Results

Parseable data
Matches to PDB90
Dali: mol1B,

Query: mol1B

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, to pre-computed structural neighbours in the Dali Database, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1j32-A 44.8  2.0  365   388   22 PDB  MOLECULE: ASPARTATE AMINOTRANSFERASE;                                


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=mol1B Sbjct=1j32A Z-score=44.8

back to top
DSSP  -LHHHHHHLLL-lllllllllllllllllLLLEELLLLLLlLLLLLLLHHHHHHHHHHHL
Query -SIEAKFKKLG-rqsaaglealirgapieGRPVDFSHGDVdAHEPTPGAFDLFSAGVQSG   58
ident     |                             || |                |    |
Sbjct mKLAARVESVSpsmtliidakakamkaegIDVCSFSAGEP-DFNTPKHIVEAAKAALEQG   59
DSSP  lLLLHHHHLLLlllllllhhhhhhhhlllLLLEELLLLLL-LLLLLHHHHHHHHHHHHLL


DSSP  hHHHLLLLLLLHHHHHHHHHHHHHHHLLLLLLlLLEEEELHHHHHHHHHHHLLLLLLLEE
Query gVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDArDGLIITPGTQGALFLAVAATVARGDKV  118
ident     |    |    |   |  |    |    | |    | |     |    |    || |
Sbjct -KTRYGPAAGEPRLREAIAQKLQRDNGLCYGA-DNILVTNGGKQSIFNLMLAMIEPGDEV  117
DSSP  -LLLLLLLLLLHHHHHHHHHHHHHHHLLLLLH-HHEEEELHHHHHHHHHHHHHLLLLLEE


DSSP  EEEELLLHHHHHHHHHLLLEEEEEElLLLLlllllLLLLHHHHHHHHHLLLLEEEEELLL
Query AIVQPDYFANRKLVEFFEGEXVPVQlDYVSadetrAGLDLTGLEEAFKAGARVFLFSNPN  178
ident  |  |        |   ||  |      |                |         |  | 
Sbjct IIPAPFWVSYPEMVKLAEGTPVILP-TTVE---tqFKVSPEQIRQAITPKTKLLVFNTPS  173
DSSP  EEELLLLLHHHHHHHHLLLEEEEEL-LLHH---hlLLLLHHHHHHHLLLLEEEEEEELLL


DSSP  LLLLLLLLHHHHHHHHHHHHHHLLEEEEELLLLLLLLLLLLLLLHHHLLLLLHHHEEEEE
Query NPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIX  238
ident || | ||   |   ||  |   |  |  |  |    |  |      |      |  |   
Sbjct NPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAASPEAYERSVVCS  233
DSSP  LLLLLLLLHHHHHHHHHHHHHHLLEEEEELLLLLLLLLLLLLLLHHHLLHHHHHLEEEEE


DSSP  LLL-LLLLHHHLLEEEEELHHHHHHHHHHHHHHLLLLLHHHHHHHHHLLLLLLLHHHHHH
Query GPS-TESLSGYRLGVAFGSRAIIARXEKLQAIVSLRAAGYSQAVLRGWFDEAPGWXEDRI  297
ident |   |    | | |   |         | |           |                  
Sbjct GFAkTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQEML  293
DSSP  ELLlLLLLLLLLLEEEELLHHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHLLLHHHHHHH


DSSP  HHHHHHHHHHHHHHHL-LLLLLLLLLLLLEELLLLLLLLLLHHHHHHHHHHHHLEELEEH
Query