhhHHHHHHHhhhhhhhhhhhhhhlllllhhhhhlllLLHHHHHHLL------L


DSSP  LEEEEELLLHHhhhhhllllhhhHHHHhHHEEELLL------------------------
Query RLIGIGDTSLVelaasnhiiaelYYCFaXTQIACLP------------------------  140
ident        |                                                    
Sbjct QVVFVSATPGP----------feLAHS-GRVVEQIIrptglldplvrvkptenqildlme  400
DSSP  EEEEEELLLLH----------hhHHHL-LEEEEELLlllllllleeeeellllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gireraargertlvtvltvrmaeeltsflvehgirarylhheldafkrqalirdlrlghy  460
DSSP  hhhhhhhllleeeeelllhhhhhhhhhhhhllllleeeelllllllhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct dclvginllregldipevslvaildadkegflrsersliqtigraarnargevwlyadrv  520
DSSP  leeeelllllllllllleeeeeelllllllhhhlhhhhhhhhhhhlllllleeeeellll


DSSP  ------------------------------ll
Query ------------------------------lt  142
ident                                 
Sbjct seamqraieetnrrralqeaynlehgitpetv  552
DSSP  lhhhhhhhhhhhhhhhhhhhhhhhhlllllll


No 91: Query=mol1A Sbjct=2fwrA Z-score=6.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct miaeiyyergtivvkgdahvphakfdsrsgtyralafryrdiieyfesngiefvdnaadp   60
DSSP  lleeeeeelleeeeelllllllleeelllleeeeehhhhhhhhhhhhhlllleeeellll


DSSP  ------llllhhHHHHHHHHHHHLLLLlLEEEELLLLLLHHHHHHHHHHLLlllLLLLEE
Query ------igrsewINQYRRRLQQLSETDiAVWLYGAPGTGRXTGARYLHQFGrnaQGEFVY   54
ident                    |                | |    |                
Sbjct iptpyfdaeislRDYQEKALERWLVDK-RGCIVLPTGSGKTHVAMAAINEL---STPTLI  116
DSSP  llllllllllllLHHHHHHHHHHLLLL-EEEEELLLLLLHHHHHHHHHHHH---LLLEEE


DSSP  EELL---------------------------------llLLLLH----hHHHHHHllLLE
Query RELT---------------------------------pdNAPQL----nDFIALAqgGTL   77
ident    |                                                       |
Sbjct VVPTlalaeqwkerlgifgeeyvgefsgrikelkpltvsTYDSAyvnaeKLGNRF--MLL  174
DSSP  EELLhhhhhhhhhhhhhhlhhheeelllllllllleeeeEHHHHhhlhhHHLLLL--LEE


DSSP  EEEL-HHHLLHHHHhHHHHHhhlllLLLLEEEEELLLhhhHHHHLLLlHHHHH-hHHHHE
Query VLSH-PEHLTREQQyHLVQLqsqehRPFRLIGIGDTSlveLAASNHIiAELYY-cFAXTQ  135
ident                   |            |   |              |         
Sbjct IFDEvHHLPAESYV-QIAQM----sIAPFRLGLTATF---EREDGRH-EILKEvvGGKVF  225
DSSP  EEELhHHLLLLLLH-HHHHL----lLLLEEEEEELLL---LLLLLHH-HLHHHhlLLEEE


DSSP  EE----------------------------------------------------------
Query IA----------------------------------------------------------  137
ident                                                             
Sbjct ELfpdslagkhlakytikrifvplaederveyekrekvykqflrargitlrraedfnkiv  285
DSSP  ELlhhhhllllllleeelleeelllhhhhhhlllllhhhhllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct masgyderayealraweearriafnsknkirklreilerhrkdkiiiftrhnelvyrisk  345
DSSP  lllllllllllllhhhhhhhhhhhlllhhhhhhhhhhhhllllllllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct vflipaithrtsreereeilegfrtgrfraivssqvldegidvpdanvgvimsgsgsare  405
DSSP  hllllllllllllhhhhlhhhhhhhlllllllllllllllllllllleeeeellllllhh


DSSP  ------------------------lllll
Query ------------------------clplt  142
ident                              
Sbjct yiqrlgrilrpskgkkeavlyelisrgtg  434
DSSP  hhhhhhhlllllllllleeeeeeeellll


No 92: Query=mol1A Sbjct=1g64B Z-score=6.1

back to top
DSSP  --llllhhhhhhhhhhhhhlLLLLLEEEELLLlLLHHHHHHHHHHLLLllLLLLEEEELL
Query --igrsewinqyrrrlqqlsETDIAVWLYGAPgTGRXTGARYLHQFGRnaQGEFVYRELT   58
ident                     |  |     |    |  | |                    
Sbjct qqrqqkvkdrvdarvaqaqeERGIIIVFTGNG-KGKTTAAFGTAARAVghGKNVGVVQFI   59
DSSP  llhhhhhhhhhhhhhhhlllLLLLEEEEELLL-LLHHHHHHHHHHHHHllLLLEEEEELL


DSSP  ------------------------------------LLLLLL-HHHHHHH---hLLLLEE
Query ------------------------------------PDNAPQ-LNDFIAL---aQGGTLV   78
ident                                                            |
Sbjct kgtwpngernllephgvefqvmatgftwetqnreadTAACMAvWQHGKRMladpLLDMVV  119
DSSP  llllllhhhhhhhhhlleeeellllllllhhhhhhhHHHHHHhHHHHHHHhhllLLLEEE


DSSP  E-ELHHH-----LLHHHHHHHHHHHhllLLLLLEEEEELLLHHhhhhhllllhHHHHHHh
Query L-SHPEH-----LTREQQYHLVQLQsqeHRPFRLIGIGDTSLVelaasnhiiaELYYCFa  132
ident |           |  |                  |  |                      
Sbjct LdELTYMvaydyLPLEEVISALNAR---PGHQTVIITGRGCHR----------DILDLA-  165
DSSP  EeLLHHHhhlllLLHHHHHHHHHHL---LLLLEEEEELLLLLH----------HHHHHL-


DSSP  HHEEELL---------------lll
Query XTQIACL---------------plt  142
ident  |                       
Sbjct DTVSELRpvkhafdagvkaqmgidy  190
DSSP  LEEEEEEeeelllllllllllllll


No 93: Query=mol1A Sbjct=1w36B Z-score=6.1

back to top
DSSP  llllhhhhhhhhHHHHHlLLLLLEEEELLLLLLHHHHHHHHHHLL---------LLLL--
Query igrsewinqyrrRLQQLsETDIAVWLYGAPGTGRXTGARYLHQFG---------RNAQ--   49
ident                 |             |||       |                   
Sbjct ----msdvaetlDPLRL-PLQGERLIEASAGTGKTFTIAALYLRLllglggsaaFPRPlt   55
DSSP  ----llllleelLHHHL-LLLLLEEEELLLLLLHHHHHHHHHHHHhllllllllLLLLll


DSSP  -lLLEEEELLL-------------------------------------------------
Query -gEFVYRELTP-------------------------------------------------   59
ident   |      |                                                  
Sbjct veELLVVTFTEaataelrgrirsnihelriaclrettdnplyerlleeiddkaqaaqwll  115
DSSP  hhHEEEEELLHhhhhhhhhhhhhhhhhhhhhhhllllllhhhhhhhhhlllhhhhhhhhh


DSSP  -----------lLLLLHH------------------------------------------
Query -----------dNAPQLN------------------------------------------   66
ident                                                             
Sbjct laerqmdeaavfTIHGFCqrmlnlnafesgmlfeqqliedesllryqacadfwrrhcypl  175
DSSP  hhhhhhhhlleeEHHHHHhhhhhhlhhhhlllllleellllhhhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   66
ident                                                             
Sbjct preiaqvvfetwkgpqallrdinrylqgeapvikapppddetlasrhaqivaridtvkqq  235
DSSP  lhhhhhhhhhhlllhhhhhhhhllllllllleeellllllllhhhhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   66
ident                                                             
Sbjct wrdavgeldaliessgidrrkfnrsnqakwidkisawaeeetnsyqlpeslekprhplfe  295
DSSP  lllllllllllllllllllhhhhhhhhhlllllllllllllllllllhhhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   66
ident                                                             
Sbjct aidqllaeplsirdlvitralaeiretvarekrrrgelgfddmlsrldsalrsesgevla  355
DSSP  hhhhhlllllllhhhhhhhhhhhhhhhhhhhhhhhleelhhhhhhhhhhhhhlllhhhhh


DSSP  -hhHHHHLllLEEEELHHHLLHHHHHHHHHHHHLlLLLLLEEEEELllHHHH----hhhL
Query -dfIALAQggTLVLSHPEHLTREQQYHLVQLQSQeHRPFRLIGIGDtsLVEL----aasN  121
ident                        |                |  |||              
Sbjct aaiRTRFP--VAMIDEFQDTDPQQYRIFRRIWHH-QPETALLLIGD--PKQAiyafrgaD  410
DSSP  hhhHHHLL--EEEELLHHHLLHHHHHHHHHHHLL-LLLLEEEEEEL--HHHLllhhhllL


DSSP  LLL-HHHHHHHhHHEEELLLLL--------------------------------------
Query HII-AELYYCFaXTQIACLPLT--------------------------------------  142
ident                                                             
Sbjct IFTyMKARSEV-HAHYTLDTNWrsapgmvnsvnklfsqtddafmfreipfipvksagknq  469
DSSP  HHHhHHHHHHL-LLEEELLEELlllhhhhhhhhhhhhlllllllllllllllleelhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct alrfvfkgetqpamkmwlmegescgvgdyqstmaqvcaaqirdwlqagqrgeallmngdd  529
DSSP  leeeeelleeelleeeeelllllllllhhhhhhhhhhhhhhhhhhhhhhllleeeeelle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct arpvrasdisvlvrsrqeaaqvrdaltlleipsvylsnrdsvfetleaqemlwllqavmt  589
DSSP  eeellhhheeeeellhhhhhhhhhhhhllllleeellllllhhhllhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct perentlrsalatsmmglnaldietlnndehawdvvveefdgyrqiwrkrgvmpmlralm  649
DSSP  lllhhhhhhhhhlhhhlllhhhhhhhhhlhhhhhhhhhhhhhhhhhhhhhlhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct sarniaenllataggerrltdilhisellqeagtqlesehalvrwlsqhilepdsnassq  709
DSSP  hhllhhhhhhhlllhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct qmrlesdkhlvqivtihkskgleyplvwlpfitnfrvqeqafyhdrhsfeavldlnaape  769
DSSP  llllllhhhleeeeelllllllleeeeeelllllllllllleeelllllleeeellllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct svdlaeaerlaedlrllyvaltrsvwhcslgvaplvrrrgdkkgdtdvhqsalgrllqkg  829
DSSP  hhhhhhhhhhhhhhhhhhhhhlleeeeeeeeellllllllllllllhhhhlhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct epqdaaglrtciealcdddiawqtaqtgdnqpwqvndvstaelnaktlqrlpgdnwrvts  889
DSSP  llllhhhhhhhhhhllllleeeeellllllllllllllllllllllllllllllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct ysglqqrghgiaqdlmprldvdaagvasvveeptltphqfprgaspgtflhslfedldft  949
DSSP  lllllllllllhhhhlllllllllllllllllllllhhhllllhhhhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct qpvdpnwvreklelggfesqwepvltewitavlqaplnetgvslsqlsarnkqvemefyl 1009
DSSP  llllhhhhhhhhhhllllhhhhhhhhhhhhhhhllllllllllhhhllhhheeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct pisepliasqldtlirqfdplsagcpplefmqvrgmlkgfidlvfrhegryylldyksnw 1069
DSSP  eelllllhhhhhhhhhhhllllllllllllllleeeeeeeeeeeelllllllleeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct lgedssaytqqamaaamqahrydlqyqlytlalhrylrhriadydyehhfggviylflrg 1129
DSSP  llllhhhllhhhhhhhhhhlllhhhhhhhhhhhhhhhhhhlllllhhhhlllleeeelll


DSSP  -----------------------------
Query -----------------------------  142
ident                              
Sbjct vdkehpqqgiyttrpnaglialmdemfag 1158
DSSP  llllllllllllllllllhhhhhhhhhhl


No 94: Query=mol1A Sbjct=2o8fA Z-score=6.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mavqpketlqlesaaevgfvrffqgmpekptttvrlfdrgdfytahgedallaarevfkt   60
DSSP  llllllllllllhhhhhhhhhhhhlllllllleeeeeellleeeeelhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qgvikymgpagaknlqsvvlskmnfesfvkdlllvrqyrvevyknragskendwylayka  120
DSSP  lllleeellllllleeeeeeehhhhhhhhhhhhhlllleeeeeeelllllllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct spgnlsqfedilfgnnigvvgvkmsavdqrqvgvgyvdsiqrklglcefpdndqfsnlea  180
DSSP  lllllllllllllllllleeeeellllllleeeeeeeelllleeeeeeeelllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lliqigpkecvlpggetagdmgklrqiiqrggiliterkkadfstkdiyqdlnrkgkkge  240
DSSP  hhhhhllleeeellllllllhhhhhhhhhlllleeeelllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qmnsavlpemenqvavsslsavikflellsddsnfgqfelttfdfsqymkldiaavraln  300
DSSP  llllllllllllhhhhhhhhhhhhhllhhhllllllllllllllhhhlleelhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lfqgdttgsqslaallnkcktpqgqrlvnqwikqplmdknrieerlnlveafvedaelrq  360
DSSP  lllllllllllhhhhhlllllhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhlllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tlqedllrrfpdlnrlakkfqrqaanlqdcyrlyqginqlpnviqalekhegkhqkllla  420
DSSP  hhllllhhhlllhhhhhhhhhllllllhhhhhhhhhhhlhhhhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vfvtpltdlrsdfskfqemiettldmdqvenheflvkpsfdpnlselreimndlekkmqs  480
DSSP  llhhhhhhhhhhhhhhhhhhhhhlllhhhhhllllllllllhhhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tlisaardlgldpgkqikldssaqfgyyfrvtckeekvlrnnknfstvdiqkngvkftns  540
DSSP  hhhhhhhhhllllllleeeeellllleeeeellllllllllllllllleelllleeellh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kltslneeytknkteyeeaqdaivkeivnissgyvepmqtlndvlaqldavvsfahvsng  600
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhhhhhhhh


DSSP  ------------------------------lLLLHhhHHHHhhhhHHLLL---lLLEEEE
Query ------------------------------iGRSEwiNQYRrrlqQLSET---dIAVWLY   27
ident                                                             
Sbjct apvpyvrpailekgqgriilkasrhacvevqDEIA--FIPN----DVYFEkdkqMFHIIT  654
DSSP  lllllllleeellllleeeeeeellllllllLLLL--LLLE----EEEEEllllLEEEEL


DSSP  LLLLLLHHHHHHHHHHLLL---------------llLLLLEEEEL-LLLLLLL-HHHHHH
Query GAPGTGRXTGARYLHQFGR---------------naQGEFVYREL-TPDNAPQ-LNDFIA   70
ident |    |  |  |                              |   |             
Sbjct GPNMGGKSTYIRQTGVIVLmaqigcfvpcesaevsiVDCILARVGsTFMAEMLeTASILR  714
DSSP  LLLLLLHHHHHHHHHHHHHhhhhllllllleeeeelLLEEEEEELlLLHHHHHhHHHHHH


DSSP  HHL-LLLEEEELHHH------llhhhhHHHHHHHHLllLLLLEEEEELllHHHHhhhlll
Query LAQ-GGTLVLSHPEH------ltreqqYHLVQLQSQehRPFRLIGIGDtsLVELaasnhi  123
ident  |                                                  ||      
Sbjct SATkDSLIIIDELGRgtstydgfglawAISEYIATK--IGAFCMFATH--FHEL---tal  767
DSSP  HLLlLLEEEEELLLLlllhhhhhhhhhHHHHHHHHL--LLLEEEEELL--LHHH---hhh


DSSP  LHHHhHHHHhhEEELL--------------------------------------------
Query IAELyYCFAxtQIACL--------------------------------------------  139
ident                                                             
Sbjct ANQI-PTVN--NLHVTaltteetltmlyqvkkgvcdqsfgihvaelanfpkhviecakqk  824
DSSP  HHLL-LLEE--EEEEEeeelllleeeeeeeeelllllllhhhhhhhllllhhhhhhhhhl


DSSP  ----lll
Query ----plt  142
ident        
Sbjct aleleef  831
DSSP  lllllll


No 95: Query=mol1A Sbjct=3cpeA Z-score=6.1

back to top
DSSP  -------------------------------LLLL-------------------------
Query -------------------------------IGRS-------------------------    4
ident                                                             
Sbjct dfhplneagkilikhpslaerkdedgihwikSQWDgkwypekfsdylrlhkivkipnnsd   60
DSSP  lllllllllllllllhhhlleeeelleeeeeLLLLlleeellhhhhhlllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    4
ident                                                             
Sbjct kpelfqtykdknnkrsrymglpnlkraniktqwtremveewkkcrddivyfaetycaith  120
DSSP  lllllllllllllllllhhhllllllllllllllhhhhhhhhhhhllhhhhhhhllllll


DSSP  -------hhhHHHHHHHHH-HLLLlLLEEEELLLLLLHHHHHHHHHHLLL--llLLLLEE
Query -------ewiNQYRRRLQQ-LSETdIAVWLYGAPGTGRXTGARYLHQFGR--naQGEFVY   54
ident             | |      |              |  |                    
Sbjct idygvikvqlRDYQRDMLKiMSSK-RMTVCNLSRQLGKTTVVAIFLAHFVcfnkDKAVGI  179
DSSP  llllllllllLHHHHHHHHhHHHL-LEEEEEELLLLLHHHHHHHHHHHHHhlllLLEEEE


DSSP  EELLL------------------------------------------llLLLHHHH-hHH
Query RELTP------------------------------------------dnAPQLNDF-iAL   71
ident                                                  |          
Sbjct LAHKGsmsaevldrtkqaiellpdflqpgivewnkgsieldngssigayASSPDAVrgNS  239
DSSP  EELLHhhhhhhhhhhhhhhlllllllllleeeellleeeelllleeeeeELLHHHHhhLL


DSSP  HLllLEEEELH--HHLLHHHHHHHHHHHHLLLLlLLEEEEELLlhhhhhhHLLL------
Query AQggTLVLSHP--EHLTREQQYHLVQLQSQEHRpFRLIGIGDTslvelaaSNHI------  123
ident                             |   |    |                      
Sbjct FA--MIYIEDCafIPNFHDSWLAIQPVISSGRR-SKIIITTTP------nGLNHfydiwt  290
DSSP  LL--EEEEELHhhLLLHHHHHHHHHHHHLLLLL-LEEEEEELL------lLLLHhhhhhh


DSSP  -lhhhHHHHhhHEEELL-------------------------------------------
Query -iaelYYCFaxTQIACL-------------------------------------------  139
ident         |                                                   
Sbjct aavegKSGF--EPYTAIwnsvkerlyndedifddgwqwsiqtingsslaqfrqehtaafe  348
DSSP  hhhllLLLL--EEEEELhhhlhhhhllllllllllhhhhhhhhllllhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct gtsgtlisgmklavmdfievtpddhgfhqfkkpepdrkyiatldcsegrgqdyhalhiid  408
DSSP  llllllllhhhhlllllllllllllleeellllllllleeeeeellllllllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct vtddvweqvgvlhsntishlilpdivmrylveynecpvyielnstgvsvakslymdleye  468
DSSP  llllleeeeeeeeelllllllhhhhhhhhhhhllllleeeeelhhhhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct gvicdsytdlgmkqtkrtkavgcstlkdliekdkliihhratiqefrtfsekgvswaaee  528
DSSP  leelllllllleellhhhhhhhhhhhhhhhhllleelllhhhhhhhlleeeelleeeell


DSSP  ----------------------lll
Query ----------------------plt  142
ident                          
Sbjct gyhddlvmslvifgwlstqskfidy  553
DSSP  llllhhhhhhhhhhhhhhlhhhlll


No 96: Query=mol1A Sbjct=1skyB Z-score=6.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sqiqvsdvgtviqvgdgiarahgldnvmsgeavefanavmgmalnleennvgivilgpyt   60
DSSP  llllhhheeeeeeeelleeeeeellllllleeeeelllleeeeeeeelleeeeeelllll


DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------i    1
ident                                                             
Sbjct gikegdevrrtgrimevpvgetligrvvnplgqpvdglgpvettetrpiesrapgvmdrr  120
DSSP  lllllleeeeeeeeleeelllllllleellllllllllllllllleeellllllllllll


DSSP  lllhhhhhhHHHHHH-HLLLL-LLEEEELLLLLLHHHHHHHHHHLLLlLLLLLEEEELL-
Query grsewinqyRRRLQQ-LSETD-IAVWLYGAPGTGRXTGARYLHQFGRnAQGEFVYRELT-   58
ident                             |   ||    |               |     
Sbjct svheplqtgIKAIDAlVPIGRgQRELIIGDRQTGKTSVAIDTIINQKdQNMICIYVAIGq  180
DSSP  lllleelllLHHHHHhLLEELlLLLEEEELLLLLHHHHHHHHHHLLLlLLLEEEEEEELl


DSSP  -------------------------------LLLLLLH-HHHHHHHL-------LLLEEE
Query -------------------------------PDNAPQL-NDFIALAQ-------GGTLVL   79
ident                                            |              | 
Sbjct kestvatvvetlakhgapdytivvtasasqpAPLLFLApYAGVAMGEyfmimgkHVLVVI  240
DSSP  lhhhhhhhhhhhhhlllllleeeeeelllllHHHHHHHhHHHHHHHHhhhllllEEEEEE


DSSP  ELHHHL-----------------------LHHHHHHHHHHHHLL-----LLLLLEEEEEL
Query SHPEHL-----------------------TREQQYHLVQLQSQE-----HRPFRLIGIGD  111
ident                                     |                       
Sbjct DDLSKQaaayrqlslllrrppgreaypgdIFYLHSRLLERAAKLsdakgGGSLTALPFVE  300
DSSP  ELHHHHhhhhhhhhhhllllllhhhllllHHHHHHHHHLLLLLLlhhhlLLEEEEEEEEE


DSSP  LlhhhhhhHLLLlHHHHHHHhHHEEEL--------LLLL---------------------
Query TslvelaaSNHIiAELYYCFaXTQIAC--------LPLT---------------------  142
ident |       |  |           ||                                   
Sbjct T--qagdiSAYIpTNVISIT-DGQIFLqsdlffsgVRPAinaglsvsrvggaaqikamkk  357
DSSP  L--hhhllLLHHhHHHHLLL-LEEEEElhhhhhhhLLLLlllllleellllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct vagtlrldlaayrelefaqfsddkatqanvargartvevlkqdlhqpipvekqvliiyal  417
DSSP  hhhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhhhhlllllllllhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct trgflddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqaieafkktfvv  477
DSSP  lllllllllhhhhhhhhhhhhhhhhhhhhhlhhhhhhhllllhhhhhhhhhhhhhhhlll


DSSP  --
Query --  142
ident   
Sbjct sq  479
DSSP  ll


No 97: Query=mol1A Sbjct=2wssA Z-score=6.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qktgtaevssileerilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglk   60
DSSP  lllllllllhhhhhhhhlllllllllleeeeeeeelleeeeeelllllllleeeelllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gmslnlepdnvgvvvfgndklikegdivkrtgaivdvpvgeellgrvvdalgnaidgkgp  120
DSSP  eeeeeelllleeeeeelllllllllleeeeeeelleeeelhhhllleeelllllllllll


DSSP  -------------------llllhhhhhhHHHHHH-HLLLL-LLEEEELLLLLLHHHHHH
Query -------------------igrsewinqyRRRLQQ-LSETD-IAVWLYGAPGTGRXTGAR   39
ident                                                 |   ||    | 
Sbjct igskarrrvglkapgiiprisvrepmqtgIKAVDSlVPIGRgQRELIIGDRQTGKTSIAI  180
DSSP  lllleeeelllllllllllllllllllllLHHHHHhLLLLLlLLLEEEELLLLLHHHHHH


DSSP  HHHHLLL--------llLLLLEEEELL--------------------------------L
Query YLHQFGR--------naQGEFVYRELT--------------------------------P   59
ident                       |                                     
Sbjct DTIINQKrfndgtdekkKLYCIYVAIGqkrstvaqlvkrltdadamkytivvsatasdaA  240
DSSP  HHHHHHHhhhlllllllLLEEEEEEELllhhhhhhhhhhhhhlllhhheeeeeelllllH


DSSP  LLLLLH-HHHHHHHL-------LLLEEEELHHHL-----------------------LHH
Query DNAPQL-NDFIALAQ-------GGTLVLSHPEHL-----------------------TRE   88
ident                                                             
Sbjct PLQYLApYSGCSMGEyfrdngkHALIIYDDLSKQavayrqmslllrrppgreaypgdVFY  300
DSSP  HHHHHHhHHHHHHHHhhhhlllEEEEEEELHHHHhhhhhhhhhhllllllhhhllllHHH


DSSP  HHHHHHHHHHLL-----llLLLEEEEELLlhhHHHHhlLLLHHHHHHHhHHEEEL-----
Query QQYHLVQLQSQE-----hrPFRLIGIGDTslvELAAsnHIIAELYYCFaXTQIAC-----  138
ident     |                       |      |   |           ||       
Sbjct LHSRLLERAAKMndafgggSLTALPVIETqagDVSA--YIPTNVISIT-DGQIFLetelf  357
DSSP  HHHHHHLLLLLLlhhhlllEEEEEEEEELlllLLLL--HHHHHHHHHL-LEEEEElhhhh


DSSP  -----LLLL---------------------------------------------------
Query -----LPLT---------------------------------------------------  142
ident                                                             
Sbjct ykgirPAINvglsvsrvgsaaqtramkqvagtmklelaqyrevaafaqfgsdldaatqql  417
DSSP  hhlllLLLLlllleellhhhhllhhhhhhhhhhhhhhhhhhhlhhhhlllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct lsrgvrltellkqgqyspmaieeqvaviyagvrgyldklepskitkfenaflshvisqhq  477
DSSP  hhhhhhhhhhllllllllllhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhhhhlll


DSSP  ---------------------------------
Query ---------------------------------  142
ident                                  
Sbjct allgkirtdgkiseesdaklkeivtnflagfea  510
DSSP  hhhhhhhhhllllhhhhhhhhhhhhhhhhhhll


No 98: Query=mol1A Sbjct=2fdcA Z-score=6.0

back to top
DSSP  -------llllhhHHHHHHHHHHHLLLL----LLEEEELLLLLLHHHHHHHHHHLLLLll
Query -------igrsewINQYRRRLQQLSETD----IAVWLYGAPGTGRXTGARYLHQFGRNaq   49
ident                        |            | || |||                
Sbjct vegrfqlvapyepQGDQPQAIAKLVDGLrrgvKHQTLLGATGTGKTFTISNVIAQVNK--   58
DSSP  lllllllllllllLLLHHHHHHHHHHHHhlllLEEEEEELLLLLLHHHHHHHHHHHLL--


DSSP  lLLEEEELLL--------------------------------------------------
Query gEFVYRELTP--------------------------------------------------   59
ident                                                             
Sbjct -PTLVIAHNKtlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakind  117
DSSP  -LEEEELLLHhhhhhhhhhhhhhlllleeeeellleeeeelleeelllleeelleeeelh


DSSP  ----------------------lLLLLHH-------------------------------
Query ----------------------dNAPQLN-------------------------------   66
ident                                                             
Sbjct eidklrhsatsalferrdviivaSVSCIYglgspeeyrelvvifpashfvtreekmrlai  177
DSSP  hhhhhhhhhhhhhhhllleeeeeLHHHHLeellhhhhhllllllllllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   66
ident                                                             
Sbjct qnieqeleerlaelraqgklleaqrleqrtrydlemmremgfcsgienysrhlalrppgs  237
DSSP  hhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhlllllll


DSSP  ---HHHHHHL-LLLEEEE----LHHHLLH---------------------------HHHH
Query ---DFIALAQ-GGTLVLS----HPEHLTR---------------------------EQQY   91
ident                           |                                 
Sbjct tpyTLLDYFPdDFLIIVDeshvTLPQLRGmyngdrarkqvlvdhgfrlpsaldnrpLTFE  297
DSSP  lleEHHHHLLlLLEEEEElhhhHHHHHHHhhhhhhhhhhhhhhhllllhhhhhlllLLHH


DSSP  HHHHHHhlllllLLEEEEELLLHHhhhhhllllhhhHHHHHHhEEELLLLL---------
Query HLVQLQsqehrpFRLIGIGDTSLVelaasnhiiaelYYCFAXtQIACLPLT---------  142
ident    |           |    |                                       
Sbjct EFEQKI------NQIIYVSATPGP----------yeLEHSPG-VVEQIIRPtglldptid  340
DSSP  HHHHHL------LEEEEELLLLLH----------hhHHLLLL-LEEELLLLlllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct vrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylherieiir  400
DSSP  eellllhhhhhhhhhhhhhhllleeeeelllhhhhhhhhhhhhhlllleeelllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct dlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigraarnanghv  460
DSSP  hhhhlllleeeelllllllllllleeeeeeellllllllllhhhhhhhhhllllllllee


DSSP  ---------------------------------------------
Query ---------------------------------------------  142
ident                                              
Sbjct imyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird  505
DSSP  eeelllllhhhhhhhhhhhhhhhhhhhhhhhllllllllllllll


No 99: Query=mol1A Sbjct=1sgwA Z-score=6.0

back to top
DSSP  ---------llllhhhhHHHHhhhhHLLLL-LLEEEELLLLLLHHHHHHHH---------
Query ---------igrsewinQYRRrlqqLSETD-IAVWLYGAPGTGRXTGARYL---------   41
ident                                  |   |  | |  |              
Sbjct skleirdlsvgydkpvlERIT----MTIEKgNVVNFHGPNGIGKTTLLKTIstylkplkg   56
DSSP  leeeeeeeeeellleeeEEEE----EEEELlLLEEEELLLLLLHHHHHHHHlllllllee


DSSP  hHLLL-----lLLLLLEEEELL--------------------------------------
Query hQFGR-----nAQGEFVYRELT--------------------------------------   58
ident              |                                              
Sbjct eIIYNgvpitkVKGKIFFLPEEiivprkisvedylkavaslygvkvnkneimdalesvev  116
DSSP  eEEELleehhhHHHHEEEELLLllllllllhhhhhhhhhhhllllllhhhhhhhhhhlll


DSSP  ------------LLLLLL-HHHHHHHhLLLLEEEELHHH-----lLHHHHHHHHHHHhll
Query ------------PDNAPQ-LNDFIALaQGGTLVLSHPEH-----lTREQQYHLVQLQsqe  100
ident                    |            ||  |                       
Sbjct ldlkkklgelsqGTIRRVqLASTLLV-NAEIYVLDDPVVaidedsKHKVLKSILEIL---  172
DSSP  llllllhhhllhHHHHHHhHHHHLLL-LLLEEEEELLLLllllllHHHHHHHHHHHH---


DSSP  lLLLLEEEEELLLHhhhhhhllllhhhHHHHhhHEEEL-LLLL
Query hRPFRLIGIGDTSLvelaasnhiiaelYYCFaxTQIAC-LPLT  142
ident       |      |              ||            |
Sbjct kEKGIVIISSREEL-------------SYCD--VNENLhKYST  200
DSSP  hHHLEEEEEELLLL-------------LLLL--EEEEHhHHLL


No 100: Query=mol1A Sbjct=2is4B Z-score=6.0

back to top
DSSP  ---llllhhHHHHHHHHHHHllLLLLEEEELLLLLLHHHHHHHHHHLL---LLLLL-LLE
Query ---igrsewINQYRRRLQQLseTDIAVWLYGAPGTGRXTGARYLHQFG---RNAQG-EFV   53
ident           |   |                  | |                |       
Sbjct mdvsylldsLNDKQREAVAA--PRSNLLVLAGAGSGKTRVLVHRIAWLmsvENCSPySIM   58
DSSP  llhhhhhllLLHHHHHHHLL--LLLLEEEELLLLLLHHHHHHHHHHHHhhlLLLLHhHEE


DSSP  EEELLL-----------------------lLLLLH-------------------------
Query YRELTP-----------------------dNAPQL-------------------------   65
ident     |                             |                         
Sbjct AVTFTNkaaaemrhrigqlmgtsqggmwvgTFHGLahrllrahhmdanlpqdfqildsed  118
DSSP  EEELLHhhhhhhhhhhhhhhllllllleeeEHHHHhhhhhhlllllllllllleeelhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   65
ident                                                             
Sbjct qlrllkrlikamnldekqwpprqamwyinsqkdeglrphhignpveqtwqkvyqayqeac  178
DSSP  hhhhhhhhhhhlllllllllhhhhhhhhhhhhhlllllllllllllllhhhhhhhhhhhh


DSSP  --------------------------hhhhHHHLllLEEEELH-HHLLHhhhHHHHHHHH
Query --------------------------ndfiALAQggTLVLSHP-EHLTReqqYHLVQLQS   98
ident                                                          |  
Sbjct draglvdfaelllrahelwlnkphilqhyrERFT--NILVDEFqDTNNI-qyAWIRLLAG  235
DSSP  hhhleeehhhhhhhhhhhhhllhhhhhhhhHHLL--EEEELLHhHLLHH-hhHHHHHHHL


DSSP  lllLLLLEEEEELL---lhhhhhhHLLLlhHHHH-HHHHHEEELLLLL------------
Query qehRPFRLIGIGDT---slvelaaSNHIiaELYY-CFAXTQIACLPLT------------  142
ident            ||                            |                  
Sbjct ---DTGKVMIVGDDdqsiygwrgaQVENiqRFLNdFPGAETIRLEQNYrstsnilsaana  292
DSSP  ---LLLEEEEEELHhhlllhhhllLLLHhhHHHHhLLLLEEEELLLLLlllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct liennngrlgkklwtdgadgepislycafneldearfvvnriktwqdnggalaecailyr  352
DSSP  hhlllllllllllllllllllleeeeeeeehhhhhhhhhhhhhhhhhllllhhheeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct snaqsrvleeallqasmpyriyggmrfferqeikdalsylrlivnrnddaafervvntpt  412
DSSP  lhhhhhhhhhhhhllllleeelllllhhhlhhhhhhhhhhhhhhllllhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct rgigdrtldvvrqtsrdrqltlwqacrellqekalagraasalqrfmelidalaqetadm  472
DSSP  llllhhhhhhhhhhhhhhlllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct plhvqtdrvikdsglrtmyeqekgqtrienleelvtatrqfslmplqaflshadtwqdav  532
DSSP  lhhhhhhhhhhhllhhhhhhlllllhhhhhhhhhhhhhhlllllhhhhhhllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct qlmtlhsakglefpqvfivgmeegmfpsqmsldeggrleeerrlayvgvtramqkltlty  592
DSSP  eeeehhhhlllleeeeeellllllllllhhhhhllllhhhhhhhhhhhhhleeeeeeeee


DSSP  ----------------------------------------
Query ----------------------------------------  142
ident                                         
Sbjct aetrrlygkevyhrpsrfigelpeecveevrlrvsrpvqr  632
DSSP  eeeeelllleelllllhhhhlllhhheeelllllllllll


No 101: Query=mol1A Sbjct=2hldK Z-score=5.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vsdeanlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgs   60
DSSP  llllllllleeeeeeeelleeeeeellllllleeeeelllleeeeeeeelleeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct drlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilp  120
DSSP  hhhllllleeeeeeeeleeeelhhhlleeelllllllllllllllleeeellllllllll


DSSP  -llllhhhhhhHHHHH-HHLLLL-LLEEEELLLLLLHHHHHHHHHHLL--------lllL
Query -igrsewinqyRRRLQ-QLSETD-IAVWLYGAPGTGRXTGARYLHQFG--------rnaQ   49
ident                               |   ||    |                   
Sbjct rrsvhepvqtgLKAVDaLVPIGRgQRELIIGDRQTGKTAVALDTILNQkrwnngsdeskK  180
DSSP  lllllllllllLHHHHhHLLLLLlLLLEEEELLLLLHHHHHHHHHHHLhhhhlllllllL


DSSP  LLLEEEELL--------------------------------LLLLLLH-HHHHHHHL---
Query GEFVYRELT--------------------------------PDNAPQL-NDFIALAQ---   73
ident    ||                                                       
Sbjct LYCVYVAVGqkrstvaqlvqtleqhdamkysiivaataseaAPLQYLApFTAASIGEwfr  240
DSSP  LEEEEEEELllhhhhhhhhhhhhhlllhhheeeeeelllllHHHHHHHhHHHHHHHHhhh


DSSP  ----LLLEEEELHHHL-----------------------LHHHHHHHHHHHHLL-----l
Query ----GGTLVLSHPEHL-----------------------TREQQYHLVQLQSQE-----h  101
ident         |                                     |             
Sbjct dngkHALIVYDDLSKQavayrqlslllrrppgreaypgdVFYLHSRLLERAAKLsekegs  300
DSSP  hlllEEEEEEELHHHHhhhhhhhhhhllllllhhhllllHHHHHHHHHLLLLLLllllll


DSSP  lLLLEEEEELL--lhHHHHhhllllHHHHHHHhHHEEELL--------------------
Query rPFRLIGIGDT--slVELAasnhiiAELYYCFaXTQIACL--------------------  139
ident           |    |                   ||                       
Sbjct gSLTALPVIETqggdVSAY----ipTNVISIT-DGQIFLEaelfykgirpainvglsvsr  355
DSSP  lEEEEEEEEELllllLLLH----hhHHHHLLL-LEEEEELhhhhhhllllllllllleel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct vgsaaqvkalkqvagslklflaqyrevaafaqdldastkqtlvrgerltqllkqnqyspl  415
DSSP  llhhhllhhhhhhlllhhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct ateeqvpliyagvnghldgielsrigefessflsylksnhnellteirekgelskellas  475
DSSP  lhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhhhhllhhhhhhhhhhllllhhhhhh


DSSP  --------lll
Query --------plt  142
ident            
Sbjct lksatesfvat  486
DSSP  hhhhhhhhhhl


No 102: Query=mol1A Sbjct=2d7dA Z-score=5.9

back to top
DSSP  -----llllhhhhHHHHHHHhHLLLL----LLEEEELLLLLLHHHHHHHHHHLLLLlllL
Query -----igrsewinQYRRRLQqLSETD----IAVWLYGAPGTGRXTGARYLHQFGRNaqgE   51
ident                      |            | || |||       |          
Sbjct drfelvskyqpqgDQPKAIEkLVKGIqegkKHQTLLGATGTGKTFTVSNLIKEVNK---P   57
DSSP  lllllllllllllLHHHHHHhHHHHHhlllLEEEEEELLLLLHHHHHHHHHHHHLL---L


DSSP  LEEEELLL----------------------------------------------------
Query FVYRELTP----------------------------------------------------   59
ident                                                             
Sbjct TLVIAHNKtlagqlysefkeffpnnaveyfvsyydyyqpeayvpqtdtfiekdasindei  117
DSSP  EEEELLLHhhhhhhhhhhhhhlllleeeeellleeeeelleeelllleeelleeeelhhh


DSSP  --------------------lLLLLHH---------------------------------
Query --------------------dNAPQLN---------------------------------   66
ident                                                             
Sbjct dklrhsatsalferrdviiiaSVSCIYglgspeeyremvvslrtemeiernellrklvdi  177
DSSP  hhhhhhhhhhhhhllleeeeeLHHHHLllllhhhhhhhleeeellllllhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   66
ident                                                             
Sbjct qyarndidfqrgtfrvrgdvveifpasrdehcvrveffgdeierirevdaltgeilgdrd  237
DSSP  lleelllllllleeeeelleeeeelllllleeeeeeelllleeeeeeeellllleeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   66
ident                                                             
Sbjct hvaifpashfvtraekmekaiqniekeleeqlkvmhengklleaqrleqrtrydlemmre  297
DSSP  eeeelllllllllhhhhhhhhhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhhhhh


DSSP  ------------------------HHHHHHL-LLLEEEE----LHHHLLH----------
Query ------------------------DFIALAQ-GGTLVLS----HPEHLTR----------   87
ident                                     |                       
Sbjct mgfcsgienysrhltlrppgstpyTLLDYFPdDFMIVVDeshvTIPQVRGmfngdqarkq  357
DSSP  hlllllhhhhhhhhllllllllllLHHHHLLlLLEEEEElhhhHHHHHHHhhhhhhhhhh


DSSP  -----------------HHHHHHHHHHhlllllLLEEEEELLLHHhhhhhllllhhhHHH
Query -----------------EQQYHLVQLQsqehrpFRLIGIGDTSLVelaasnhiiaelYYC  130
ident                                          |                  
Sbjct vlvdhgfrlpsaldnrpLRFEEFEKHM------HNIVYVSATPGP----------yeIEH  401
DSSP  hhhhlllllhhhhhlllLLHHHHHHLL------LEEEEELLLLLH----------hhHHH


DSSP  HHHhEEELLL--------------------------------------------------
Query FAXtQIACLP--------------------------------------------------  140
ident                                                             
Sbjct TDE-MVEQIIrptglldplidvrpiegqiddligeiqariernervlvttltkkmsedlt  460
DSSP  LLL-LEEELLlllllllleeeeellllhhhhhhhhhhhhhlllleeeeelllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct dylkeigikvnylhseiktlerieiirdlrlgkydvlvginllregldipevslvailda  520
DSSP  hhhhhlllleeeelllllhhhhhhhhhhhhhlllleeeelllllllllllleeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct dkegflrsersliqtigraarnaegrvimyadkitksmeiainetkrrreqqerfneehg  580
DSSP  llllllllhhhhhhhhhlllllllleeeeelllllhhhhhhhhhhhhhhhhhhhhhhhhl


DSSP  ---------------------------------------ll
Query ---------------------------------------lt  142
ident                                          
Sbjct itpktinkkerqkvveqmehemkeaakaldferaaelrdll  621
DSSP  llllllllhhhhhhhhhhhhhhhhhhhlllhhhhhhhhhhl


No 103: Query=mol1A Sbjct=2cvfA Z-score=5.9

back to top
DSSP  llllhhHHHHHHHHHHHLLLLLLEEEELLLLLLHHHHHHHHHHLlllllLLLEEEEL---
Query igrsewINQYRRRLQQLSETDIAVWLYGAPGTGRXTGARYLHQFgrnaqGEFVYREL---   57
ident              |            ||    |  | |               |      
Sbjct -mlstgTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLL---sgKKVAYVDTegg   56
DSSP  -lllllLLHHHHHHLLLLLLLLLLLEEELLLLLHHHHHHHHHHL---llLLEEEELLlll


DSSP  ---------------------------lllLLLLHHHHHHHHL------LLLEEEELHHH
Query ---------------------------tpdNAPQLNDFIALAQ------GGTLVLSHPEH   84
ident                                       |              |      
Sbjct fsperlvqmaetrglnpeealsrfilftpsDFKEQRRVIGSLKktvdsnFALVVVDSITA  116
DSSP  llllhhhhhhhhlllllllhhhleeeelllLLLLHHHHHHHHHhlllllLLLEEELLLLL


DSSP  ---------lLHHHHHHHHH-HHHL--LLLLlLEEEEELLL------hHHHHhhllLLHH
Query ---------lTREQQYHLVQ-LQSQ--EHRPfRLIGIGDTS------lVELAasnhIIAE  126
ident                    | |      |     | |                       
Sbjct hyraeenrsgLIAELSRQLQvLLWIarKHNI-PVIVINQVHfdsrtemTKPV----AEQT  171
DSSP  llllllllhhHHHHLLLHHHhHHHHhhHLLL-LLEEEEELLlllllllLLLL----LHHH


DSSP  HHHHHHhHEEEL----------------------------------llll
Query LYYCFAxTQIAC----------------------------------lplt  142
ident | |                                               
Sbjct LGYRCK-DILRLdklpkpglrvavlerhrfrpeglmayfritergiedve  220
DSSP  HHHHLL-LLLLEeelllllleeeellllllllllleeeleeelleeelll


No 104: Query=mol1A Sbjct=1n0wA Z-score=5.9

back to top
DSSP  llllhhhhhHHHHHHHH-lLLLL--LEEEELLLLLLHHHHHHHHHHLL------LLLLLL
Query igrsewinqYRRRLQQL-sETDI--AVWLYGAPGTGRXTGARYLHQFG------RNAQGE   51
ident                 |             |   ||       |              | 
Sbjct -eiiqittgSKELDKLLqgGIETgsITEXFGEFRTGKTQICHTLAVTCqlpidrGGGEGK   59
DSSP  -llleelllLHHHHHHLllLEELllEEEEELLLLLLHHHHHHHHHHHLlllhhhLLLLLE


DSSP  LEEEE--------------------------------LLLL-LLLLH-HHHHHH---hlL
Query FVYRE--------------------------------LTPD-NAPQL-NDFIAL---aqG   74
ident   |                                          ||     |       
Sbjct AXYIDtegtfrperllavaeryglsgsdvldnvayarAFNTdHQTQLlYQASAXxvesrY  119
DSSP  EEEEEllllllhhhhhhhhhhllllhhhhhhleeeeeLLLHhHHHHHhHHHHHHhhhllE


DSSP  LLEEEELHH----------hlLHHHHHHHHHHHHLllLLLLEEEEElllhhhhhhhllll
Query GTLVLSHPE----------hlTREQQYHLVQLQSQehRPFRLIGIGdtslvelaasnhii  124
ident   |                         |  |                            
Sbjct ALLIVDSATalyrelsarqxhLARFLRXLLRLADE--FGVAVVITN--------------  163
DSSP  EEEEEELLLhhhllhhhhhhhHHHHHHHHHHHHHH--HLLEEEEEL--------------


DSSP  hhHHHHHhhHEEELLLLL---------------------------------
Query aeLYYCFaxTQIACLPLT---------------------------------  142
ident          |                                         
Sbjct --AHAST--TRLYLRKGRgetrickiydspclpeaeaxfainadgvgdakd  210
DSSP  --LLLLL--EEEEEEELLlleeeeeelllllllleeeeeeeelleeellll


No 105: Query=mol1A Sbjct=1szpA Z-score=5.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl   60
DSSP  lllhhhhllllllhhhhhhhhllllllhhhhhhlllhhhhllllllhhhhhhhhhhhhhh


DSSP  ------------------llllhhhHHHHHHhHHHLLLL-LLEEEELLLLLLHHHHHHHH
Query ------------------igrsewiNQYRRRlQQLSETD-IAVWLYGAPGTGRXTGARYL   41
ident                                             | |   ||       |
Sbjct vpmgfvtaadfhmrrseliclttgsKNLDTL-LGGGVETgSITELFGEFRTGKSQLCHTL  119
DSSP  lllllllhhhhhhhhhllleellllHHHHHH-HLLLEELlLEEEEEELLLLLHHHHHHHH


DSSP  HHllLLLL--------LLLEEEEL---------------------------------LLL
Query HQfgRNAQ--------GEFVYREL---------------------------------TPD   60
ident                 |   |                                      |
Sbjct AV--TCQIpldigggeGKCLYIDTegtfrpvrlvsiaqrfgldpddalnnvayarayNAD  177
DSSP  LL--LLLLllllllllLEEEEEELlllllhhhhhhhhhhllllhhhhhhheeeeellLLL


DSSP  LLLLH-HHHH---hhhLLLLEEEELHHHL------------LHHHHHHHHHHHHLllLLL
Query NAPQL-NDFI---alaQGGTLVLSHPEHL------------TREQQYHLVQLQSQehRPF  104
ident     |                |      |                   |  |  |     
Sbjct HQLRLlDAAAqmmsesRFSLIVVDSVMALyrtdelsarqmhLAKFMRALQRLADQ--FGV  235
DSSP  LHHHHhHHLHhhhhhlLEEEEEEELHHHHhlllllhhhhhhHHHHHHHHHHHHHH--HLL


DSSP  LEEEEELLlhHHHHhhllllhhhHHHHhHHEEELLL------------------------
Query RLIGIGDTslVELAasnhiiaelYYCFaXTQIACLP------------------------  140
ident                              |                              
Sbjct AVVVTNQV-vTGGN-------imAHSS-TTRLGFKKgkgcqrlckvvdspclpeaecvfa  286
DSSP  LEEEEEEL-lLHHH-------hhHHHL-LEEEEEEElllleeeeelllllllllllllee


DSSP  ------ll
Query ------lt  142
ident         
Sbjct iyedgvgd  294
DSSP  eelleeel


No 106: Query=mol1A Sbjct=2gzaC Z-score=5.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deaavkraasvnfhleplrpwlddpqitevcvnrpgevfcerasaweyyavpnldyehli   60
DSSP  lhhhhhhhhhhhhhhhhhhhhhhllllleeeelllleeeeelllleeeeelllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct slgtatarfvdqdisdsrpvlsailpmgeriqivrppacehgtisvtirkpsftrrtled  120
DSSP  hhhhhhhhhhllllllllleeeeellllleeeeelllllllllleeeeellllllllhhh


DSSP  -----------------------llllhhhHHHHHHHHHHLLLLLLEEEELLLLLLHHHH
Query -----------------------igrsewiNQYRRRLQQLSETDIAVWLYGAPGTGRXTG   37
ident                                 |   |             |  | |  | 
Sbjct yaqqgffkhvrpmsksltpfeqellalkeaGDYMSFLRRAVQLERVIVVAGETGSGKTTL  180
DSSP  hhhllllllllllllllllllhhhhhhhhlLLHHHHHHHHHHLLLLEEEEELLLLLHHHH


DSSP  HHHHHHLLLlLLLLLEEEE-----------------lllLLLLLH-HHHHHHhLLLLEEE
Query ARYLHQFGRnAQGEFVYRE-----------------ltpDNAPQL-NDFIALaQGGTLVL   79
ident    | |            |                      |  |              |
Sbjct MKALMQEIP-FDQRLITIEdvpelflpdhpnhvhlfyppVTAATLlRSCLRM-KPTRILL  238
DSSP  HHHHHLLLL-LLLLEEEEElllllllllllleeeeelllLLHHHHhHHHLLL-LLLEEEE


DSSP  -ELHHHLlhhHHHHHHHHHhllllLLLEEEEELL-----LHHHHHHHLL-----------
Query -SHPEHLtreQQYHLVQLQsqehrPFRLIGIGDT-----SLVELAASNH-----------  122
ident                             |              ||               
Sbjct aELRGGE-ayDFINVAASG-----HGGSITSCHAgscelTFERLALMVLqnrqgrqlpye  292
DSSP  lLLLLLH-hhHHHHHHHLL-----LLLLEEEEELllhhhHHHHHHHHHLllllhhhllhh


DSSP  -LLHHHHHHHhHHEEELL------------------------lll
Query -IIAELYYCFaXTQIACL------------------------plt  142
ident  |   ||                                      
Sbjct iIRRLLYLVV-DVVVHVHngvhdgtgrhisevwydpntkralslq  336
DSSP  hHHHHHHHHL-LEEEEEEeellllleeeeeeeeelhhhhhhhhhl


No 107: Query=mol1A Sbjct=3cmtA Z-score=5.8

back to top
DSSP  llllhhhhhHHHHHHHH--lLLLL--LEEEELLLLLLHHHHHHHHHHLLLllLLLLEEEE
Query igrsewinqYRRRLQQL--sETDI--AVWLYGAPGTGRXTGARYLHQFGRnaQGEFVYRE   56
ident                 |          |  ||    |  |                    
Sbjct --vetistgSLSLDIALgagGLPMgrIVEIYGPESSGKTTLTLQVIAAAQreGKTCAFID   58
DSSP  --lleelllLHHHHHHLlllLEELllEEEEELLLLLLHHHHHHHHHHHHHllLLLEEEEL


DSSP  L----------------------LLLLLLL-HHHHHHH---hLLLLEEEELHH-------
Query L----------------------TPDNAPQ-LNDFIAL---aQGGTLVLSHPE-------   83
ident                         ||   | |    ||         |            
Sbjct AehaldpiyarklgvdidnllcsQPDTGEQaLEICDALarsgAVDVIVVDSVAaltpkae  118
DSSP  LlllllhhhhhhlllllllleeeLLLLHHHhHHHHHHHhhhlLLLEEEELLLLllllhhh


DSSP  --------------hLLHHHHHHHHHHHHLllLLLLEEEEELL---------lhHHHHhh
Query --------------hLTREQQYHLVQLQSQehRPFRLIGIGDT---------slVELAas  120
ident                        |     |      || |                    
Sbjct iegeigdshmglaarMMSQAMRKLAGNLKQ--SNTLLIFINQIrmkigvmfgnpETTT--  174
DSSP  hhlllllllllhhhhHHHHHHHHHHHHHHH--HLLEEEEEELEeelllllllllEEEL--


DSSP  LLLLhhHHHHHhHHEEELLL----------------------------------------
Query NHIIaeLYYCFaXTQIACLP----------------------------------------  140
ident       |                                                     
Sbjct GGNA--LKFYA-SVRLDIRRigavkegenvvgsetrvkvvknkiaapfkqaefqilygeg  231
DSSP  LLLH--HHHHE-EEEEEEEEeeeeeelleeeeeeeeeeeeeellllllleeeeeeellle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct infygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrell  291
DSSP  elhhhhhhhhhhhlllleeelleeeelleeeeehhhhhhhhhhhlhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct lsnpnsaidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgag  351
DSSP  llllllllhhhhhhhhhhhhhhhhhhhllllleehhhlhhhllleellllhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct glpmgriveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnl  411
DSSP  leellleeeeellllllhhhhhhhhhhhhhllllleeeelllllllhhhhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct lcsqpdtgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqa  471
DSSP  eeellllhhhhhhhhhhhhhhlllleeeellllllllhhhhhlllllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct mrklagnlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkeg  531
DSSP  hhhhhhhhhhhlleeeeeeleeellllllllleeellllhhhhheeeeeeeeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct envvgsetrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysyk  591
DSSP  leeeeeeeeeeeeeellllllleeeeeeellleelhhhhhhhhhhhlllleeelleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gekigqgkanatawlkdnpetakeiekkvrelllsnpnsaidenkqkalaaalgqiekqf  651
DSSP  leeeeehhhhhhhhhhhlhhhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gkgsimrlgedrsmdvetistgslsldialgagglpmgriveiygpessgkttltlqvia  711
DSSP  llllleehhhlhhhllleellllhhhhhhllllleellleeeeellllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct aaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqaleicdalarsgavdvi  771
DSSP  hhhllllleeeelllllllhhhhhhllllhhhleeellllhhhhhhhhhhhhhhllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct vvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnlkqsntllifinqirmkigv  831
DSSP  eellllllllhhhhhlllllllllhhhhhhhhhhhhhhhhhhhhlleeeeeeleeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct mfgnpetttggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefq  891
DSSP  llllleeellllhhhhheeeeeeeeeeeeeeelleeeeeeeeeeeeeellllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ilygeginfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiek  951
DSSP  eellleelhhhhhhhhhhhlllleeelleeeelleeeeehhhhhhhhhhhlhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct kvrelllsnpnsaidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsld 1011
DSSP  hhhhhhllllllllhhhhhhhhhhhhhhhhhhhlllleeehhhlhhhllleellllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ialgagglpmgriveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklg 1071
DSSP  hhllllleellleeeeellllllhhhhhhhhhhhhhllllleeeelllllllhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct vdidnllcsqpdtgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaa 1131
DSSP  llhhhleeellllhhhhhhhhhhhhhhlllleeeellllllllhhhhhlllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct rmmsqamrklagnlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirri 1191
DSSP  hhhhhhhhhhhhhhhhhlleeeeeeleeellllllllleeellllhhhhheeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gavkegenvvgsetrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekag 1251
DSSP  eeeeelleeeeeeeeeeeeeellllllleeeeeeellleelhhhhhhhhhhhlllleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct awysykgekigqgkanatawlkdnpetakeiekkvrelllsnpnsaidenkqkalaaalg 1311
DSSP  leeeelleeeeehhhhhhhhhhhlhhhhhhhhhhhhhhhllllllllhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct qiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiygpessgkttl 1371
DSSP  hhhhhhllllleehhhlhhhllleellllhhhhhhllllleellleeeeellllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct tlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqaleicdalars 1431
DSSP  hhhhhhhhhllllleeeelllllllhhhhhhllllhhhleeellllhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct gavdvivvdsvaaltpkaeiemglaarmmsqamrklagnlkqsntllifinqirnpettt 1491
DSSP  lllleeeelllllllllllllllhhhhhhhhhhhhhhhhhhhhlleeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilygeginf 1551
DSSP  lllhhhhheeeeeeeeeeeeeeelleeeeeeeeeeeeeellllllleeeeeeellleelh


DSSP  --------------------------------------------------------ll
Query --------------------------------------------------------lt  142
ident                                                           
Sbjct ygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll 1609
DSSP  hhhhhhhhhhlllleeelleeeelleeeeehhhhhhhhhhhlhhhhhhhhhhhhhhhl


No 108: Query=mol1A Sbjct=2ixfA Z-score=5.8

back to top
DSSP  --------------------------llllhhhhHHHHHhhhHLLLLLLEEEELLLLLLH
Query --------------------------igrsewinQYRRRlqqLSETDIAVWLYGAPGTGR   34
ident                                   |                | |  | | 
Sbjct splsgslaplnmkglvkfqdvsfaypnhpnvqvlQGLTF---TLYPGKVTALVGPNGSGK   57
DSSP  llllllllllllllleeeeeeeelllllllllleEEEEE---EELLLLEEEEELLLLLLH


DSSP  HHHHHHHHH-------------------llllLLLLLEEEEL------------------
Query XTGARYLHQ-------------------fgrnAQGEFVYREL------------------   57
ident  | |  |                                                     
Sbjct STVAALLQNlyqptggkvlldgeplvqydhhyLHTQVAAVGQepllfgrsfreniayglt  117
DSSP  HHHHHHHLLllllleeeeeelleehhhllhhhHHHHEEEELLllllllllhhhhhhllll


DSSP  ----------------------------------------LLLLLLL-HHHHHHHhLLLL
Query ----------------------------------------TPDNAPQ-LNDFIALaQGGT   76
ident                                                 |           
Sbjct rtptmeeitavamesgahdfisgfpqgydtevgetgnqlsGGQRQAVaLARALIR-KPRL  176
DSSP  llllhhhhhhhhhhhllhhhhhllllhhhllllhhhllllHHHHHHHhHHHHHHL-LLLE


DSSP  EEE-ELHHHLLHHHHHHHHHHH-HLLLL-lLLEEEEElLLHHhhhhhllllhhHHHHHhH
Query LVL-SHPEHLTREQQYHLVQLQ-SQEHR-pFRLIGIGdTSLVelaasnhiiaeLYYCFaX  133
ident | |      |    |     |              |    |            |      
Sbjct LILdQATSALDAGNQLRVQRLLyESPEWasRTVLLIT-HQLS-----------LAERA-H  223
DSSP  EEEeLLLLLLLHHHHHHHHHHHhHLLLLllLEEEEEL-LLHH-----------HHLLL-L


DSSP  HEEELLLL-----------------------l
Query TQIACLPL-----------------------t  142
ident                                 
Sbjct HILFLKEGsvceqgthlqlmerggcyrsmvea  255
DSSP  EEEEEELLeeeeeelhhhhhhhllhhhhhhhl


No 109: Query=mol1A Sbjct=2dr3D Z-score=5.7

back to top
DSSP  llllhhhhhhHHHHHHH--LLLL-LLEEEELLLLLLHHHHHHHHHHLLllLLLLLEEEEL
Query igrsewinqyRRRLQQL--SETD-IAVWLYGAPGTGRXTGARYLHQFGrnAQGEFVYREL   57
ident                 |         | | | ||||           |        |  |
Sbjct --trrvktgiPGVDEILhgGIPErNVVLLSGGPGTGKTIFSQQFLWNGlkMGEPGIYVAL   58
DSSP  --lleellllLLHHHHLllLEELlLEEEEEELLLLLHHHHHHHHHHHHhhLLLLEEEEEL


DSSP  --------------------------------LLLL-----------------lLLHH-H
Query --------------------------------TPDN-----------------aPQLN-D   67
ident                                                             
Sbjct eehpvqvrqnmaqfgwdvkpyeekgmfamvdaFTAGigkskeyekyivhdltdiREFIeV  118
DSSP  lllhhhhhhhhhhhllllhhhhhhlleeeeelLHHHhlllllllleelllllllHHHHhH


DSSP  HHHHH---LLLLEEEELHHHL-------lHHHHHHHHHHHHLllLLLLEEEEELL---lh
Query FIALA---QGGTLVLSHPEHL-------tREQQYHLVQLQSQehRPFRLIGIGDT---sl  114
ident              |      |        |     |             |          
Sbjct LRQAIrdiNAKRVVVDSVTTLyinkpamaRSIILQLKRVLAG--TGCTSIFVSQVsvger  176
DSSP  HHHHHhhlLLLEEEEELHHHHhlllhhhhHHHHHHHHHHHHH--LLLEEEEEEELlllll


DSSP  HHHHhhlLLLHhhHHHHhhHEEEL-----------------------------LLLL---
Query VELAasnHIIAelYYCFaxTQIAC-----------------------------LPLT---  142
ident                      |                                  |   
Sbjct GFGG---PGVE--HGVD--GIIRLdldeidgelkrslivwkmrgtshsmrrhpFDITdkg  229
DSSP  LLLL---LLHH--HHLL--EEEEEeeeeelleeeeeeeeeeellllllllleeEEEElle


DSSP  -------------
Query -------------  142
ident              
Sbjct iivypdkvlkrgk  242
DSSP  eeellllllllll


No 110: Query=mol1A Sbjct=1z6aA Z-score=5.7

back to top
DSSP  -------------------llllhhHHHHHHHHHHHLLLL---LLEEEELLLLLLHHHHH
Query -------------------igrsewINQYRRRLQQLSETD---IAVWLYGAPGTGRXTGA   38
ident                                                |    | |     
Sbjct lvprgshmasksfqllepynikanlRPYQIKGFSWMRFMNklgFGICLADDMGLGKTLQT   60
DSSP  lllllllllllllllllllllllllLHHHHHHHHHHHHHHhllLLEEELLLLLLLHHHHH


DSSP  HHHHHLL---LLLLlLLEEEELL-------------------------------------
Query RYLHQFG---RNAQgEFVYRELT-------------------------------------   58
ident                                                             
Sbjct IAVFSDAkkeNELT-PSLVICPLsvlknweeelskfaphlrfavfhedrskikledydii  119
DSSP  HHHHHHLlllLLLL-LEEEELLHhhhhhhhhhhhhhllllleeelllllllllhhhllee


DSSP  llLLLLH---hhHHHHhLLLLEEEEL----hHHLLhHHHHHHHHHhhllllLLLEEEEEL
Query pdNAPQL---ndFIALaQGGTLVLSH----pEHLTrEQQYHLVQLqsqehrPFRLIGIGD  111
ident       |               |           |         |          |    
Sbjct ltTYAVLlrdtrLKEV-EWKYIVIDEaqnikNPQT-KIFKAVKEL-----kSKYRIALTG  172
DSSP  eeLLHHHhllllLLLL-LLLEEEEELlllllLLLL-HHHHHHLLL-----lLLEEEEELL


DSSP  LLhHHHHHhlLLLHHHHHHH----------------------------------hHHEEE
Query TSlVELAAsnHIIAELYYCF----------------------------------aXTQIA  137
ident |   |                                                       
Sbjct TP-IENKV--DDLWSIMTFLnpgllgsysefkskfatpikkgdnmakeelkaiisPFILR  229
DSSP  LL-LLLLH--HHHHHHHHHHlllllllhhhhhhhlhhhhhlllhhhhhhhhhhhhHHEEL


DSSP  L-----------------------------------------------------------
Query C-----------------------------------------------------------  138
ident                                                             
Sbjct Rtkydkaiindlpdkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstll  289
DSSP  Lllllhhhhhhllleeeeeeeelllhhhhhhhhhhhhhhhllllllllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  138
ident                                                             
Sbjct klkqivdhpallkggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniie  349
DSSP  hhhhhhhlhhhlllllllhhhlhhhhhhhhhhhhhhhlllleeeelllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  138
ident                                                             
Sbjct kelntevpflygelskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrw  409
DSSP  hhlllllleeellllhhhhhhhhhhhhlllllllleeelllllllllllllleeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  138
ident                                                             
Sbjct wdqatdrvyrigqtrnvivhklisvgtleekidqllafkrslfkdiissgdswitelste  469
DSSP  llhhhhhhhllllllleeeeeeeelllhhhhhhhhhhllllllllllllhhhhlllllhh


DSSP  -------llll
Query -------lplt  142
ident            
Sbjct elrkvielsvg  480
DSSP  hhhhhllllll


No 111: Query=mol1A Sbjct=3gfoA Z-score=5.7

back to top
DSSP  ---------------LLLLhhHHHHHhhhHHHLlLLLLEEEELLLLLLHHHHHHHHHH--
Query ---------------IGRSewINQYRrrlQQLSeTDIAVWLYGAPGTGRXTGARYLHQ--   43
ident                 |                         |  | |  |         
Sbjct edyilkveelnynysDGTH-aLKGIN---MNIK-RGEVTAILGGNGVGKSTLFQNFNGil   55
DSSP  lleeeeeeeeeeellLLLE-eEEEEE---EEEE-LLLEEEEELLLLLLHHHHHHHHLLll


DSSP  -------LLLL------------LLLLLEEEELLLLL-----------------------
Query -------FGRN------------AQGEFVYRELTPDN-----------------------   61
ident           |                       |||                       
Sbjct kpssgriLFDNkpidysrkgimkLRESIGIVFQDPDNqlfsasvyqdvsfgavnmklped  115
DSSP  llleeeeEELLeellllhhhhhhHHHLEEEELLLHHHllllllhhhhhhhhhhlllllhh


DSSP  -------------------------------LLLH-HHHHHHhLLLLEEEELHHH-----
Query -------------------------------APQL-NDFIALaQGGTLVLSHPEH-----   84
ident                                                | |  |       
Sbjct eirkrvdnalkrtgiehlkdkpthclsfgqkKRVAiAGVLVM-EPKVLILDEPTAgldpm  174
DSSP  hhhhhhhhhhhhlllhhhllllhhhllhhhhHHHHhHHHHLL-LLLEEEEELLLLlllhh


DSSP  lLHHHHHHHHHHHHLllLLLLEEEEElLLHHhhhhhllllhhhHHHHhHHEEELLLL---
Query lTREQQYHLVQLQSQehRPFRLIGIGdTSLVelaasnhiiaelYYCFaXTQIACLPL---  141
ident    |    ||  |         |                                     
Sbjct gVSEIMKLLVEMQKE--LGITIIIAT-HDID----------ivPLYC-DNVFVMKEGrvi  220
DSSP  hHHHHHHHHHHHHHH--HLLEEEEEE-LLLL----------lhHHHL-LEEEEEELLeee


DSSP  ------------------------------l
Query ------------------------------t  142
ident                                
Sbjct lqgnpkevfaekevirkvnlrlprighlmei  251
DSSP  eeelhhhhlhhhhhhhhhhhhlhhhhhhlll


No 112: Query=mol1A Sbjct=2r6fA Z-score=5.7

back to top
DSSP  --------llllHHHHhhHHHHhhhllLLLLEEEELLLLLLHHHHHH-HHHHLL------
Query --------igrsEWINqyRRRLqqlseTDIAVWLYGAPGTGRXTGAR-YLHQFG------   45
ident                |               | | |  | |    |       |      
Sbjct xdkiivkgarahNLKN--IDVE---ipRGKLVVLTGLSGSGKSSLAFdTIYAEGqrryve   55
DSSP  lleeeeeeelllLLLL--EEEE---eeLLLEEEEEELLLLLHHHHHLlLHHHHHhhhhhl


DSSP  ----------------------LLLLllLEEEEL--------------------------
Query ----------------------RNAQgeFVYREL--------------------------   57
ident                                                             
Sbjct slsayarqflgqxekpdvdaieGLSP--AISIDQkttsrnprstvgtvteiydylrllfa  113
DSSP  lllhhhhhhhhlllllleeeeeLLLL--EEEELLllllllllllhhhhllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   57
ident                                                             
Sbjct rigrpicpthgieiqsqtieqxvdrllsypertkxqilapidvvvdriiikdgiaarlad  173
DSSP  hlleelllllllllllllhhhhhhhhhlllllleeeeeellleeeeeeelllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   57
ident                                                             
Sbjct sletalkladgkvvvdvigegellfsekhacpycgfsigeleprlfsfnspfgacpdcdg  233
DSSP  hhhhhhhhllleeeeeellllleeeelleelllllleeelllhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   57
ident                                                             
Sbjct lgaklevdldlvipndeltlkehaiapwepyypqlleavcrhygipxdvpvkdlpkeqld  293
DSSP  lleeeeelhhhhlllllllhhhlllllllllhhhhhhhhhhhhlllllllhhhllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   57
ident                                                             
Sbjct kilygsggepiyfrytndfgqvreqyiafegvipnverryretssdyireqxekyxaeqp  353
DSSP  hhhhlllllllllllllllllllllllllllhhhhhhhhhhhlllllhhhhhhhheeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   57
ident                                                             
Sbjct cptcqgyrlkkeslavlvggkhigevtaxsvtealaffdgleltekeaqiarlilreird  413
DSSP  llllllllllllllleelllllhhhhhlllhhhhhhhhhhllllhhhhhhlhhhhhhhhh


DSSP  -----------------------LLLLLLLH-HHHHHH-hLLLLEEEELHHH-----lLH
Query -----------------------TPDNAPQL-NDFIAL-aQGGTLVLSHPEH-----lTR   87
ident                                    |     |   ||  |          
Sbjct rlgflqnvgldyltlsrsagtlsGGEAQRIRlATQIGSrlTGVLYVLDEPSIglhqrdND  473
DSSP  hhhhhhhhllllllllllhhhllHHHHHHHHhHHHHLLllLLLEEEEELLLLlllhhhHH


DSSP  HHHHHHHHHHHlllLLLLEEEEEllLHHHhhhhllllhhhHHHHhhHEEELL--------
Query EQQYHLVQLQSqehRPFRLIGIGdtSLVElaasnhiiaelYYCFaxTQIACL--------  139
ident      |            ||                            |           
Sbjct RLIATLKSXRD---LGNTLIVVE--HDED---------txLAAD--YLIDIGpgagihgg  517
DSSP  HHHHHHHHHHL---LLLEEEEEL--LLHH---------hhHLLL--EEEEELlllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct evvaagtpeevxndpnsltgqylsgkkfipipaerrrpdgrwlevvgarehnlknvsvki  577
DSSP  leeeeelllllllllllllhhhhhllllllllllllllllleeeeeeellllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct plgtfvavtgvsgsgkstlvnevlykalaqklhrakakpgehrdirglehldkvididqs  637
DSSP  ellleeellllllllhhhhhlllhhhhhhhhhhlllllllllleeelhhhlleeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct pigrtprsnpatytgvfddirdvfastneakvrgykkgrfsfnvkggrceachgdgiiki  697
DSSP  lllllllllhhhhhlhhhhhhhhhhllhhhhhlllllllllllllllllllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct exhflpdvyvpcevchgkrynretlevtykgkniaevldxtvedaldffasipkikrkle  757
DSSP  llllllleeeellllllllllllhhhlllllllhhhhhlllhhhhhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct tlydvglgyxklgqpattlsggeaqrvklaaelhrrsngrtlyildepttglhvddiarl  817
DSSP  hhhhlllllllllllhhhllhhhhhhhhhhhhhllllllleeeeeelllllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct ldvlhrlvdngdtvlviehnldviktadyiidlgpeggdrggqivavgtpeevaevkesh  877
DSSP  hhhhhhhhhllleeeeelllhhhhlllleeeeelllllllllleeeeelhhhhhlllllh


DSSP  -------------------lll
Query -------------------plt  142
ident                       
Sbjct tgrylkpilerdrarxqaryea  899
DSSP  hhhhhhhhhhhhhhhhhhhhll


No 113: Query=mol1A Sbjct=2zj8A Z-score=5.7

back to top
DSSP  ------------------lllLHHH---hhhHHHHhhHLLLlLLEEEELLLLLLHHHHHH
Query ------------------igrSEWI---nqyRRRLqqLSETdIAVWLYGAPGTGRXTGAR   39
ident                                        |             |    | 
Sbjct mrvdelrvderikstlkergiESFYppqaeaLKSG--ILEG-KNALISIPTASGKTLIAE   57
DSSP  llhhhllllhhhhhhhhhlllLLLLhhhhhhHLLL--HHHL-LEEEEELLHHHLHHHHHH


DSSP  HHHHLLL-lLLLLLEEEELLLL--------------------------------------
Query YLHQFGR-nAQGEFVYRELTPD--------------------------------------   60
ident            |  ||                                            
Sbjct IAMVHRIltQGGKAVYIVPLKAlaeekfqefqdwekiglrvamatgdydskdewlgkydi  117
DSSP  HHHHHHHhhHLLEEEEELLLHHhhhhhhhhlhhhhhhllleeeellllllllhhhhhlle


DSSP  ---llLLHHH-----hhhhhLLLLEEEELHHHL-----LHHHHHHHHHHHhlllLLLLEE
Query ---naPQLND-----fialaQGGTLVLSHPEHL-----TREQQYHLVQLQsqehRPFRLI  107
ident                         ||                   |             |
Sbjct iiataEKFDSllrhgsswikDVKILVADEIHLIgsrdrGATLEVILAHML----GKAQII  173
DSSP  eeelhHHHHHhhhhllllhhHEEEEEEELHHHHhllllHHHHHHHHHHHL----LLLEEE


DSSP  EEELLlhHHHHhhllllhhhHHHHhhHEEE------------------------------
Query GIGDTslVELAasnhiiaelYYCFaxTQIA------------------------------  137
ident |   |                       |                               
Sbjct GLSAT--IGNP-----eelaEWLN-aELIVsdwrpvklrrgvfyqgfvtwedgsidrfss  225
DSSP  EEELL--LLLH-----hhhhHHLL-eEEEElllllleeeeeeeelleeeelllleeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct weelvydairkkkgalifvnmrrkaervalelskkvkslltkpeiralneladsleenpt  285
DSSP  llhhhhhhhhlllleeeelllhhhhhhhhhhhhhhhhhhllhhhhhhhhhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct neklakairggvafhhaglgrdervlveenfrkgiikavvatptlsagintpafrviird  345
DSSP  hhhhhhhhllleeeelllllhhhhhhhhhhhhllllleeeellllhhhlllllleeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct iwrysdfgmeripiievhqmlgragrpkydevgegiivstsddprevmnhyifgkpeklf  405
DSSP  leelllllleellhhhhhhhhlllllllllleeeeeeelllllhhhhhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct sqlsnesnlrsqvlaliatfgystveeilkfisntfyayqrkdtysleekirnilyflle  465
DSSP  lllllhhhhhhhhhhhhhhlllllhhhhhhhhhllhhhhhllllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct nefieisledkirplslgirtaklyidpytakmfkdkmeevvkdpnpigifhlisltpdi  525
DSSP  llleeellllleeelhhhhhhhhhlllhhhhhhhhhhhhhhhhlllhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct tpfnyskreferleeeyyefkdrlyfddpyisgydpylerkffrafktalvllawinevp  585
DSSP  llllllhhhhhhhhhhhhhhhhhllllllllllllhhhhhhhhhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  137
ident                                                             
Sbjct egeivekysvepgdiyrivetaewlvyslkeiakvlgayeivdyletlrvrvkygireel  645
DSSP  hhhhhhhhlllhhhhhhhhhhhhhhhhhhhhhhhhhllhhhhhhhhhhhhhhhhlllhhh


DSSP  --------------------------------------------------lllll
Query --------------------------------------------------clplt  142
ident                                                        
Sbjct iplmqlplvgrrraralynsgfrsiedisqarpeellkiegigvktveaifkflg  700
DSSP  hhhlllllllhhhhhhhhllllllhhhhhlllhhhhhllllllhhhhhhhhhhhl


No 114: Query=mol1A Sbjct=1ewqA Z-score=5.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct xegxlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth   60
DSSP  llllllllllllllhhhhhhhhhhhhlllleeeeeelleeeeehhhhhhhhhhhllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ktskdfttpxagiplrafeayaerllkxgfrlavadqvepaeeaeglvrrevtqlltpgt  120
DSSP  eelllleeeeeeeehhhhhhhhhhhhhlllleeeeeelllhhhlllllleeeeeeelhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll  180
DSSP  lllhhhllllllleeeeeellleeeeeeelllleeeeeeellhhhhhhhhhhhllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct apellengafldefrkrfpvxlseapfepegegplalrrargallayaqrtqggalslqp  240
DSSP  lhhhhhlhhhhhhhhhhllleeelllllllllllhhhhhhhhhhhhhhhhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct frfydpgafxrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg  300
DSSP  leellhhhlllllhhhhhhllllllllllllhhhhhlllllhhhhhhhhhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp  360
DSSP  hhhhhhhhhhhhhhlhhhhhhhhhhhlllllhhhhhhhhhlllllhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva  420
DSSP  hhhhhhlllllllllhhhhhhhhhhllllllllllllllllllllhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe  480
DSSP  hhhhhhhhhhhhhllllleeeeellleeeeeeehhhhhhllllleeeeellleeeeelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct xkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry  540
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllhhhhhhhhhhhhhhhhhhhhhhhhhhh


DSSP  ----------------------lLLLHhhhhHHHHhhhhLLLL-LLEEEELLLLLLHHHH
Query ----------------------iGRSEwinqYRRRlqqlSETD-IAVWLYGAPGTGRXTG   37
ident                                         |     |   |    |  | 
Sbjct gyvrprfgdrlqiragrhpvverRTEF----VPND----LEXAhELVLITGPNXAGKSTF  592
DSSP  llllleellleeeeeellllhhhLLLL----LLEE----EEELlLEEEEELLLLLLHHHH


DSSP  HHHHHHLL---------------LLLLLLLEEEE----lLLLLLLL-HHHHHHHHL-LLL
Query ARYLHQFG---------------RNAQGEFVYRE----lTPDNAPQ-LNDFIALAQ-GGT   76
ident  |                              |      |              |     
Sbjct LRQTALIAllaqvgsfvpaeeahLPLFDGIYTRIgagksTFXVEXEeVALILKEATeNSL  652
DSSP  HHHHHHHHhhhllllllllleeeELLLLEEEEELlllllHHHHHHHhHHHHHHHLLlLEE


DSSP  EEEELHHH---------LLHHHHHHHHHHHhlllllLLEEEEElLLHHhhhhhllllHHH
Query LVLSHPEH---------LTREQQYHLVQLQsqehrpFRLIGIGdTSLVelaasnhiiAEL  127
ident   |                      |                               |  
Sbjct VLLDEVGRgtssldgvaIATAVAEALHERR------AYTLFAT-HYFE-------ltALG  698
DSSP  EEEELLLLlllhhhhhhHHHHHHHHHHHHL------LEEEEEL-LLHH-------hhLLL


DSSP  HHHHhhHEEEL-----------LLLL----------------------------------
Query YYCFaxTQIAC-----------LPLT----------------------------------  142
ident                                                             
Sbjct LPRL--KNLHVaareeagglvfYHQVlpgpasksygvevaaxaglpkevvararallqax  756
DSSP  LLLE--EEEEEeeelllllleeEEEEeelllllllhhhhhhhllllhhhhhhhhhhhhhh


DSSP  ---
Query ---  142
ident    
Sbjct aar  759
DSSP  lll


No 115: Query=mol1A Sbjct=1p9wA Z-score=5.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sddffslaeelapiiklinaxlgeaikegasdihietfektlsirfrvdgvlrevlapsr   60
DSSP  lllhhhhhllllhhhhhhhhhhhhhhhhllleeeeeeelleeeeeeeelleeeeeelllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct klssllvsrvkvxakldiaekrvpqdgrislrigavdvrvstxpsshgervvxrlldkna  120
DSSP  hhhhhhhhhhhhhhlllllllllleeeeeeelllleeeeeeeelllllleeeelleelll


DSSP  ----llllHHHHHHHHHHHHHLLLL-LLEEEELLLLLLHHHHHHHHHHLLLLlLLLLEEE
Query ----igrsEWINQYRRRLQQLSETD-IAVWLYGAPGTGRXTGARYLHQFGRNaQGEFVYR   55
ident                     |           |  | |  |      |            
Sbjct trldlhslGXTAHNHDNFRRLIKRPhGIILVTGPTGSGKSTTLYAGLQELNSsERNILTV  180
DSSP  llllhhhlLLLHHHHHHHHHHLLLLlEEEEEELLLLLLHHHHHHHHHHHHLLlLLLEEEE


DSSP  E-----------------lllLLLLLH-HHHHHHhLLLLEEE-ELHHHLlhhHHHHHHHH
Query E-----------------ltpDNAPQL-NDFIALaQGGTLVL-SHPEHLtreQQYHLVQL   96
ident |                                                           
Sbjct EdpiefdidgigqtqvnprvdXTFARGlRAILRQ-DPDVVXVgEIRDLEtaqIAVQASLT  239
DSSP  ElllllllllleeeellhhhlLLHHHHhHHHHHL-LLLEEEElLLLLHHhhhHHHHHHHL


DSSP  HhlllllLLEEEEELL----LHHHHHHHLLLL-HHHHHHHhHHEEELL------------
Query QsqehrpFRLIGIGDT----SLVELAASNHII-AELYYCFaXTQIACL------------  139
ident                |      |       |              |              
Sbjct G------HLVXSTLHTntavGAVTRLRDXGIEpFLISSSL-LGVLAQRlvrtlcpdckep  292
DSSP  L------LEEEEEELLllhhHHHHHHHHHLLLhHHHHHHE-EEEEEEEeeeeelllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct yeadkeqrklfeplilyratgcpkcnhkgyrgrtgihelllvddalqelihseageqaxe  352
DSSP  eellhhhhlllllleeeellllllllllleeeeeeeeeeeellhhhhhhhhllllhhhhh


DSSP  -----------------------------lll
Query -----------------------------plt  142
ident                                 
Sbjct khirattpsirddgldkvrqgitsleevxrgs  384
DSSP  hhhhlllllhhhhhhhhhhlllllhhhhhhll


No 116: Query=mol1A Sbjct=1vplA Z-score=5.6

back to top
DSSP  -----------llLLHHHHhhHHHHhhhLLLL-LLEEEELLLLLLHHHHHHH--------
Query -----------igRSEWINqyRRRLqqlSETD-IAVWLYGAPGTGRXTGARY--------   40
ident                |                     | |  | |  |  |         
Sbjct gavvvkdlrkrigKKEILK--GISF---EIEEgEIFGLIGPNGAGKTTTLRIistlikps   55
DSSP  lleeeeeeeeeelLEEEEE--EEEE---EELLlLEEEEELLLLLLHHHHHHHhlllllll


DSSP  -hhHLLL---------lLLLLLEEEELLLL------------------------------
Query -lhQFGR---------nAQGEFVYRELTPD------------------------------   60
ident                        |                                    
Sbjct sgiVTVFgknvveepheVRKLISYLPEEAGayrnmqgieylrfvagfyasssseieemve  115
DSSP  eeeEEELleellllhhhHHLLEEEELLLLLllllllhhhhhhhhhhhhlllhhhhhhhhh


DSSP  -----------------------lLLLH-HHHHHHhLLLLEEEELHHH-----lLHHHHH
Query -----------------------nAPQL-NDFIALaQGGTLVLSHPEH-----lTREQQY   91
ident                            |              |  |         ||   
Sbjct rateiaglgekikdrvstyskgmvRKLLiARALMV-NPRLAILDEPTSgldvlnAREVRK  174
DSSP  hhhhhhllhhhhhllhhhllhhhhHHHHhHHHHLL-LLLEEEEELLLLlllhhhHHHHHH


DSSP  HHHHHHHLlllLLLEEEEELllHHHHhhhllllhhhHHHHhHHEEELLLL----------
Query HLVQLQSQehrPFRLIGIGDtsLVELaasnhiiaelYYCFaXTQIACLPL----------  141
ident  | |                                                        
Sbjct ILKQASQE---GLTILVSSH--NMLE---------vEFLC-DRIALIHNGtivetgtvee  219
DSSP  HHHHHHHL---LLEEEEEEL--LHHH---------hLLLL-LEEEEEELLeeeeeeehhh


DSSP  ------------------l
Query ------------------t  142
ident                    
Sbjct lkerykaqnieevfeevvk  238
DSSP  hhhhlllllhhhhhhhhhl


No 117: Query=mol1A Sbjct=1v5wA Z-score=5.6

back to top
DSSP  -------------llllhhhhhHHHHHHHHlLLLL---LEEEELLLLLLHHHHHHHHHHL
Query -------------igrsewinqYRRRLQQLsETDI---AVWLYGAPGTGRXTGARYLHQF   44
ident                              |             |   ||       |   
Sbjct pgfltafeysekrkmvfhittgSQEFDKLLgGGIEsmaITEAFGEFRTGKTQLSHTLCVT   60
DSSP  llleehhhhhhhhhhlllllllLHHHHHHLlLLLLlleEEEEELLLLLLHHHHHHHHHHH


DSSP  LL------llLLLLEEEE--------------------------------LLLL-LLLLH
Query GR------naQGEFVYRE--------------------------------LTPD-NAPQL   65
ident            |                                               |
Sbjct AQlpgaggypGGKIIFIDtentfrpdrlrdiadrfnvdhdavldnvlyarAYTSeHQMEL  120
DSSP  LLllllllllLLEEEEEEllllllhhhhhhhhhhllllhhhhhhleeeeeLLLLlHHHHH


DSSP  -HHHHHH-----hlLLLEEEELHH-----------------hlLHHHHHHHHHHHHLllL
Query -NDFIAL-----aqGGTLVLSHPE-----------------hlTREQQYHLVQLQSQehR  102
ident      |           |                                |         
Sbjct lDYVAAKfheeagiFKLLIIDSIMalfrvdfsgrgelaerqqkLAQMLSRLQKISEE--Y  178
DSSP  hHHHHHHhhhllllEEEEEEELLHhhhhhhllhhhlhhhhhhhHHHHHHHHHHHHHH--H


DSSP  LLLEEEEELLlhhhhhhhllllHHHHHHHHhHEEELLL----------------------
Query PFRLIGIGDTslvelaasnhiiAELYYCFAxTQIACLP----------------------  140
ident                         |      | |                          
Sbjct NVAVFVTNQM-----------gHILAHAST-TRISLRKgrgelriakiydspempeneat  226
DSSP  LLEEEEEELL-----------lLLLLLLLL-EEEEEEElllleeeeeeeellllllllee


DSSP  -----------ll
Query -----------lt  142
ident              
Sbjct faitaggigdake  239
DSSP  eeeelleeeelll


No 118: Query=mol1A Sbjct=2zucB Z-score=5.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ktindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqkiikeardaldi   60
DSSP  llhhhlllllllhhhhhhllllllhhhhhlllhhhhhhhllllhhhhhhhhhhhhhllll


DSSP  ---------------llllhhHHHHHHHHHHhLLLL-LLEEEELLLLLLHHHHHHHHHHL
Query ---------------igrsewINQYRRRLQQlSETD-IAVWLYGAPGTGRXTGARYLHQF   44
ident                             |              |  | |       |   
Sbjct rfktalevkkermnvkkistgSQALDGLLAG-GIETrTMTEFFGEFGSGKTQLCHQLSVN  119
DSSP  lleehhhhhhhhhllleelllLHHHHHHLLL-LEELlLEEEEEELLLLLHHHHHHHHHHH


DSSP  L-------LLLLLlLEEEELL------------------------------lLLLLL-HH
Query G-------RNAQGeFVYRELT------------------------------pDNAPQ-LN   66
ident                ||                                    |      
Sbjct VqlppekgGLSGK-AVYIDTEgtfrwerienmakalgldidnvmnniyyiraINTDHqIA  178
DSSP  LlllhhhlLLLLE-EEEEELLllllhhhhhhhhhlllllhhhhhhleeeeelLLHHHhHH


DSSP  HHHHH-------hlLLLEEE-ELHHHL-------------LHHHHHHHHHHHH--LLLLl
Query DFIAL-------aqGGTLVL-SHPEHL-------------TREQQYHLVQLQS--QEHRp  103
ident     |             |  |   |                    || ||         
Sbjct IVDDLqelvskdpsIKLIVVdSVTSHFraeypgrenlavrQQKLNKHLHQLTRlaEVYD-  237
DSSP  HHHHHhhhhhllllEEEEEEeLLHHHHhhhllllllhhhhHHHHHHHHHHHHHhhHHHL-


DSSP  LLEEEEELLlhhhhhhHLLLlhhhHHHHhhHEEELLL-----------------------
Query FRLIGIGDTslvelaaSNHIiaelYYCFaxTQIACLP-----------------------  140
ident    |                            |                           
Sbjct IAVIITNQV-marpdmHTLY----HVPG--IRIQLKKsrgnrriarvvdaphlpegevvf  290
DSSP  LEEEEEEEL-llllllLLLL----LLLL--EEEEEEElllleeeeeeeellllllleeee


DSSP  ---------ll
Query ---------lt  142
ident            
Sbjct alteegirdae  301
DSSP  eelllleelll


No 119: Query=mol1A Sbjct=1nlfA Z-score=5.6

back to top
DSSP  -llllhhhhhhhhhhhhhlLLLL-------LEEEELLLLLLHHHHHHHHHHLLL------
Query -igrsewinqyrrrlqqlsETDI-------AVWLYGAPGTGRXTGARYLHQFGR------   46
ident                                  |    | |    |  |           
Sbjct athkpinileafaaappplDYVLpnmvagtVGALVSPGGAGKSMLALQLAAQIAggpdll   60
DSSP  lllllllhhhhhhllllllLEEElleelllEEEEEELLLLLHHHHHHHHHHHHHllllll


DSSP  ----llLLLLEEEEL-----------------------------------llLLLL----
Query ----naQGEFVYREL-----------------------------------tpDNAP----   63
ident        |   |                                                
Sbjct evgelpTGPVIYLPAedpptaihhrlhalgahlsaeerqavadglliqpligSLPNimap  120
DSSP  llllllLLLEEEEELlllhhhhhhhhhhhhllllhhhhhhhhhheeelllllLLLLlllh


DSSP  -LHHHHHHHHL-LLLEEEELHHH----------lLHHHHHHHHHHHHLllLLLLEEEEEL
Query -QLNDFIALAQ-GGTLVLSHPEH----------lTREQQYHLVQLQSQehRPFRLIGIGD  111
ident          |      ||                                          
Sbjct eWFDGLKRAAEgRRLMVLDTLRRfhieeenasgpMAQVIGRMEAIAAD--TGCSIVFLHH  178
DSSP  hHHHHHHHHHLlLLEEEEELHHHhlllllllhhhHHHHHHHHHHHHHH--HLLEEEEEEE


DSSP  LlhhhhhhhllllhhhHHHHhhHEEELLL-------------------------------
Query TslvelaasnhiiaelYYCFaxTQIACLP-------------------------------  140
ident                        |                                    
Sbjct A------------vlvDNIR--WQSYLSSmtsaeaeewgvdddqrrffvrfgvskanyga  224
DSSP  L------------llhHHLL--LEEEEEEllhhhhhhlllllllhhheeeeeeeelllll


DSSP  ----------------------------ll
Query ----------------------------lt  142
ident                               
Sbjct pfadrwfrrhdggvlkpavlerqrkskgvp  254
DSSP  lllleeeeelhhhleeelllllllllllll


No 120: Query=mol1A Sbjct=3iceC Z-score=5.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct xnltelkntpvselitlgenlenlarxrkqdiifailkqhaksgedifgdgvleilqdgf   60
DSSP  llhhhhhhllhhhhhhhhhlllllllllhhhhhhhhhhhhhhlllleeeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevnfd  120
DSSP  eeeelhhhlllllllleeelhhhhhhllllllleeeeeeellllllllleelllleelll


DSSP  --------------------------lllLHHHHHHHHHHHH-HLLLL-LLEEEEL-LLL
Query --------------------------igrSEWINQYRRRLQQ-LSETD-IAVWLYG-APG   31
ident                                      | |                    
Sbjct kpenarnkilfenltplhansrlrxergnGSTEDLTARVLDLaSPIGRgQRGLIVApPKA  180
DSSP  llhhhhllllllllleellllllllllllLLLLHHHHHHHHHhLLLLLlLEEEEEElLLL


DSSP  L--LHHHHHHHHHHLllLLLLLLEEEELL-------------------------LLLLL-
Query T--GRXTGARYLHQFgrNAQGEFVYRELT-------------------------PDNAP-   63
ident                                                             
Sbjct GktXLLQNIAQSIAY-nHPDCVLXVLLIDerpeevtexqrlvkgevvastfdepASRHVq  239
DSSP  LhhHHHHHHHHHHHH-hLLLLEEEEEEELllhhhhhhhhhhllleeeeelllllHHHHHh


DSSP  LHHHHHHHHL-------LLLEEEELHHHLL----------------------HHHHHHHH
Query QLNDFIALAQ-------GGTLVLSHPEHLT----------------------REQQYHLV   94
ident      |  |             |     |                               
Sbjct VAEXVIEKAKrlvehkkDVIILLDSITRLArayntvvpasgkvltggvdanaLHRPKRFF  299
DSSP  HHHHHHHHHHhhhhhllEEEEEEELHHHHHhhhhhhlllllleellleelllLHHHHHHH


DSSP  HHHHLL--llLLLEEEEELLlhhhhhHHLL--LLHHHHHHHhHHEEE-------------
Query QLQSQE--hrPFRLIGIGDTslvelaASNH--IIAELYYCFaXTQIA-------------  137
ident               |                 |  |                        
Sbjct GAARNVeeggSLTIIATALI---dtgSKXDevIYEEFKGTG-NXELHlsrkiaekrvfpa  355
DSSP  LLLEEEllllEEEEEEEEEL---lllLHHHhhHHHHHHLLL-LEEEElllllllllllll


DSSP  -----------------------------------------------------lllll
Query -----------------------------------------------------clplt  142
ident                                                           
Sbjct idynrsgtrkeellttqeelqkxwilrkiihpxgeidaxeflinklaxtktnddffex  413
DSSP  lllllleellhhhlllhhhhhhhhhhhhhhllllhhhhhhhhhhhhllllhhhhhhhl


No 121: Query=mol1A Sbjct=2cbzA Z-score=5.5

back to top
DSSP  --------------LLLLhhhhHHHHhhhhHLLLL-LLEEEELLLLLLHHHHHHHHHH--
Query --------------IGRSewinQYRRrlqqLSETD-IAVWLYGAPGTGRXTGARYLHQ--   43
ident                                |      |   |  | |       |    
Sbjct nsitvrnatftwarSDPP--tlNGIT----FSIPEgALVAVVGQVGCGKSSLLSALLAem   54
DSSP  lleeeeeeeeelllLLLL--leEEEE----EEELLlLEEEEELLLLLLHHHHHHHHLLll


DSSP  ----llllLLLLLEEEELL-----------------------------------------
Query ----fgrnAQGEFVYRELT-----------------------------------------   58
ident           |   |                                             
Sbjct dkveghvaIKGSVAYVPQQawiqndslrenilfgcqleepyyrsviqacallpdleilps  114
DSSP  eeeeeeeeELLLEEEELLLllllleehhhhhhllllllllhhhhhhhhlllhhhhlllll


DSSP  ---------------LLLLLL-HHHHHHHHLlLLEEEELHHH-----lLHHHHHHH----
Query ---------------PDNAPQ-LNDFIALAQgGTLVLSHPEH-----lTREQQYHL----   93
ident                       |                |                    
Sbjct gdrteigekgvnlsgGQKQRVsLARAVYSNA-DIYLFDDPLSavdahvGKHIFENVigpk  173
DSSP  hhhleellllllllhHHHHHHhHHHHHHHLL-LEEEEELLLLlllhhhHHHHHHHLllll


DSSP  HHHHhllllLLLEEEEElLLHHhhhhhllllhhHHHHHhHHEEELLLL------------
Query VQLQsqehrPFRLIGIGdTSLVelaasnhiiaeLYYCFaXTQIACLPL------------  141
ident   |          |     |                      |                 
Sbjct GMLK-----NKTRILVT-HSMS-----------YLPQV-DVIIVMSGGkisemgsyqell  215
DSSP  LLLL-----LLEEEEEL-LLLL-----------LHHHL-LEEEEEELLeeeeeelhhhhh


DSSP  --------------l
Query --------------t  142
ident                
Sbjct ardgafaeflrtyas  230
DSSP  hhllhhhhhhhhlll


No 122: Query=mol1A Sbjct=2r6dC Z-score=5.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ppqsieaeqavlgavfldpaalvpaseilipedfyraahqkifhamlrvadrgepvdlvt   60
DSSP  llllhhhhhhhhhhhllllllhhhhhhhllhhhlllhhhhhhhhhhhhhhlllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vtaelaaseqleeiggvsylseladavptaanveyyariveeksvlrrlirtatsiaqdg  120
DSSP  hhhhhhhlllllllllhhhhhhhhhhllllllllllhhhhhhhhhhhhhhhhhhhhhhhh


DSSP  -----------------------------------------llllhhhhhhHHHHHHHLL
Query -----------------------------------------igrsewinqyRRRLQQLSE   19
ident                                                           | 
Sbjct ytredeidvlldeadrkimeknikdilvqtydniemlhnrdgeitgiptgfTELDRMTSG  180
DSSP  hhlllllllhhhhhhhhllllllhhhhhhhhhhhlhhhhllllllllllllHHHHHHHLL


DSSP  LL--LLEEEELLLLLLHHHHHHHHHHLL-lllLLLLEEEELL------------------
Query TD--IAVWLYGAPGTGRXTGARYLHQFG-rnaQGEFVYRELT------------------   58
ident             |  |    |    |              |                   
Sbjct FQrsDLIIVAARPSVGKTAFALNIAQNVatktNENVAIFSLEmsaqqlvmrmlcaegnin  240
DSSP  LLllLEEEEELLLLLLHHHHHHHHHHHHhhhlLLLEEEEELLllhhhhhhhhhhhhhlll


DSSP  --------------------------------lLLLLLHHHHHHHHL-------LLLEEE
Query --------------------------------pDNAPQLNDFIALAQ-------GGTLVL   79
ident                                         |  |           |  | 
Sbjct aqnlrtgkltpedwgkltmamgslsnagiyiddTPSIRVSDIRAKCRrlkqesgLGMIVI  300
DSSP  hhhhhhllllhhhhhhhhhhhhhhhllleeeelLLLLLHHHHHHHHHhhhllllLLEEEE


DSSP  ELHHHL------LHHHHHHHHHHHHLllLLLLEEEEELL------lhHHHHHhLLLLhhH
Query SHPEHL------TREQQYHLVQLQSQehRPFRLIGIGDT------slVELAAsNHIIaeL  127
ident               |    |  |          |                          
Sbjct DYLQLIqgsgreVSEISRSLKALARE--LEVPVIALSQLsrsverpmMSDIR-ESGS--I  355
DSSP  ELHHHLllllllHHHHHHHHHHHHHH--HLLLEEEEELLllllllllLHHHH-LLLL--H


DSSP  HHHHhHHEEELL------------------------------lll
Query YYCFaXTQIACL------------------------------plt  142
ident                                              
Sbjct EQDA-DIVAFLYkniieiiiakqrngpvgtvqlafikeynkfvnl  399
DSSP  HHHL-LEEEEELlleeeeeeeeellllleeeeeeeelllleeell


No 123: Query=mol1A Sbjct=3ew9A Z-score=5.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct advltelpgvgpstadklieggyldfmkiatatigeltdiegisekaaakmimaardlcd   60
DSSP  lllhhhlllllhhhhhhhhhlllllhhhhhlllhhhhhllllllhhhhhhhhhhhhhhll


DSSP  -------------llllhhhhhHHHHHHHH-lLLLL--LEEEELLLLLLHHHHHHHHHHL
Query -------------igrsewinqYRRRLQQL-sETDI--AVWLYGAPGTGRXTGARYLHQF   44
ident                              |             |  | |           
Sbjct lgfksgvellkqrqsvwrlstgSTELDTVLagGIESqsVTEFAGMFGSGKTQIMHQTCVN  120
DSSP  llllllhhhhhhhlllleelllLHHHHHHLllLEELllEEEEEELLLLLHHHHHHHHHHH


DSSP  LL----------------lllLLLEEEEL-------------------------------
Query GR----------------naqGEFVYREL-------------------------------   57
ident                         ||                                  
Sbjct LQmrekifadlegvveeeleaPKAVYIDTegtfrpervvqmaegagidgqtvldntfvar  180
DSSP  HLlhhheelllllllhhhlllEEEEEEELlllllhhhhhhhhhhhlllhhhhhhleeeee


DSSP  --LLLLLLLH-HHHHHH----hLLLLEEEELHH-----------------hlLHHHHHHH
Query --TPDNAPQL-NDFIAL----aQGGTLVLSHPE-----------------hlTREQQYHL   93
ident     |           |                                          |
Sbjct ayNSDMQMLFaEKIEDLikggnNIKLVIIDSLTstfrneftgrgklaerqqkLGRHMATL  240
DSSP  llLHHHHHHHhHLHHHHhhlllEEEEEEEELLLhhhhhhlllhhhhhhhhhhHHHHHHHH


DSSP  HHHHHLllLLLLEEEEELL---lhHHHHhhLLLLhhhHHHHHhHEEELLL----------
Query VQLQSQehRPFRLIGIGDT---slVELAasNHIIaelYYCFAxTQIACLP----------  140
ident   |                            |                            
Sbjct NKLADL--YNCIVLVTNQVaakaeQAIG--GHVV---GHAAT-FRFFLRKskgdkrvakl  292
DSSP  HHHHHH--LLLEEEEEELEellllEELL--HHHH---HHHLL-EEEEEEElllleeeeee


DSSP  --------------------ll
Query --------------------lt  142
ident                       
Sbjct ydsphlpdseavfritekgiqd  314
DSSP  eelllllleeeeeeelllleel


No 124: Query=mol1A Sbjct=1oxuA Z-score=5.5

back to top
DSSP  --------------llllhhhHHHHhhhHHHLlLLLLEEEELLLLLLHHHHHHHHHH---
Query --------------igrsewiNQYRrrlQQLSeTDIAVWLYGAPGTGRXTGARYLHQ---   43
ident                                          |  | |  |  |       
Sbjct mvriivknvskvfkkgkvvalDNVN---INIE-NGERFGILGPSGAGKTTFMRIIAGldv   56
DSSP  llleeeeeeeeeehhhleeeeEEEE---EEEL-LLLEEEEELLLLLLHHHHHHHHHLlll


DSSP  --------------------lllllLLLLEEEE---------------------------
Query --------------------fgrnaQGEFVYRE---------------------------   56
ident                                                             
Sbjct pstgelyfddrlvasngklivppedRKIGMVFQtwalypnltafeniafpltnmkmskee  116
DSSP  lleeeeeelleeeeelleelllhhhLLEEEELLlllllllllhhhhhhhhhllllllhhh


DSSP  ---------------------lllLLLL-LHHHHHHHHL---LLLEEE-ELHHHL----L
Query ---------------------ltpDNAP-QLNDFIALAQ---GGTLVL-SHPEHL----T   86
ident                              |     | |       | |      |     
Sbjct irkrveevakildihhvlnhfpreLSGGqQQRVALARALvkdPSLLLLdEPFSNLdarmR  176
DSSP  hhhhhhhhhhhlllhhhllllhhhLLHHhHHHHHHHHHHlllLLEEEEeLLLLLLllhhH


DSSP  HHHHHHHHHHHHLllLLLLEEEEELLLHhhhhhhllllhhhHHHHhHHEEELLLL-----
Query REQQYHLVQLQSQehRPFRLIGIGDTSLvelaasnhiiaelYYCFaXTQIACLPL-----  141
ident           ||       |                                        
Sbjct DSARALVKEVQSR--LGVTLLVVSHDPA-----------diFAIA-DRVGVLVKGklvqv  222
DSSP  HHHHHHHHHHHHH--HLLEEEEEELLHH-----------hhHHHL-LEEEEEELLeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct gkpedlydnpvsiqvasligeinelegkvtnegvvigslrfpvsvssdraiigirpedvk  282
DSSP  elhhhhhhllllhhhhhhhllleeeeeeeelleeeelleeellllllleeeeeelhhhee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct lskdvikddswilvgkgkvkvigyqgglfrititpldseeeiftysdhpihsgeevlvyv  342
DSSP  eellllllllleeeeeeeeeeeeeelleeeeeeeelllllleeeeelllllllleeeeee


DSSP  ----------l
Query ----------t  142
ident            
Sbjct rkdkikvfekn  353
DSSP  lhhhleeeell


No 125: Query=mol1A Sbjct=2d62A Z-score=5.5

back to top
DSSP  --------------llllhhhhhhHHHHhhhLLLLLLEEEELLLLLLHHHHHHHHHH---
Query --------------igrsewinqyRRRLqqlSETDIAVWLYGAPGTGRXTGARYLHQ---   43
ident                                        | |  | |  |  |       
Sbjct xigxaevkliniwkrfgdvtavkdLSLE---IKDGEFLVLLGPSGCGKTTTLRXIAGlee   57
DSSP  lllllleeeeeeeeeelleeeeeeEEEE---ELLLLEEEEELLLLLLHHHHHHHHHLlll


DSSP  --------------------lllllLLLLEEEELLLLL----------------------
Query --------------------fgrnaQGEFVYRELTPDN----------------------   61
ident                                                             
Sbjct ptrgqiyiednlvadpekgvfvppkERDVAXVFQSYALyphxtvydniafplklrkvpkq  117
DSSP  lleeeeeelleeeeehhhleellhhHHLEEELLLLLLLlllllhhhhhhhhhhlllllhh


DSSP  --------------------------------lLLHHHHHHHhLLLLEEEELHHH-----
Query --------------------------------aPQLNDFIALaQGGTLVLSHPEH-----   84
ident                                    |   |            |       
Sbjct eidkrvrevaexlgltellnrkprelsggqrqrVALGRAIIR-RPKVFLXDEPLSnldak  176
DSSP  hhhhhhhhhhhhlllhhhllllhhhllhhhhhhHHHHHHHLL-LLLEEEEELLLLlllhh


DSSP  lLHHHHHHHHHHHHLllLLLLEEEEElLLHHhhhhhllllhhhHHHHhHHEEELLLL---
Query lTREQQYHLVQLQSQehRPFRLIGIGdTSLVelaasnhiiaelYYCFaXTQIACLPL---  141
ident         |  || |       |       |                             
Sbjct lRVKXRAELKKLQRQ--LGVTTIYVT-HDQV----------eaXTXG-DRIAVXNKGelq  222
DSSP  hHHHHHHHHHHHHHH--HLLEEEEEE-LLHH----------hhHHHL-LEEEEEELLeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct qvgtpdevyykpvntfvagfigsppxnfldatitddgfldfgefklkllqdqfevleeen  282
DSSP  eeelhhhhhhllllhhhhhhlllllleeeeeeelllleeelllleeellhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  141
ident                                                             
Sbjct xvgkevifgirpedvhdasfthidvpeentvkatvdiienlggekivhlrrgnisftakf  342
DSSP  lllleeeeeelhhheeehhhllllllllleeeeeeeeeeellleeeeeeeelleeeeeee


DSSP  --------------------------------l
Query --------------------------------t  142
ident                                  
Sbjct pkeskvregdevsvvfdxkkihifrkdtekaif  375
DSSP  ellllllllleeeeeelhhhleeeellllllll


No 126: Query=mol1A Sbjct=3k70D Z-score=5.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mklqkqlleavehkqlrpldvqfaltvagdehpavtlaaallshdageghvclplsrlen   60
DSSP  lllhhhhhhhhhlllllhhhhhhhhhhlllllhhhhhhhhhhhhhhhhllleeehhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct neashpllatcvseigelqnweecllasqavsrgdeptpmilcgdrlylnrmwcnertva  120
DSSP  hhhlllllllllllllllllhhhhhhhllleellllllleeeelleeeehhhhhhhhhhh


DSSP  -------------------------lllLHHHhhHHHH-HHHHLLLlLLEEEELLLLLLH
Query -------------------------igrSEWInqYRRR-LQQLSETdIAVWLYGAPGTGR   34
ident                              |                       | |||| 
Sbjct rffnevnhaievdeallaqtldklfpvsDEIN--WQKVaAAVALTR-RISVISGGPGTGK  177
DSSP  hhlllllllllllhhhhhhhhhhhllllLLLL--HHHHhHHHHHLL-LEEEEELLLLLLH


DSSP  HHHHHHHHHLLL----llLLLLEEEELLL-------------------------------
Query XTGARYLHQFGR----naQGEFVYRELTP-------------------------------   59
ident  |    |                    |                                
Sbjct TTTVAKLLAALIqmadgeRCRIRLAAPTGkaaarlteslgkalrqlpltdeqkkripeda  237
DSSP  HHHHHHHHHHHHhlllllLLLEEEEELLHhhhhhhhhhhlhhhhllllllllllllllll


DSSP  lLLLLHHH----------hhHHHLlLLEEEELH-HHLLHhHHHHHHHHHhlllLLLLEEE
Query dNAPQLND----------fiALAQgGTLVLSHP-EHLTReQQYHLVQLQsqehRPFRLIG  108
ident      |               |     ||               |           | | 
Sbjct sTLHRLLGaqpqrlrhhagnPLHL-DVLVVDEAsMIDLP-MMSRLIDAL---pDHARVIF  292
DSSP  eELLLLLLeelleellllllLLLL-LEEEELLHhHLLHH-HHHHHHHHL---lLLLEEEE


DSSP  EELLlhhHHHHHLLLL--------------------------------hhhhhhhHHHEE
Query IGDTslvELAASNHII--------------------------------aelyycfAXTQI  136
ident  ||                                                         
Sbjct LGDR-dqLASVEAGAVlgdicayanagftaerarqlsrltgthvpagtgteaaslRDSLC  351
DSSP  EELL-llHHHHLLLLLhhhhlhhhlllllhhhhhhhhhhllllllllllllllllHHHEE


DSSP  ELLLLL------------------------------------------------------
Query ACLPLT------------------------------------------------------  142
ident                                                             
Sbjct LLQKSYrfgsdsgigqlaaainrgdktavktvfqqdftdiekrllqsgedyiamleeala  411
DSSP  ELLLLLlllllllhhhhhhhhlllhhhhhhhhhllllllleeeeelllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct gygryldllqaraepdliiqafneyqllcalregpfgvaglnerieqfmqqkrpsrlpeh  471
DSSP  hlhhhhhhhhllllllhhhhhhlleeeeellllllllhhhhhhhhhlhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  142
ident                                                             
Sbjct ettwamtvhksqgsefdhaalilpsqrtpvvtrelvytavtrarrrlslyaderilsaai  531
DSSP  lllleeelllllllllleeeeellllllllllhhhhhhhhlllllleeeeelllhhhhhl


DSSP  ----------------
Query ----------------  142
ident                 
Sbjct atrterrsglaalfss  547
DSSP  llllllllllllllll


No 127: Query=mol1A Sbjct=2r6eA Z-score=5.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct rippqsieaeqavlgavfldpaalvpaseilipedfyraahqkifhamlrvadrgepvdl   60
DSSP  llllllhhhhhhhhhhhhhlhhhhhhhhhhllhhhlllhhhhhhhhhhhhhhhllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vtvtaelaaseqleeiggvsylseladavptaanveyyariveeksvlrrlirtatsiaq  120
DSSP  hhhhhhhhhllllhhhlhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhhhhhhhhhhhh


DSSP  --------------------llllhhhhhhHHHHHHHLLLL--LLEEEELLLLLLHHHHH
Query --------------------igrsewinqyRRRLQQLSETD--IAVWLYGAPGTGRXTGA   38
ident                                      |             |  |    |
Sbjct dgytredeidvlldeadrkimevsgiptgfTELDRMTSGFQrsDLIIVAARPSVG