Results

Parseable data
Matches to PDB90
Dali: mol1A,

Query: mol1A

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, to pre-computed structural neighbours in the Dali Database, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1e5k-A 19.2  2.4  173   188   20 PDB  MOLECULE: MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS            
   2:  1vpa-A 17.7  2.5  174   221   16 PDB  MOLECULE: 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE                        
   3:  2e8b-A 17.2  2.5  163   185   23 PDB  MOLECULE: PROBABLE MOLYBDOPTERIN-GUANINE DINUCLEOTIDE                
   4:  2px7-A 17.0  2.6  169   203   17 PDB  MOLECULE: 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE                        
   5:  3dk5-A 16.7  2.6  182   442   15 PDB  MOLECULE: BIFUNCTIONAL PROTEIN GLMU;                                 
   6:  1i52-A 16.4  2.7  178   225   16 PDB  MOLECULE: 4-DIPHOSPHOCYTIDYL-2-C-METHYLERYTHRITOL SYNTHASE;          
   7:  2vsi-B 16.1  2.7  172   227   14 PDB  MOLECULE: 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE                        
   8:  3fww-A 16.0  2.9  183   444   15 PDB  MOLECULE: BIFUNCTIONAL PROTEIN GLMU;                                 
   9:  1h7e-A 15.9  2.9  180   245   13 PDB  MOLECULE: 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE;           
  10:  3d8v-A 15.7  2.6  180   477   16 PDB  MOLECULE: BIFUNCTIONAL PROTEIN GLMU;                                 
  11:  2v0i-A 15.7  3.0  183   450   15 PDB  MOLECULE: BIFUNCTIONAL PROTEIN GLMU;                                 
  12:  1hm8-A 15.6  2.8  182   458   18 PDB  MOLECULE: UDP-N-ACETYLGLUCOSAMINE-1-PHOSPHATE                        
  13:  3f1c-B 15.5  2.6  172   230   17 PDB  MOLECULE: PUTATIVE 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE               
  14:  1w55-A 15.3  2.7  166   369   14 PDB  MOLECULE: ISPD/ISPF BIFUNCTIONAL ENZYME;                             
  15:  3k8d-A 15.2  3.0  177   246   14 PDB  MOLECULE: 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE;           
  16:  1vic-A 15.2  3.1  180   255   13 PDB  MOLECULE: 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE;           
  17:  2e3d-C 15.0  2.8  180   288   14 PDB  MOLECULE: UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE;              
  18:  2oi6-B 14.8  2.8  177   452   16 PDB  MOLECULE: BIFUNCTIONAL PROTEIN GLMU;                                 
  19:  3jtj-A 14.7  3.2  180   249   11 PDB  MOLECULE: 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE;           
  20:  1w77-A 14.7  2.9  171   212   23 PDB  MOLECULE: 2C-METHYL-D-ERYTHRITOL 4-PHOSPHATE                         
  21:  1wvc-A 14.6  2.8  176   254   15 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE;                  
  22:  3hl3-A 14.3  2.9  175   246   15 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE;                 
  23:  1vgw-B 14.2  2.9  164   214   14 PDB  MOLECULE: 4-DIPHOSPHOCYTIDYL-2C-METHYL-D-ERYTHRITOL                  
  24:  1mc3-A 14.1  2.9  172   291   15 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE;                 
  25:  2ux8-A 14.0  3.1  174   255   15 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE;                   
  26:  1eyr-A 13.8  3.2  167   225   14 PDB  MOLECULE: CMP-N-ACETYLNEURAMINIC ACID SYNTHETASE;                    
  27:  3d5n-A 13.8  3.0  155   178   19 PDB  MOLECULE: Q97W15_SULSO;                                              
  28:  2ux8-G 13.6  3.2  178   288   15 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE;                   
  29:  2pa4-B 13.4  2.9  178   299   14 PDB  MOLECULE: UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE;               
  30:  1h5s-B 13.4  3.0  175   291   14 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE;                 
  31:  2ggo-A 13.3  2.6  175   401   16 PDB  MOLECULE: 401AA LONG HYPOTHETICAL GLUCOSE-1-PHOSPHATE                
  32:  2cu2-A 13.2  2.9  173   335   17 PDB  MOLECULE: PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL                      
  33:  2i5k-B 13.0  3.0  177   466   10 PDB  MOLECULE: UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE;              
  34:  3gue-A 13.0  3.0  176   468   11 PDB  MOLECULE: UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE 2;             
  35:  1fxo-B 12.9  3.0  176   293   13 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE;                 
  36:  1lvw-A 12.5  3.1  176   295   15 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE;                 
  37:  2icy-B 12.3  3.1  183   463   13 PDB  MOLECULE: PROBABLE UTP-GLUCOSE-1-PHOSPHATE                           
  38:  3cgx-A 12.3  3.0  164   231   13 PDB  MOLECULE: PUTATIVE NUCLEOTIDE-DIPHOSPHO-SUGAR TRANSFERASE;           
  39:  1jyk-A 12.3  3.2  169   229   16 PDB  MOLECULE: CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE;                    
  40:  2dpw-A 12.3  3.0  160   231   19 PDB  MOLECULE: HYPOTHETICAL PROTEIN TTHA0179;                             
  41:  2yqc-A 12.1  3.1  181   480   15 PDB  MOLECULE: UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE;                 
  42:  1jv1-A 11.9  3.1  178   490   16 PDB  MOLECULE: GLCNAC1P URIDYLTRANSFERASE ISOFORM 1: AGX1;                
  43:  3brk-X 11.9  3.5  178   395   15 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE;                   
  44:  1yp3-C 11.8  3.1  174   435   15 PDB  MOLECULE: GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL              
  45:  1qwj-B 11.5  3.3  164   229   16 PDB  MOLECULE: CYTIDINE MONOPHOSPHO-N-ACETYLNEURAMINIC ACID               
  46:  2oef-A 11.4  3.2  179   482   13 PDB  MOLECULE: UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE 2,             
  47:  2bo4-A 11.1  3.2  154   380    9 PDB  MOLECULE: MANNOSYLGLYCERATE SYNTHASE;                                
  48:  1vm8-A 10.5  3.4  174   491   16 PDB  MOLECULE: UDP-N-ACTEYLGLUCOSAMINE PYROPHOSPHORYLASE;                 
  49:  2i5e-A 10.5  3.3  152   210   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN MM_2497;                              
  50:  2qh5-B  9.9  3.1  150   256   13 PDB  MOLECULE: MANNOSE-6-PHOSPHATE ISOMERASE;                             
  51:  3ckq-A  9.5  3.2  150   302   12 PDB  MOLECULE: PUTATIVE UNCHARACTERIZED PROTEIN;                          
  52:  3e26-A  9.5  3.3  149   274   12 PDB  MOLECULE: PUTATIVE UNCHARACTERIZED PROTEIN;                          
  53:  1ss9-A  9.3  3.3  165   280    7 PDB  MOLECULE: ALPHA-1,4-GALACTOSYL TRANSFERASE;                          
  54:  1on8-A  9.2  3.0  149   265    7 PDB  MOLECULE: ALPHA-1,4-N-ACETYLHEXOSAMINYLTRANSFERASE EXTL2;            
  55:  1ll0-B  9.0  3.0  154   267    9 PDB  MOLECULE: GLYCOGENIN-1;                                              
  56:  2z86-C  8.9  3.6  149   603   10 PDB  MOLECULE: CHONDROITIN SYNTHASE;                                      
  57:  2d0j-A  8.8  3.5  147   242    7 PDB  MOLECULE: GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-                 
  58:  1fgg-A  8.6  3.6  148   250   10 PDB  MOLECULE: GLUCURONYLTRANSFERASE I;                                   
  59:  2p73-A  8.5  3.3  143   207    8 PDB  MOLECULE: PUTATIVE GLYCOSYLTRANSFERASE                               
  60:  1foa-A  8.4  4.1  164   342   12 PDB  MOLECULE: ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-                
  61:  3f1y-A  8.3  3.5  151   318    9 PDB  MOLECULE: MANNOSYL-3-PHOSPHOGLYCERATE SYNTHASE;                      
  62:  2j0a-A  8.2  3.9  156   243   13 PDB  MOLECULE: BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASE MANIC             
  63:  2zu8-A  8.0  3.3  152   373   11 PDB  MOLECULE: MANNOSYL-3-PHOSPHOGLYCERATE SYNTHASE;                      
  64:  2d7i-A  7.5  3.1  152   536    6 PDB  MOLECULE: POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10;          
  65:  1xhb-A  7.5  3.2  150   447   11 PDB  MOLECULE: POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 1;           
  66:  2vkd-A  7.5  3.4  144   542   10 PDB  MOLECULE: CYTOTOXIN L;                                               
  67:  2ffu-A  7.1  3.3  148   494    7 PDB  MOLECULE: POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 2;           
  68:  2vs4-A  7.1  3.5  144   288   11 PDB  MOLECULE: N-ACETYLLACTOSAMINIDE ALPHA-1,                             
  69:  3bcv-A  7.1  3.7  139   196    8 PDB  MOLECULE: PUTATIVE GLYCOSYLTRANSFERASE PROTEIN;                      
  70:  1v82-A  6.9  3.8  147   247    8 PDB  MOLECULE: GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-                 
  71:  1h7q-A  6.7  3.6  138   240    9 PDB  MOLECULE: SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN             
  72:  2gak-A  6.5  3.5  148   374    3 PDB  MOLECULE: BETA-1,6-N-ACETYLGLUCOSAMINYLTRANSFERASE;                  
  73:  2c0n-A  6.4  3.3  122   191   10 PDB  MOLECULE: A197;                                                      
  74:  2rj7-A  6.0  4.0  136   292   10 PDB  MOLECULE: GLYCOPROTEIN-FUCOSYLGALACTOSIDE ALPHA-                     
  75:  1s4n-A  5.8  3.7  141   337   10 PDB  MOLECULE: GLYCOLIPID 2-ALPHA-MANNOSYLTRANSFERASE;                    
  76:  2agd-A  5.6  3.4  129   273    6 PDB  MOLECULE: BETA-1,4-GALACTOSYLTRANSFERASE 1;                          
  77:  2wzf-A  5.5  3.8  140   515    9 PDB  MOLECULE: GLUCOSYLTRANSFERASE;                                       
  78:  2wzg-A  5.5  4.0  137   502    9 PDB  MOLECULE: GLUCOSYLTRANSFERASE;                                       
  79:  1zi4-A  5.5  3.5  127   264   14 PDB  MOLECULE: HISTO-BLOOD GROUP ABO SYSTEM TRANSFERASE (NAGAT)           
  80:  1fgx-B  5.4  3.7  132   273    6 PDB  MOLECULE: BETA 1,4 GALACTOSYLTRANSFERASE;                            
  81:  2nxv-A  4.2  3.7  125   249    8 PDB  MOLECULE: ATP SYNTHASE SUBUNITS REGION ORF 6;                        
  82:  2e28-A  4.1  4.3   83   587   11 PDB  MOLECULE: PYRUVATE KINASE;                                           
  83:  2j4k-C  3.9  3.5   94   206    6 PDB  MOLECULE: URIDYLATE KINASE;                                          
  84:  3fwz-A  3.9  3.2   88   140    6 PDB  MOLECULE: INNER MEMBRANE PROTEIN YBAL;                               
  85:  1lss-A  3.9  3.3   90   132    9 PDB  MOLECULE: TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKA HOMOLOG;          
  86:  1lix-B  3.8  3.0   77   463    8 PDB  MOLECULE: PYRUVATE KINASE, ISOZYMES R/L;                             
  87:  1pkl-G  3.6  2.8   77   498   17 PDB  MOLECULE: PROTEIN (PYRUVATE KINASE);                                 
  88:  3d4o-B  3.6  4.3   90   291   13 PDB  MOLECULE: DIPICOLINATE SYNTHASE SUBUNIT A;                           
  89:  2j4j-F  3.5  3.5   94   226    9 PDB  MOLECULE: URIDYLATE KINASE;                                          
  90:  3hbn-A  3.5  3.8  101   282   10 PDB  MOLECULE: UDP-SUGAR HYDROLASE;                                       
  91:  3fvv-A  3.5  3.6   91   223    7 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
  92:  3h6o-A  3.5  2.6   74   490   12 PDB  MOLECULE: PYRUVATE KINASE ISOZYMES M1/M2;                            
  93:  3h6o-C  3.5  2.6   75   468   12 PDB  MOLECULE: PYRUVATE KINASE ISOZYMES M1/M2;                            
  94:  1l5x-B  3.4  3.2   97   278   12 PDB  MOLECULE: SURVIVAL PROTEIN E;                                        
  95:  2a1u-A  3.4  3.5  108   315    8 PDB  MOLECULE: ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT,              
  96:  2ogx-B  3.4  3.0   97   268    9 PDB  MOLECULE: MOLYBDENUM STORAGE PROTEIN SUBUNIT ALPHA;                  
  97:  2c1z-A  3.4  3.3   91   439   11 PDB  MOLECULE: UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE;             
  98:  1llu-A  3.4  4.1   97   341   10 PDB  MOLECULE: ALCOHOL DEHYDROGENASE;                                     
  99:  1id1-A  3.4  3.4   91   153   10 PDB  MOLECULE: PUTATIVE POTASSIUM CHANNEL PROTEIN;                        
 100:  2j5t-D  3.3  4.3  106   367   14 PDB  MOLECULE: GLUTAMATE 5-KINASE;                                        
 101:  2jjx-A  3.3  3.4   96   244   10 PDB  MOLECULE: URIDYLATE KINASE;                                          
 102:  2w6p-B  3.3  3.2   95   387   12 PDB  MOLECULE: ACETYL-COA CARBOXYLASE;                                    
 103:  1dv2-A  3.3  3.6   99   450   12 PDB  MOLECULE: BIOTIN CARBOXYLASE;                                        
 104:  2nz2-A  3.3  4.1   87   403    8 PDB  MOLECULE: ARGININOSUCCINATE SYNTHASE;                                
 105:  1rku-A  3.3  3.5   84   206   10 PDB  MOLECULE: HOMOSERINE KINASE;                                         
 106:  1aqf-E  3.3  3.1   80   426   11 PDB  MOLECULE: PYRUVATE KINASE;                                           
 107:  1lnq-A  3.3  3.1   87   301   11 PDB  MOLECULE: POTASSIUM CHANNEL RELATED PROTEIN;                         
 108:  3ek6-A  3.2  3.5   96   243   10 PDB  MOLECULE: URIDYLATE KINASE;                                          
 109:  3ioy-A  3.2  4.3  100   277   12 PDB  MOLECULE: SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR;                   
 110:  2phj-A  3.2  3.6   94   248   12 PDB  MOLECULE: 5'-NUCLEOTIDASE SURE;                                      
 111:  1dv1-B  3.2  3.7   92   428   13 PDB  MOLECULE: BIOTIN CARBOXYLASE;                                        
 112:  1fs0-G  3.2  4.3   94   219   13 PDB  MOLECULE: ATP SYNTHASE EPSILON SUBUNIT;                              
 113:  2voy-I  3.2  2.8   80   128   11 PDB  MOLECULE: POTENTIAL COPPER-TRANSPORTING ATPASE;                      
 114:  2g50-D  3.2  2.9   75   521    8 PDB  MOLECULE: PYRUVATE KINASE ISOZYMES M1/M2;                            
 115:  2j5t-H  3.1  3.5   94   337   16 PDB  MOLECULE: GLUTAMATE 5-KINASE;                                        
 116:  2vqd-A  3.1  3.1   96   447   13 PDB  MOLECULE: BIOTIN CARBOXYLASE;                                        
 117:  2ij9-B  3.1  3.3   96   216   10 PDB  MOLECULE: URIDYLATE KINASE;                                          
 118:  1f0k-A  3.1  3.1   82   351   11 PDB  MOLECULE: UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-                   
 119:  3c85-A  3.1  3.1   82   150   13 PDB  MOLECULE: PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX            
 120:  1vl2-A  3.1  3.8   79   398   11 PDB  MOLECULE: ARGININOSUCCINATE SYNTHASE;                                
 121:  1rjw-A  3.1  3.9   92   339   10 PDB  MOLECULE: ALCOHOL DEHYDROGENASE;                                     
 122:  1liu-B  3.1  2.9   74   491    8 PDB  MOLECULE: PYRUVATE KINASE, ISOZYMES R/L;                             
 123:  3fdx-A  3.1  3.8   82   127   11 PDB  MOLECULE: PUTATIVE FILAMENT PROTEIN / UNIVERSAL STRESS               
 124:  2bne-B  3.0  3.7   97   238    6 PDB  MOLECULE: URIDYLATE KINASE;                                          
 125:  2a1f-C  3.0  3.5   96   237    7 PDB  MOLECULE: URIDYLATE KINASE;                                          
 126:  1lu9-A  3.0  4.0   90   287   12 PDB  MOLECULE: METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE;           
 127:  1gn8-A  3.0  4.1   84   159    4 PDB  MOLECULE: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;                    
 128:  3grp-D  3.0  3.6   88   209   10 PDB  MOLECULE: 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE;                 
 129:  1ni5-A  3.0  3.6   85   433    7 PDB  MOLECULE: PUTATIVE CELL CYCLE PROTEIN MESJ;                          
 130:  1yqd-A  3.0  3.8   89   359    7 PDB  MOLECULE: SINAPYL ALCOHOL DEHYDROGENASE;                             
 131:  1i01-C  3.0  3.9   92   220    9 PDB  MOLECULE: BETA-KETOACYL [ACP] REDUCTASE;                             
 132:  3hmk-B  3.0  3.4   87   322    7 PDB  MOLECULE: SERINE RACEMASE;                                           
 133:  1ydw-B  3.0  3.6   83   350    7 PDB  MOLECULE: AX110P-LIKE PROTEIN;                                       
 134:  1pky-C  3.0  2.9   75   433    9 PDB  MOLECULE: PYRUVATE KINASE;                                           
 135:  2pr7-A  3.0  3.1   85   137   13 PDB  MOLECULE: HALOACID DEHALOGENASE/EPOXIDE HYDROLASE FAMILY;            
 136:  3ic5-A  3.0  4.0   78   115    9 PDB  MOLECULE: PUTATIVE SACCHAROPINE DEHYDROGENASE;                       
 137:  1htt-A  3.0  2.5   69   366    7 PDB  MOLECULE: HISTIDYL-TRNA SYNTHETASE;                                  
 138:  1zmo-A  2.9  4.5   95   243    8 PDB  MOLECULE: HALOHYDRIN DEHALOGENASE;                                   
 139:  1z9d-A  2.9  3.5   94   238    6 PDB  MOLECULE: URIDYLATE KINASE;                                          
 140:  3bg5-B  2.9  3.4  100  1074    8 PDB  MOLECULE: PYRUVATE CARBOXYLASE;                                      
 141:  2bmu-B  2.9  3.7   96   226   11 PDB  MOLECULE: URIDYLATE KINASE;                                          
 142:  2vpq-B  2.9  3.6   98   448   11 PDB  MOLECULE: ACETYL-COA CARBOXYLASE;                                    
 143:  2ahr-E  2.9  4.7   93   259    4 PDB  MOLECULE: PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE;                  
 144:  3bg5-A  2.9  3.3  101  1137    8 PDB  MOLECULE: PYRUVATE CARBOXYLASE;                                      
 145:  2zat-A  2.9  3.2   89   251    8 PDB  MOLECULE: DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 4;               
 146:  3h2z-A  2.9  4.1   97   377   11 PDB  MOLECULE: MANNITOL-1-PHOSPHATE 5-DEHYDROGENASE;                      
 147:  1e19-A  2.9  3.0   90   313    7 PDB  MOLECULE: CARBAMATE KINASE-LIKE CARBAMOYLPHOSPHATE                   
 148:  1od6-A  2.9  3.9   82   155    9 PDB  MOLECULE: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;                    
 149:  1ulz-A  2.9  3.7  101   451   12 PDB  MOLECULE: PYRUVATE CARBOXYLASE N-TERMINAL DOMAIN;                    
 150:  2ah5-A  2.9  3.2   81   210   14 PDB  MOLECULE: COG0546: PREDICTED PHOSPHATASES;                           
 151:  2dvm-A  2.9  3.4   93   438   11 PDB  MOLECULE: 439AA LONG HYPOTHETICAL MALATE OXIDOREDUCTASE;             
 152:  2a9f-A  2.9  3.3   88   383   14 PDB  MOLECULE: PUTATIVE MALIC ENZYME ((S)-MALATE:NAD+                     
 153:  2vyv-D  2.9  2.7   78   334    9 PDB  MOLECULE: GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE;                  
 154:  1te2-A  2.9  3.2   89   218    9 PDB  MOLECULE: PUTATIVE PHOSPHATASE;                                      
 155:  1vl6-B  2.9  3.7   93   355   12 PDB  MOLECULE: MALATE OXIDOREDUCTASE;                                     
 156:  1u0l-A  2.9  4.7   87   278   13 PDB  MOLECULE: PROBABLE GTPASE ENGC;                                      
 157:  3ccf-B  2.9  2.9   79   242   14 PDB  MOLECULE: CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE;             
 158:  2hoq-A  2.9  3.0   91   237   10 PDB  MOLECULE: PUTATIVE HAD-HYDROLASE PH1655;                             
 159:  2yv5-A  2.9  4.6   86   293   14 PDB  MOLECULE: YJEQ PROTEIN;                                              
 160:  1uuf-A  2.9  3.8   88   339   15 PDB  MOLECULE: ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN               
 161:  1deh-A  2.9  4.1   97   374    9 PDB  MOLECULE: HUMAN BETA1 ALCOHOL DEHYDROGENASE;                         
 162:  1jg1-A  2.9  4.3   84   215   11 PDB  MOLECULE: PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE;                
 163:  1ys6-B  2.9  3.5   82   227    9 PDB  MOLECULE: TRANSCRIPTIONAL REGULATORY PROTEIN PRRA;                   
 164:  1p0c-A  2.9  3.8   94   372    7 PDB  MOLECULE: NADP-DEPENDENT ALCOHOL DEHYDROGENASE;                      
 165:  2iel-A  2.9  3.2   84   132   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TT0030;                               
 166:  3do8-A  2.9  3.5   82   135   13 PDB  MOLECULE: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;                    
 167:  3khd-B  2.9  2.9   74   500    9 PDB  MOLECULE: PYRUVATE KINASE;                                           
 168:  3a1c-B  2.9  3.3   86   273    8 PDB  MOLECULE: PROBABLE COPPER-EXPORTING P-TYPE ATPASE A;                 
 169:  2v5h-B  2.8  3.2   92   289   14 PDB  MOLECULE: ACETYLGLUTAMATE KINASE;                                    
 170:  2rd5-B  2.8  2.9   90   284   12 PDB  MOLECULE: ACETYLGLUTAMATE KINASE-LIKE PROTEIN;                       
 171:  2ap9-A  2.8  3.7   92   299   13 PDB  MOLECULE: ACETYLGLUTAMATE KINASE;                                    
 172:  3hbj-A  2.8  3.3   95   445   17 PDB  MOLECULE: FLAVONOID 3-O-GLUCOSYLTRANSFERASE;                         
 173:  3g1u-C  2.8  4.0  102   424    9 PDB  MOLECULE: ADENOSYLHOMOCYSTEINASE;                                    
 174:  2qf7-B  2.8  3.3   93  1016   11 PDB  MOLECULE: PYRUVATE CARBOXYLASE PROTEIN;                              
 175:  1ybd-A  2.8  3.6   94   236    9 PDB  MOLECULE: URIDYLATE KINASE;                                          
 176:  2va1-B  2.8  3.3   93   235   12 PDB  MOLECULE: URIDYLATE KINASE;                                          
 177:  2ptg-A  2.8  3.7   98   224    6 PDB  MOLECULE: ENOYL-ACYL CARRIER REDUCTASE;                              
 178:  1vlh-B  2.8  3.7   85   158    7 PDB  MOLECULE: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;                    
 179:  2e9y-A  2.8  3.5   93   313    8 PDB  MOLECULE: CARBAMATE KINASE;                                          
 180:  3cf4-G  2.8  3.2   87   169    8 PDB  MOLECULE: ACETYL-COA DECARBONYLASE/SYNTHASE ALPHA SUBUNIT;           
 181:  3k9w-A  2.8  3.7   83   163    7 PDB  MOLECULE: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;                    
 182:  1lvh-A  2.8  3.7   89   221   12 PDB  MOLECULE: BETA-PHOSPHOGLUCOMUTASE;                                   
 183:  3f3m-A  2.8  3.6   83   155    4 PDB  MOLECULE: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;                    
 184:  2obn-D  2.8  3.9   88   346   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
 185:  3l93-A  2.8  4.0   82   161    7 PDB  MOLECULE: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;                    
 186:  2d13-A  2.8  3.5   87   215   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1257;                               
 187:  2vd8-A  2.8  4.2   92   387   12 PDB  MOLECULE: ALANINE RACEMASE;                                          
 188:  1vl6-A  2.8  3.7   93   377   13 PDB  MOLECULE: MALATE OXIDOREDUCTASE;                                     
 189:  1agn-A  2.8  3.9   93   373    8 PDB  MOLECULE: HUMAN SIGMA ALCOHOL DEHYDROGENASE;                         
 190:  1qzt-A  2.8  3.4   83   332   10 PDB  MOLECULE: PHOSPHATE ACETYLTRANSFERASE;                               
 191:  3eyw-B  2.8  4.3   90   352    8 PDB  MOLECULE: C-TERMINAL DOMAIN OF GLUTATHIONE-REGULATED                 
 192:  2cd9-A  2.8  3.8   94   363   10 PDB  MOLECULE: GLUCOSE DEHYDROGENASE;                                     
 193:  1pqw-A  2.8  3.9   90   183    9 PDB  MOLECULE: POLYKETIDE SYNTHASE;                                       
 194:  2yxe-A  2.8  3.8   83   214   16 PDB  MOLECULE: PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE;                
 195:  1kmm-C  2.8  2.6   64   388    5 PDB  MOLECULE: HISTIDYL-TRNA SYNTHETASE;                                  
 196:  3d41-A  2.7  3.1   89   268    7 PDB  MOLECULE: FOMA PROTEIN;                                              
 197:  2qf7-A  2.7  3.4  100  1076   12 PDB  MOLECULE: PYRUVATE CARBOXYLASE PROTEIN;                              
 198:  3ho8-D  2.7  3.3  101   934    8 PDB  MOLECULE: PYRUVATE CARBOXYLASE;                                      
 199:  3cxr-A  2.7  3.9   94   260    9 PDB  MOLECULE: DEHYDROGENASE WITH DIFFERENT SPECIFICITIES;                
 200:  2ako-A  2.7  3.1   90   241   12 PDB  MOLECULE: GLUTAMATE 5-KINASE;                                        
 201:  2p6p-A  2.7  4.4  108   382    9 PDB  MOLECULE: GLYCOSYL TRANSFERASE;                                      
 202:  2dzd-A  2.7  3.6  100   459   15 PDB  MOLECULE: PYRUVATE CARBOXYLASE;                                      
 203:  2jan-A  2.7  4.0   96   419    9 PDB  MOLECULE: TYROSYL-TRNA SYNTHETASE;                                   
 204:  1ilv-B  2.7  4.1   93   247   13 PDB  MOLECULE: STATIONARY-PHASE SURVIVAL PROTEIN SURE HOMOLOG;            
 205:  1e5l-A  2.7  3.9   92   449   16 PDB  MOLECULE: SACCHAROPINE REDUCTASE;                                    
 206:  1yde-F  2.7  4.1   94   256   12 PDB  MOLECULE: RETINAL DEHYDROGENASE/REDUCTASE 3;                         
 207:  1t9z-A  2.7  3.9   94   181   10 PDB  MOLECULE: CARBOXY-TERMINAL DOMAIN RNA POLYMERASE II                  
 208:  1z45-A  2.7  3.8   89   674   10 PDB  MOLECULE: GAL10 BIFUNCTIONAL PROTEIN;                                
 209:  2q5e-A  2.7  3.8   98   181    9 PDB  MOLECULE: CARBOXY-TERMINAL DOMAIN RNA POLYMERASE II                  
 210:  2hcy-A  2.7  4.5   96   347   11 PDB  MOLECULE: ALCOHOL DEHYDROGENASE 1;                                   
 211:  1g8a-A  2.7  3.8   92   227   14 PDB  MOLECULE: FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN;              
 212:  2dfv-A  2.7  4.0   95   346    8 PDB  MOLECULE: PROBABLE L-THREONINE 3-DEHYDROGENASE;                      
 213:  1a71-A  2.7  3.9   91   374   11 PDB  MOLECULE: LIVER ALCOHOL DEHYDROGENASE;                               
 214:  1tfu-A  2.7  4.3   83   157    5 PDB  MOLECULE: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE;                    
 215:  2dy3-D  2.7  3.3   85   344   14 PDB  MOLECULE: ALANINE RACEMASE;                                          
 216:  3cie-A  2.7  2.9   79   338    8 PDB  MOLECULE: GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE;                  
 217:  1y5e-C  2.7  2.9   78   161   12 PDB  MOLECULE: MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN B;                
 218:  2c0c-A  2.7  3.8   96   353    9 PDB  MOLECULE: ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN                 
 219:  2eih-A  2.7  3.7   90   343    8 PDB  MOLECULE: ALCOHOL DEHYDROGENASE;                                     
 220:  1psw-A  2.7  2.8   79   331   13 PDB  MOLECULE: ADP-HEPTOSE LPS HEPTOSYLTRANSFERASE II;                    
 221:  2vhy-B  2.7  3.6   81   330   10 PDB  MOLECULE: ALANINE DEHYDROGENASE;                                     
 222:  2cf5-A  2.7  3.8   94   352   11 PDB  MOLECULE: CINNAMYL ALCOHOL DEHYDROGENASE;                            
 223:  3e58-A  2.7  3.2   86   211    7 PDB  MOLECULE: PUTATIVE BETA-PHOSPHOGLUCOMUTASE;                          
 224:  3k1z-A  2.7  3.7   87   241   13 PDB  MOLECULE: HALOACID DEHALOGENASE-LIKE HYDROLASE DOMAIN-               
 225:  1jqk-A  2.7  3.2   82   610    7 PDB  MOLECULE: CARBON MONOXIDE DEHYDROGENASE;                             
 226:  2dum-C  2.7  3.4   83   146    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH0823;                               
 227:  2i2x-B  2.7  3.2   79   258    9 PDB  MOLECULE: METHYLTRANSFERASE 1;                                       
 228:  3glv-A  2.7  3.9   77   122   12 PDB  MOLECULE: LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN;              
 229:  1wly-A  2.7  4.5   94   322    7 PDB  MOLECULE: 2-HALOACRYLATE REDUCTASE;                                  
 230:  2wmf-A  2.6  4.8  120   555    8 PDB  MOLECULE: FUCOLECTIN-RELATED PROTEIN;                                
 231:  2ogx-A  2.6  3.1   91   246   10 PDB  MOLECULE: MOLYBDENUM STORAGE PROTEIN SUBUNIT ALPHA;                  
 232:  1hi9-A  2.6  3.5   97   274    8 PDB  MOLECULE: DIPEPTIDE TRANSPORT PROTEIN DPPA;                          
 233:  3ef1-A  2.6  4.0   96   372   16 PDB  MOLECULE: RNA POLYMERASE II SUBUNIT A C-TERMINAL DOMAIN              
 234:  1x1e-A  2.6  4.2   95   239   11 PDB  MOLECULE: 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE;                       
 235:  1u7z-C  2.6  3.5   91   219    4 PDB  MOLECULE: COENZYME A BIOSYNTHESIS BIFUNCTIONAL PROTEIN               
 236:  1iir-A  2.6  2.7   81   382   11 PDB  MOLECULE: GLYCOSYLTRANSFERASE GTFB;                                  
 237:  1q7b-A  2.6  3.3   90   243    9 PDB  MOLECULE: 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE;                
 238:  1vp8-A  2.6  3.0   82   190   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN AF0103;                               
 239:  2iya-A  2.6  3.7  104   392    5 PDB  MOLECULE: OLEANDOMYCIN GLYCOSYLTRANSFERASE;                          
 240:  3ca8-A  2.6  3.5   84   261    6 PDB  MOLECULE: PROTEIN YDCF;                                              
 241:  1v3t-A  2.6  3.7   90   333    8 PDB  MOLECULE: LEUKOTRIENE B4 12-                                         
 242:  2jkv-A  2.6  3.6   96   482    5 PDB  MOLECULE: 6-PHOSPHOGLUCONATE DEHYDROGENASE,                          
 243:  2rcn-A  2.6  4.2   91   278   10 PDB  MOLECULE: PROBABLE GTPASE ENGC;                                      
 244:  2b5w-A  2.6  3.7   95   357    8 PDB  MOLECULE: GLUCOSE DEHYDROGENASE;                                     
 245:  1y8c-A  2.6  3.5   85   246    7 PDB  MOLECULE: S-ADENOSYLMETHIONINE-DEPENDENT METHYLTRANSFERASE;          
 246:  1k92-A  2.6  3.7   79   444    5 PDB  MOLECULE: ARGININOSUCCINATE SYNTHASE;                                
 247:  2ho5-A  2.6  4.0   87   305   11 PDB  MOLECULE: OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY;                       
 248:  3khd-D  2.6  2.6   70   386    9 PDB  MOLECULE: PYRUVATE KINASE;                                           
 249:  1b76-A  2.6  3.5   69   442   14 PDB  MOLECULE: PROTEIN (GLYCYL-TRNA SYNTHETASE);                          
 250:  2cxh-A  2.6  3.4   74   180    7 PDB  MOLECULE: PROBABLE BRIX-DOMAIN RIBOSOMAL BIOGENESIS                  
 251:  2kpo-A  2.6  3.8   74   110    4 PDB  MOLECULE: ROSSMANN 2X2 FOLD PROTEIN;                                 
 252:  2z2v-A  2.5  4.2   93   349   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1688;                               
 253:  2hma-A  2.5  3.8   92   364    7 PDB  MOLECULE: PROBABLE TRNA (5-METHYLAMINOMETHYL-2-                      
 254:  2pg3-A  2.5  3.9   97   221   10 PDB  MOLECULE: QUEUOSINE BIOSYNTHESIS PROTEIN QUEC;                       
 255:  1lrj-A  2.5  4.8   97   338   11 PDB  MOLECULE: UDP-GLUCOSE 4-EPIMERASE;                                   
 256:  2jao-A  2.5  3.1   84   196    8 PDB  MOLECULE: 5'(3')-DEOXYRIBONUCLEOTIDASE;                              
 257:  3gns-A  2.5  3.5   94   221   18 PDB  MOLECULE: ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH];             
 258:  1txg-A  2.5  4.5   96   335   13 PDB  MOLECULE: GLYCEROL-3-PHOSPHATE DEHYDROGENASE [NAD(P)+];              
 259:  3ksu-A  2.5  3.9   94   234    9 PDB  MOLECULE: 3-OXOACYL-ACYL CARRIER PROTEIN REDUCTASE;                  
 260:  2i99-A  2.5  3.9   96   312   15 PDB  MOLECULE: MU-CRYSTALLIN HOMOLOG;                                     
 261:  2w90-B  2.5  3.6   94   471    9 PDB  MOLECULE: 6-PHOSPHOGLUCONATE DEHYDROGENASE,                          
 262:  2iyf-B  2.5  3.7  100   394   10 PDB  MOLECULE: OLEANDOMYCIN GLYCOSYLTRANSFERASE;                          
 263:  2yut-A  2.5  4.3   91   202   12 PDB  MOLECULE: PUTATIVE SHORT-CHAIN OXIDOREDUCTASE;                       
 264:  1u7u-A  2.5  3.7   91   198    4 PDB  MOLECULE: COENZYME A BIOSYNTHESIS BIFUNCTIONAL PROTEIN               
 265:  3dcm-X  2.5  3.4   82   189   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN TM_1570;                           
 266:  3cir-A  2.5  3.6   89   541    6 PDB  MOLECULE: FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT;                   
 267:  1u8f-O  2.5  2.8   76   333    9 PDB  MOLECULE: GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, LIVER;           
 268:  3l0d-A  2.5  2.9   79   332    6 PDB  MOLECULE: GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE;                  
 269:  2ome-A  2.5  4.1   85   330    6 PDB  MOLECULE: C-TERMINAL-BINDING PROTEIN 2;                              
 270:  2j3h-B  2.5  4.4   98   345   11 PDB  MOLECULE: NADP-DEPENDENT OXIDOREDUCTASE P1;                          
 271:  3jyl-A  2.5  3.8   91   325    9 PDB  MOLECULE: QUINONE OXIDOREDUCTASE;                                    
 272:  1wzc-B  2.5  3.7   89   244   10 PDB  MOLECULE: MANNOSYL-3-PHOSPHOGLYCERATE PHOSPHATASE;                   
 273:  1e3j-A  2.5  3.8   89   348    6 PDB  MOLECULE: NADP(H)-DEPENDENT KETOSE REDUCTASE;                        
 274:  1zej-A  2.5  3.6   82   282   16 PDB  MOLECULE: 3-HYDROXYACYL-COA DEHYDROGENASE;                           
 275:  3db2-A  2.5  4.6   87   347   11 PDB  MOLECULE: PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE;                   
 276:  1sbz-D  2.5  3.3   80   185   11 PDB  MOLECULE: PROBABLE AROMATIC ACID DECARBOXYLASE;                      
 277:  2c4n-A  2.5  4.0   88   250   15 PDB  MOLECULE: PROTEIN NAGD;                                              
 278:  1yb5-A  2.5  3.8   92   324    9 PDB  MOLECULE: QUINONE OXIDOREDUCTASE;                                    
 279:  2pib-A  2.5  3.2   82   216   11 PDB  MOLECULE: PHOSPHORYLATED CARBOHYDRATES PHOSPHATASE TM_1254;          
 280:  2hqb-A  2.5  3.7   80   283    9 PDB  MOLECULE: TRANSCRIPTIONAL ACTIVATOR OF COMK GENE;                    
 281:  3dnp-A  2.5  3.2   84   275   10 PDB  MOLECULE: STRESS RESPONSE PROTEIN YHAX;                              
 282:  1a3w-A  2.5  2.9   74   492   12 PDB  MOLECULE: PYRUVATE KINASE;                                           
 283:  2b7l-A  2.5  3.1   78   115   10 PDB  MOLECULE: GLYCEROL-3-PHOSPHATE CYTIDYLYLTRANSFERASE;                 
 284:  1zzo-A  2.5  3.5   76   134   11 PDB  MOLECULE: RV1677;                                                    
 285:  2qk4-B  2.5  3.7   80   424   10 PDB  MOLECULE: TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN                  
 286:  3hri-A  2.5  3.4   62   400    8 PDB  MOLECULE: HISTIDYL-TRNA SYNTHETASE;                                  
 287:  3f9i-B  2.4  3.7   94   229    3 PDB  MOLECULE: 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE;                
 288:  1pwx-A  2.4  3.3   92   252   11 PDB  MOLECULE: HALOHYDRIN DEHALOGENASE;                                   
 289:  2jg7-A  2.4  3.4   89   509    9 PDB  MOLECULE: ANTIQUITIN;                                                
 290:  2o8v-A  2.4  3.7   94   229    6 PDB  MOLECULE: PHOSPHOADENOSINE PHOSPHOSULFATE REDUCTASE;                 
 291:  1ja9-A  2.4  3.4   85   259   11 PDB  MOLECULE: 1,3,6,8-TETRAHYDROXYNAPHTHALENE REDUCTASE;                 
 292:  3i4f-A  2.4  3.3   87   242   15 PDB  MOLECULE: 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE;                
 293:  1yxm-C  2.4  3.6   87   263   14 PDB  MOLECULE: PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE;                   
 294:  3ezy-A  2.4  3.3   81   334    9 PDB  MOLECULE: DEHYDROGENASE;                                             
 295:  1g6k-A  2.4  3.4   88   261   11 PDB  MOLECULE: GLUCOSE 1-DEHYDROGENASE;                                   
 296:  1t57-A  2.4  3.6   89   186    9 PDB  MOLECULE: CONSERVED PROTEIN MTH1675;                                 
 297:  2eer-B  2.4  5.3   97   347   10 PDB  MOLECULE: NAD-DEPENDENT ALCOHOL DEHYDROGENASE;                       
 298:  1pgj-A  2.4  4.0  100   478   10 PDB  MOLECULE: 6-PHOSPHOGLUCONATE DEHYDROGENASE;                          
 299:  1xng-B  2.4  3.5   83   262    7 PDB  MOLECULE: NH(3)-DEPENDENT NAD(+) SYNTHETASE;                         
 300:  1zsv-A  2.4  3.8   91   327   11 PDB  MOLECULE: NADP-DEPENDENT LEUKOTRIENE B4 12-                          
 301:  3gpd-G  2.4  3.0   79   334    9 PDB  MOLECULE: D-GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE;                
 302:  2o48-X  2.4  3.1   85   331    9 PDB  MOLECULE: DIMERIC DIHYDRODIOL DEHYDROGENASE;                         
 303:  3iup-A  2.4  5.0   90   376   10 PDB  MOLECULE: PUTATIVE NADPH:QUINONE OXIDOREDUCTASE;                     
 304:  2is8-B  2.4  4.1   78   161   13 PDB  MOLECULE: MOLYBDOPTERIN BIOSYNTHESIS ENZYME, MOAB;                   
 305:  2p35-A  2.4  4.2   83   246   12 PDB  MOLECULE: TRANS-ACONITATE 2-METHYLTRANSFERASE;                       
 306:  3gg8-C  2.4  3.2   74   491   12 PDB  MOLECULE: PYRUVATE KINASE;                                           
 307:  2zr8-A  2.4  3.0   79   321    6 PDB  MOLECULE: UNCHARACTERIZED PROTEIN C320.14;                           
 308:  2nyv-A  2.4  3.7   85   217   12 PDB  MOLECULE: PHOSPHOGLYCOLATE PHOSPHATASE;                              
 309:  2i80-B  2.4  3.3   76   347   13 PDB  MOLECULE: D-ALANINE-D-ALANINE LIGASE;                                
 310:  2ia5-H  2.4  3.4   87   300   10 PDB  MOLECULE: POLYNUCLEOTIDE KINASE;                                     
 311:  3hv2-A  2.4  2.7   66   136    9 PDB  MOLECULE: RESPONSE REGULATOR/HD DOMAIN PROTEIN;                      
 312:  3elb-A  2.4  4.7   85   302    8 PDB  MOLECULE: ETHANOLAMINE-PHOSPHATE CYTIDYLYLTRANSFERASE;               
 313:  3cfy-A  2.4  3.2   67   130    6 PDB  MOLECULE: PUTATIVE LUXO REPRESSOR PROTEIN;                           
 314:  2dq4-A  2.4  3.9   92   343    8 PDB  MOLECULE: L-THREONINE 3-DEHYDROGENASE;                               
 315:  3jte-A  2.4  2.6   64   126   11 PDB  MOLECULE: RESPONSE REGULATOR RECEIVER PROTEIN;                       
 316:  3bre-B  2.4  2.7   66   328    9 PDB  MOLECULE: PROBABLE TWO-COMPONENT RESPONSE REGULATOR;                 
 317:  2zg6-B  2.4  4.8   87   203   10 PDB  MOLECULE: PUTATIVE UNCHARACTERIZED PROTEIN ST2620;                   
 318:  1yco-A  2.4  3.2   77   276    8 PDB  MOLECULE: BRANCHED-CHAIN PHOSPHOTRANSACYLASE;                        
 319:  3bq9-A  2.3  3.8  105   446    5 PDB  MOLECULE: PREDICTED ROSSMANN FOLD NUCLEOTIDE-BINDING                 
 320:  1ptm-A  2.3  4.2  110   329    9 PDB  MOLECULE: 4-HYDROXYTHREONINE-4-PHOSPHATE DEHYDROGENASE;              
 321:  2ehh-A  2.3  4.5  100   294   14 PDB  MOLECULE: DIHYDRODIPICOLINATE SYNTHASE;                              
 322:  1dli-A  2.3  4.9   86   402   14 PDB  MOLECULE: UDP-GLUCOSE DEHYDROGENASE;                                 
 323:  2cdq-A  2.3  3.4   89   473   10 PDB  MOLECULE: ASPARTOKINASE;                                             
 324:  1bdb-A  2.3  3.8   92   267    9 PDB  MOLECULE: CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE;            
 325:  1d7o-A  2.3  3.7   95   297    6 PDB  MOLECULE: ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)              
 326:  2b4q-A  2.3  3.2   93   256   10 PDB  MOLECULE: RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-                 
 327:  2bfp-D  2.3  3.8   89   257   11 PDB  MOLECULE: PTERIDINE REDUCTASE 1;                                     
 328:  2gdz-A  2.3  4.1   95   266    9 PDB  MOLECULE: NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN                     
 329:  1ae1-B  2.3  4.2   92   258   10 PDB  MOLECULE: TROPINONE REDUCTASE-I;                                     
 330:  1ipe-A  2.3  4.5   95   259    9 PDB  MOLECULE: TROPINONE REDUCTASE-II;                                    
 331:  2qq5-A  2.3  3.6   92   238    5 PDB  MOLECULE: DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 1;               
 332:  1wmb-A  2.3  3.7   89   260    6 PDB  MOLECULE: D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE;                      
 333:  2uvd-A  2.3  3.4   87   246    6 PDB  MOLECULE: 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE;                
 334:  1yqg-A  2.3  3.9   81   263   14 PDB  MOLECULE: PYRROLINE-5-CARBOXYLATE REDUCTASE;                         
 335:  2a4k-B  2.3  4.3   90   202   14 PDB  MOLECULE: 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE;                
 336:  3ib6-A  2.3  3.5   86   179   15 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
 337:  1dus-A  2.3  2.9   78   194    6 PDB  MOLECULE: MJ0882;                                                    
 338:  2oby-A  2.3  4.6   97   334    6 PDB  MOLECULE: PUTATIVE QUINONE OXIDOREDUCTASE;                           
 339:  1x19-A  2.3  3.6   84   350    8 PDB  MOLECULE: CRTF-RELATED PROTEIN;                                      
 340:  2yw2-A  2.3  4.0   80   423   11 PDB  MOLECULE: PHOSPHORIBOSYLAMINE--GLYCINE LIGASE;                       
 341:  1uls-B  2.3  4.0   92   245   14 PDB  MOLECULE: PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN                    
 342:  3cjt-M  2.3  3.3   80   256   13 PDB  MOLECULE: RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE;                   
 343:  1f8f-A  2.3  4.3   95   362    8 PDB  MOLECULE: BENZYL ALCOHOL DEHYDROGENASE;                              
 344:  1q92-A  2.3  3.0   82   195   11 PDB  MOLECULE: 5(3)-DEOXYRIBONUCLEOTIDASE;                                
 345:  1pjq-B  2.3  3.7   80   455    6 PDB  MOLECULE: SIROHEME SYNTHASE;                                         
 346:  3eyt-C  2.3  4.1   87   157    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN SPOA0173;                          
 347:  3goh-A  2.3  3.7   75   297    5 PDB  MOLECULE: ALCOHOL DEHYDROGENASE, ZINC-CONTAINING;                    
 348:  3cg4-A  2.3  2.7   65   126   15 PDB  MOLECULE: RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-          
 349:  2pju-D  2.3  2.8   69   208    7 PDB  MOLECULE: PROPIONATE CATABOLISM OPERON REGULATORY PROTEIN;           
 350:  2j3l-B  2.3  3.6   70   571   10 PDB  MOLECULE: PROLYL-TRNA SYNTHETASE;                                    
 351:  2axq-A  2.2  3.6   90   445   10 PDB  MOLECULE: SACCHAROPINE DEHYDROGENASE;                                
 352:  3gr6-D  2.2  3.9   95   260   13 PDB  MOLECULE: ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH];             
 353:  3iv6-A  2.2  3.9   86   258   13 PDB  MOLECULE: PUTATIVE ZN-DEPENDENT ALCOHOL DEHYDROGENASE;               
 354:  2qio-A  2.2  3.5   89   256    8 PDB  MOLECULE: ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE;                    
 355:  3fs2-A  2.2  3.8   83   258   10 PDB  MOLECULE: 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE;                 
 356:  2c07-A  2.2  4.0   95   246    5 PDB  MOLECULE: 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE;                
 357:  2hrb-A  2.2  4.0  102   273   12 PDB  MOLECULE: CARBONYL REDUCTASE [NADPH] 3;                              
 358:  3c7c-B  2.2  3.9   83   404   10 PDB  MOLECULE: OCTOPINE DEHYDROGENASE;                                    
 359:  3grp-A  2.2  3.5   83   231   11 PDB  MOLECULE: 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE;                 
 360:  3ftp-A  2.2  3.8   90   248    6 PDB  MOLECULE: 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE;                
 361:  3d0c-A  2.2  4.1   98   302   12 PDB  MOLECULE: DIHYDRODIPICOLINATE SYNTHASE;                              
 362:  3h2s-A  2.2  3.5   87   216   13 PDB  MOLECULE: PUTATIVE NADH-FLAVIN REDUCTASE;                            
 363:  3h7a-B  2.2  3.7   89   213   12 PDB  MOLECULE: SHORT CHAIN DEHYDROGENASE;                                 
 364:  1j1z-A  2.2  3.6   86   386   12 PDB  MOLECULE: ARGININOSUCCINATE SYNTHETASE;                              
 365:  1hxh-A  2.2  4.0   91   253   15 PDB  MOLECULE: 3BETA/17BETA-HYDROXYSTEROID DEHYDROGENASE;                 
 366:  1x1t-A  2.2  3.9   88   236    8 PDB  MOLECULE: D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE;                      
 367:  2dpo-A  2.2  4.0   83   310    7 PDB  MOLECULE: L-GULONATE 3-DEHYDROGENASE;                                
 368:  1x42-A  2.2  3.0   83   230   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH0459;                               
 369:  3a2k-A  2.2  3.6   87   462   10 PDB  MOLECULE: TRNA(ILE)-LYSIDINE SYNTHASE;                               
 370:  2gk4-A  2.2  3.5   90   229   11 PDB  MOLECULE: CONSERVED HYPOTHETICAL PROTEIN;                            
 371:  2g8l-B  2.2  3.5   82   286    7 PDB  MOLECULE: 287AA LONG HYPOTHETICAL PROTEIN;                           
 372:  1uzm-B  2.2  4.1   90   210   10 PDB  MOLECULE: 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE;                
 373:  3gt0-A  2.2  4.3   89   217    6 PDB  MOLECULE: PYRROLINE-5-CARBOXYLATE REDUCTASE;                         
 374:  1so8-A  2.2  4.6   90   208   10 PDB  MOLECULE: 3-HYDROXYACYL-COA DEHYDROGENASE TYPE II;                   
 375:  1y5m-A  2.2  3.9   87   265   11 PDB  MOLECULE: CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1;           
 376:  2iz1-B  2.2  4.3   96   471   10 PDB  MOLECULE: 6-PHOSPHOGLUCONATE DEHYDROGENASE,                          
 377:  1xq1-A  2.2  3.5   84   218    8 PDB  MOLECULE: PUTATIVE TROPINONE REDUCATSE;                              
 378:  3ga0-A  2.2  4.1   84   337    8 PDB  MOLECULE: C-TERMINAL-BINDING PROTEIN 1;                              
 379:  3ba1-A  2.2  3.9   84   312    7 PDB  MOLECULE: HYDROXYPHENYLPYRUVATE REDUCTASE;                           
 380:  1ehi-A  2.2  3.6   78   360   10 PDB  MOLECULE: D-ALANINE:D-LACTATE LIGASE;                                
 381:  2h6e-A  2.2  3.6   91   323    7 PDB  MOLECULE: D-ARABINOSE 1-DEHYDROGENASE;                               
 382:  2fmt-A  2.2  3.6   82   314    6 PDB  MOLECULE: FORMYL-METHIONYL-TRNAFMET2;                                
 383:  1p3y-1  2.2  3.4   77   171   13 PDB  MOLECULE: MRSD PROTEIN;                                              
 384:  3ew7-A  2.2  4.0   82   172   13 PDB  MOLECULE: LMO0794 PROTEIN;                                           
 385:  3eag-A  2.2  5.0   84   324    7 PDB  MOLECULE: UDP-N-ACETYLMURAMATE:L-ALANYL-GAMMA-D-GLUTAMYL-            
 386:  3bxo-A  2.2  3.6   84   237   10 PDB  MOLECULE: N,N-DIMETHYLTRANSFERASE;                                   
 387:  1k3r-B  2.2  3.4   82   264    6 PDB  MOLECULE: CONSERVED PROTEIN MT0001;                                  
 388:  2ip2-A  2.2  3.3   84   330    5 PDB  MOLECULE: PROBABLE PHENAZINE-SPECIFIC METHYLTRANSFERASE;             
 389:  1xxl-A  2.2  3.8   82   234   13 PDB  MOLECULE: YCGJ PROTEIN;                                              
 390:  2yy7-A  2.2  4.1   91   312    7 PDB  MOLECULE: L-THREONINE DEHYDROGENASE;                                 
 391:  1jsx-A  2.2  3.3   84   193    8 PDB  MOLECULE: GLUCOSE-INHIBITED DIVISION PROTEIN B;                      
 392:  2bgt-A  2.2  3.9   82   329    9 PDB  MOLECULE: BETA-GLUCOSYLTRANSFERASE;                                  
 393:  2oda-B  2.2  3.6   95   195    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PSPTO_2114;                           
 394:  1vbk-A  2.2  4.3   83   307    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1313;                               
 395:  2bon-A  2.2  4.6   79   287   11 PDB  MOLECULE: LIPID KINASE;                                              
 396:  2zwv-A  2.2  3.3   77   374    9 PDB  MOLECULE: PROBABLE RIBOSOMAL RNA SMALL SUBUNIT                       
 397:  2dkc-A  2.2  4.6   78   536    9 PDB  MOLECULE: PHOSPHOACETYLGLUCOSAMINE MUTASE;                           
 398:  3i5a-A  2.2  2.6   62   319   10 PDB  MOLECULE: RESPONSE REGULATOR/GGDEF DOMAIN PROTEIN;                   
 399:  1ovq-A  2.2  2.9   69   138   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YQGF;                                 
 400:  2b1k-A  2.2  3.4   75   149   12 PDB  MOLECULE: THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE;                  
 401:  2pl1-A  2.2  2.9   63   121   11 PDB  MOLECULE: TRANSCRIPTIONAL REGULATORY PROTEIN PHOP;                   
 402:  1w94-A  2.2  2.6   63   155    6 PDB  MOLECULE: PROBABLE BRIX-DOMAIN RIBOSOMAL BIOGENESIS                  
 403:  1vi1-A  2.1  3.4   95   327   11 PDB  MOLECULE: FATTY ACID/PHOSPHOLIPID SYNTHESIS PROTEIN PLSX;            
 404:  2det-A  2.1  3.7   90   365   11 PDB  MOLECULE: TRNA;                                                      
 405:  1epv-A  2.1  3.8   89   382   11 PDB  MOLECULE: ALANINE RACEMASE;                                          
 406:  2wkj-A  2.1  5.0  105   298    7 PDB  MOLECULE: N-ACETYLNEURAMINATE LYASE;                                 
 407:  2om6-A  2.1  2.7   86   233   10 PDB  MOLECULE: PROBABLE PHOSPHOSERINE PHOSPHATASE;                        
 408:  1p33-B  2.1  4.2   98   269   13 PDB  MOLECULE: PTERIDINE REDUCTASE 1;                                     
 409:  1xfi-A  2.1  4.2   89   343   11 PDB  MOLECULE: UNKNOWN PROTEIN;                                           
 410:  1qsg-G  2.1  3.8  100   259    7 PDB  MOLECULE: ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE;                    
 411:  2c7v-C  2.1  3.7   93   261   16 PDB  MOLECULE: PTERIDINE REDUCTASE;                                       
 412:  1yxm-A  2.1  4.2   90   297   12 PDB  MOLECULE: PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE;                   
 413:  2jlb-A  2.1  4.0   97   548    9 PDB  MOLECULE: XCC0866;                                                   
 414:  3gem-C  2.1  3.3   87   224    8 PDB  MOLECULE: SHORT CHAIN DEHYDROGENASE;                                 
 415:  1spx-A  2.1  3.7   90   237   12 PDB  MOLECULE: SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265);               
 416:  3fwn-A  2.1  3.8   95   467    5 PDB  MOLECULE: 6-PHOSPHOGLUCONATE DEHYDROGENASE,                          
 417:  1u7n-A  2.1  3.7  100   318   10 PDB  MOLECULE: FATTY ACID/PHOSPHOLIPID SYNTHESIS PROTEIN PLSX;            
 418:  2q2q-D  2.1  3.9   89   255    8 PDB  MOLECULE: BETA-D-HYDROXYBUTYRATE DEHYDROGENASE;                      
 419:  2et6-A  2.1  3.2   89   582   11 PDB  MOLECULE: (3R)-HYDROXYACYL-COA DEHYDROGENASE;                        
 420:  2yz7-A  2.1  4.0   91   260    8 PDB  MOLECULE: D-3-HYDROXYBUTYRATE DEHYDROGENASE;                         
 421:  1mxh-A  2.1  3.7   92   248   13 PDB  MOLECULE: PTERIDINE REDUCTASE 2;                                     
 422:  1f12-A  2.1  3.8   86   293   12 PDB  MOLECULE: L-3-HYDROXYACYL-COA DEHYDROGENASE;                         
 423:  1jgt-B  2.1  5.2   94   500    9 PDB  MOLECULE: BETA-LACTAM SYNTHETASE;                                    
 424:  1k2w-A  2.1  3.9   93   256    6 PDB  MOLECULE: SORBITOL DEHYDROGENASE;                                    
 425:  3ego-A  2.1  4.0   81   292   14 PDB  MOLECULE: PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE;                    
 426:  1ldm-A  2.1  3.6   82   329    9 PDB  MOLECULE: M4 LACTATE DEHYDROGENASE;                                  
 427:  2h2a-A  2.1  4.1   89   189    6 PDB  MOLECULE: PROBABLE NICOTINATE-NUCLEOTIDE                             
 428:  2uup-A  2.1  3.7   72   440    6 PDB  MOLECULE: UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE;           
 429:  1qor-A  2.1  4.1   91   326    5 PDB  MOLECULE: QUINONE OXIDOREDUCTASE;                                    
 430:  3hn2-A  2.1  4.8   82   302    9 PDB  MOLECULE: 2-DEHYDROPANTOATE 2-REDUCTASE;                             
 431:  1f9a-A  2.1  4.9   78   164    5 PDB  MOLECULE: HYPOTHETICAL PROTEIN MJ0541;                               
 432:  2gt1-A  2.1  3.4   80   323   13 PDB  MOLECULE: LIPOPOLYSACCHARIDE HEPTOSYLTRANSFERASE-1;                  
 433:  2esr-A  2.1  3.5   84   160   12 PDB  MOLECULE: METHYLTRANSFERASE;                                         
 434:  1o8o-B  2.1  3.7   78   163   10 PDB  MOLECULE: MOLYBDOPTERIN BIOSYNTHESIS CNX1 PROTEIN;                   
 435:  2pkw-A  2.1  3.6   81   254   11 PDB  MOLECULE: UPF0341 PROTEIN YHIQ;                                      
 436:  1egh-A  2.1  3.5   80   152    8 PDB  MOLECULE: METHYLGLYOXAL SYNTHASE;                                    
 437:  2hsz-A  2.1  3.5   86   225    8 PDB  MOLECULE: NOVEL PREDICTED PHOSPHATASE;                               
 438:  3gms-A  2.1  4.2   90   331   12 PDB  MOLECULE: PUTATIVE NADPH:QUINONE REDUCTASE;                          
 439:  3iau-A  2.1  3.5   80   363    4 PDB  MOLECULE: THREONINE DEAMINASE;                                       
 440:  2hcf-A  2.1  3.3   80   225   15 PDB  MOLECULE: HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY;              
 441:  2rjn-A  2.1  2.9   67   135    9 PDB  MOLECULE: RESPONSE REGULATOR RECEIVER:METAL-DEPENDENT                
 442:  1dbw-B  2.1  2.9   64   125   11 PDB  MOLECULE: TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ;                   
 443:  2g4c-A  2.1  3.1   69   397   12 PDB  MOLECULE: DNA POLYMERASE GAMMA SUBUNIT 2;                            
 444:  1dc7-A  2.1  3.2   64   124   11 PDB  MOLECULE: NITROGEN REGULATION PROTEIN;                               
 445:  1ujm-A  2.0  3.9   95   342   15 PDB  MOLECULE: ALDEHYDE REDUCTASE II;                                     
 446:  3eif-A  2.0  3.7   88   936   16 PDB  MOLECULE: C5A PEPTIDASE;                                             
 447:  1e3w-D  2.0  4.7   96   255    9 PDB  MOLECULE: SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE;               
 448:  1vl8-B  2.0  3.7   88   252    8 PDB  MOLECULE: GLUCONATE 5-DEHYDROGENASE;                                 
 449:  2o2s-A  2.0  3.6   90   303    2 PDB  MOLECULE: ENOYL-ACYL CARRIER REDUCTASE;                              
 450:  1w6u-A  2.0  3.6   87   288    9 PDB  MOLECULE: 2,4-DIENOYL-COA REDUCTASE,MITOCHONDRIAL                    
 451:  3k31-A  2.0  4.0   98   262    8 PDB  MOLECULE: ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE;                    
 452:  2ph3-A  2.0  3.9   94   245   11 PDB  MOLECULE: 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE;                
 453:  3ged-B  2.0  3.9   91   243    5 PDB  MOLECULE: SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR;                   
 454:  2r86-A  2.0  3.4   91   334   12 PDB  MOLECULE: PURP PROTEIN PF1517;                                       
 455:  2oo3-A  2.0  4.3  101   267    8 PDB  MOLECULE: PROTEIN INVOLVED IN CATABOLISM OF EXTERNAL DNA;            
 456:  1nxq-A  2.0  3.7   89   251   10 PDB  MOLECULE: R-ALCOHOL DEHYDROGENASE;                                   
 457:  1jax-A  2.0  3.8   86   212   20 PDB  MOLECULE: CONSERVED HYPOTHETICAL PROTEIN;                            
 458:  1aq6-A  2.0  3.3   85   245    7 PDB  MOLECULE: L-2-HALOACID DEHALOGENASE;                                 
 459:  3imf-B  2.0  3.1   85   249   12 PDB  MOLECULE: SHORT CHAIN DEHYDROGENASE;                                 
 460:  1o5i-A  2.0  3.8   86   234   10 PDB  MOLECULE: 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE;                
 461:  2dpl-A  2.0  3.3   78   287    8 PDB  MOLECULE: GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B;            
 462:  1cde-A  2.0  3.8   85   210   11 PDB  MOLECULE: PHOSPHORIBOSYL-GLYCINAMIDE FORMYLTRANSFERASE;              
 463:  2jl1-A  2.0  3.8   82   287   16 PDB  MOLECULE: TRIPHENYLMETHANE REDUCTASE;                                
 464:  1p91-A  2.0  3.3   83   268   12 PDB  MOLECULE: RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE A;           
 465:  1e8c-B  2.0  3.5   74   497    8 PDB  MOLECULE: UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-               
 466:  3ibs-A  2.0  3.2   81   206   12 PDB  MOLECULE: CONSERVED HYPOTHETICAL PROTEIN BATB;                       
 467:  3ed5-A  2.0  4.6   89   232    6 PDB  MOLECULE: YFNB;                                                      
 468:  1qmv-A  2.0  3.6   86   197    8 PDB  MOLECULE: HUMAN THIOREDOXIN PEROXIDASE-B;                            
 469:  2pq6-A  2.0  2.6   75   443   13 PDB  MOLECULE: UDP-GLUCURONOSYL/UDP-GLUCOSYLTRANSFERASE;                  
 470:  1yl5-A  2.0  3.2   70   247   13 PDB  MOLECULE: DIHYDRODIPICOLINATE REDUCTASE;                             
 471:  2b5x-A  2.0  3.9   81   148    9 PDB  MOLECULE: YKUV PROTEIN;                                              


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=mol1A Sbjct=1e5kA Z-score=19.2

back to top
DSSP  ---LEEEEELLL-lllllLLLHHHLEELLEEHHHHHHHHHLL--LEEEEELLlhHHHHHH
Query ---XKVAVLVGG-vgrriGXEKTEVXLCGKKLIEWVLEKYSP--FQTVFVCRdeKQAEKL   54
ident        || ||      |  |    | || |   |           |         |  
Sbjct mttITGVVLAGGkarrmgGVDKGLLELNGKPLWQHVADALMTqlSHVVVNAN--RHQEIY   58
DSSP  lllEEEEEELLLllllllLLLHHHLEELLEEHHHHHHHHHHHhlLLEEEELL--LLHHHH


DSSP  HlLLLLLEELLL-LLLLLHHHHHHHHHHHH--LLEEEEELLLLLLLHHHHHHHHHHHhhH
Query SsRYEAEFIWDL-HKGVGSIAGIHAALRHF--GSCVVAAIDXPFVKPEVLEHLYKEGekA  111
ident         | |      |  ||                  | |   |     |       
Sbjct Q-ASGLKVIEDSlADYPGPLAGMLSVMQQEagEWFLFCPCDTPYIPPDLAARLNHQR--K  115
DSSP  H-LLLLLEELLLlLLLLLHHHHHHHHHHHLllLEEEEEELLLLLLLLLHHHHHHHLL--L


DSSP  LLLEEEEE-LLLLLLLEEEELHHHHHHHHHHHHLLLLLLHHHHHLLLEEEEEHHhhllll
Query GCDALIPK-HDYPEPLLAYYAESAADELERAILQGIRKILVPLERLNVVYYPVEklrkfd  170
ident               |  |         |      | |   |                   
Sbjct DAPVVWVHdGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFS------  169
DSSP  LLLEEEEElLLLEEEEEEEEELLHHHHHHHHHHLLLLLHHHHHHHLLLEEEELL------


DSSP  LLLHHHLLLLLHHHHHHHHhhhhhl
Query KELISFFNINTPDDLKRAEeicskx  195
ident      | | |||  | |        
Sbjct DHKDAFVNVNTPEELARWQ------  188
DSSP  LLLLLLLLLLLHHHHHLLL------


No 2: Query=mol1A Sbjct=1vpaA Z-score=17.7

back to top
DSSP  ---LEEEEELLLLLLLLL--LLHHHLEELLEEHHHHHHHHHLL----LEEEEELlLHHHH
Query ---XKVAVLVGGVGRRIG--XEKTEVXLCGKKLIEWVLEKYSP----FQTVFVCrDEKQA   51
ident         |  | | |      |      |  | |  |            | |       
Sbjct hhmNVAILLAAGKGERMSenVPKQFLEIEGRMLFEYPLSTFLKseaiDGVVIVT-RREWF   59
DSSP  lllEEEEEEELLLLHHHLllLLHHHLEELLEELLHHHHHHHHHllllLEEEEEE-LHHHH


DSSP  HHHHLLLLL----LEELLlllLLLHHHHHHHHHHHH-----LLEEEEELLLLLLLHHHHH
Query EKLSSRYEA----EFIWDlhkGVGSIAGIHAALRHF-----GSCVVAAIDXPFVKPEVLE  102
ident |    |               |         ||            |     ||       
Sbjct EVVEKRVFHekvlGIVEG---GDTRSQSVRSALEFLekfspSYVLVHDSARPFLRKKHVS  116
DSSP  HHHHLLLLLlleeEEEEL---LLLHHHHHHHHHHHHhhhllLEEEEEELLLLLLLHHHHH


DSSP  HHHHHHHHHllLEEEEEL----------------------LLLLlLEEEELHH-HHHHHH
Query HLYKEGEKAgcDALIPKH----------------------DYPEpLLAYYAES-AADELE  139
ident             |                                              |
Sbjct EVLRRARET--GAATLALknsdalvrvendrieyiprkgvYRIL-TPQAFSYEiLKKAHE  173
DSSP  HHHHHHHHH--LEEEEEEellleeeeeelleeeeelllleEEEE-EEEEEEHHhHHHHHL


DSSP  HHhhllLLLL--hHHHHLL-LEEEEEHhhhllllllLHHHLLLLLHHHHHHHHHHHHHL-
Query RAilqgIRKI--lVPLERL-NVVYYPVeklrkfdkeLISFFNINTPDDLKRAEEICSKX-  195
ident               |   |                     |      ||  |  |     
Sbjct NG----GEWAddtEPVQKLgVKIALVE--------gDPLCFKVTFKEDLELARIIAREWe  221
DSSP  LL----LLLLllhHHHHLLlLLLEEEE--------lLHHHLLLLLLLHHHHHHHHHHHHl


No 3: Query=mol1A Sbjct=2e8bA Z-score=17.2

back to top
DSSP  -----------LEEEEELLLLLLLLL-llhhHLEElleEHHHHHHHHHLL--LEEEEELL
Query -----------XKVAVLVGGVGRRIG-xektEVXLcgkKLIEWVLEKYSP--FQTVFVCR   46
ident                || ||   | |            | || | |           |  
Sbjct ftwrkgslskvNTCYVLAGGKSKRFGedkllYEIK-gkKVIERVYETAKSvfKEVYIVAK   59
DSSP  lllllllllllLEEEEEEELLLLLLLllhhhHHHH-hhHHHHHHHHHHHLllLEEEEEEL


DSSP  lhhHHHHHHlLLLLLEELLLLLLLLHHHHHHHHHHHH--LLEEEEELLLLLLLHHHHHHH
Query dekQAEKLSsRYEAEFIWDLHKGVGSIAGIHAALRHF--GSCVVAAIDXPFVKPEVLEHL  104
ident      || |    |    |      || |   || |       |   | |  | |     
Sbjct ---DREKFS-FLNAPVVLDEFEESASIIGLYTALKHAkeENVFVLSGDLPLMKKETVLYV  115
DSSP  ---LLHHHH-HHLLLEEELLLLLLLHHHHHHHHHHHLllLEEEEEELLLLLLLHHHHHHH


DSSP  HHHHhhhLLLEEEEELLLLLLLEEEELHHHHHHHHHHHHLLLLLLHHHHHLLLEEEEEHh
Query YKEGekaGCDALIPKHDYPEPLLAYYAESAADELERAILQGIRKILVPLERLNVVYYPVe  164
ident               |      |   |        |  |  |   |   |           
Sbjct LENF---KEPVSVAKTEKLHTLVGVYSKKLLEKIEERIKKGDYRIWALLKDVGYNEVEI-  171
DSSP  HHLL---LLLEEEEELLLEEEEEEEEEHHHHHHHHHHHHLLLLLHHHHHHHHLLEEEEL-


DSSP  hHLLLlllLHHHLLlllhhHHHHhhhhhhhl
Query kLRKFdkeLISFFNintpdDLKRaeeicskx  195
ident              |                 
Sbjct -PEEL---RYTLLN-----MNTK--------  185
DSSP  -LHHH---HHHHLL-----LLLL--------


No 4: Query=mol1A Sbjct=2px7A Z-score=17.0

back to top
DSSP  --LEEEEELLLllllllLLHHHLEELLEEHHHHHHHHHLLL-EEEEELlLHHHhhHHHLL
Query --XKVAVLVGGvgrrigXEKTEVXLCGKKLIEWVLEKYSPF-QTVFVCrDEKQaeKLSSR   57
ident     |     |        |      |  | || |                         
Sbjct meVSVLIPAAG------GPKAFLQVGGRTLLEWTLAAFRDAaEVLVAL-PPGA--EPPKG   51
DSSP  llLEEEEELLL------LLHHHLLLLLLLHHHHHHHHLLLLlEEEEEE-LLLL--LLLLL


DSSP  LLLLEELllllLLLHHHHHHHHHHHH--LLEEEEELLLLLLLHHHHHHHHHHHHHHllLE
Query YEAEFIWdlhkGVGSIAGIHAALRHF--GSCVVAAIDXPFVKPEVLEHLYKEGEKAgcDA  115
ident   | |      |    |     |         |     |||                  |
Sbjct LGAVFLE---gGATRQASVARLLEAAslPLVLVHDVARPFVSRGLVARVLEAAQRS--GA  106
DSSP  LLLEEEE---lLLLHHHHHHHHHHHLllLEEEELLLLLLLLLHHHHHHHHHHHHHH--LE


DSSP  EEEEL-----------------------LLLLlLEEEELHH-HHHHHHHHHHLLLLLLH-
Query LIPKH-----------------------DYPEpLLAYYAES-AADELERAILQGIRKIL-  150
ident   |                                              |   |      
Sbjct AVPVLpvpdtlmapegeaygrvvpreafRLVQ-TPQGFFTAlLREAHAYARRKGLEASDd  165
DSSP  EEEEEellleeeeellllleeeelhhhlEEEL-LLEEEEHHhHHHHHHHHHHHLLLLLLh


DSSP  -HHHHL--LLEEEEEHhhhllllllLHHHLLLLLHHHHHHHHHHHHHl
Query -VPLER--LNVVYYPVeklrkfdkeLISFFNINTPDDLKRAEEICSKx  195
ident           |                  | |  | ||  ||      
Sbjct aQLVQAlgYPVALVEG---------EATAFKITHPQDLVLAEALARV-  203
DSSP  hHHHHHllLLLEEEEL---------LLLLLLLLLHHHHHHHHHHHLL-


No 5: Query=mol1A Sbjct=3dk5A Z-score=16.7

back to top
DSSP  -LEEEEELLLLLLLLL--LLHHHLEELLEEHHHHHHHHHLL---LEEEEELLlhhHHHHH
Query -XKVAVLVGGVGRRIG--XEKTEVXLCGKKLIEWVLEKYSP---FQTVFVCRdekQAEKL   54
ident    | ||  | | |      |    | |      ||             |          
Sbjct dTAVLVLAAGPGTRMRsdTPKVLHTLAGRSMLSHVLHAIAKlapQRLIVVLG---HDHQR   57
DSSP  lEEEEEEELLLLHHHLllLLHHHLEELLEEHHHHHHHHHHHhllLEEEEEEL---LLHHH


DSSP  HLLLL----------LLEELLLlLLLLHHHHHHHHHHHH-----LLEEEEELLLLLLLHH
Query SSRYE----------AEFIWDLhKGVGSIAGIHAALRHF-----GSCVVAAIDXPFVKPE   99
ident                           |        |        |  ||   | |     
Sbjct IAPLVgeladtlgrtIDVALQD-RPLGTGHAVLCGLSALpddyaGNVVVTSGDTPLLDAD  116
DSSP  HLLLLllhhhhllllLEEEELL-LLLLHHHHHHHHHLLLlllllLEEEEEELLLLLLLHH


DSSP  HHHHHHHHHHHHLLLEEEEEL---------------LLLLlLEEEELH-HHHHHHHHHhH
Query VLEHLYKEGEKAGCDALIPKH---------------DYPEpLLAYYAE-SAADELERAiL  143
ident  |  |                                                 | |   
Sbjct TLADLIATHRAVSAAVTVLTTtlddpfygrivmaivEVNA-GVYAFDIaALRSALSRL-S  174
DSSP  HHHHHHHHHHHLLLLEEEEEElllllllllllllllLEEE-EEEEELHhHHHHHHHLL-L


DSSP  LLL---LLLHHHHHLL-----LEEEEEHHhhlllllLLHHHLLLLLHHHHHHHHHHHHHL
Query QGI---RKILVPLERL-----NVVYYPVEklrkfdkELISFFNINTPDDLKRAEEICSKX  195
ident                |      |    |                |    |          
Sbjct SNNqqeLYLTDVIAILrsdgqTVHASHVD-------DSALVAGVNNRVQLAELASELNRR  227
DSSP  LLLlllLLLLHHHHHHhhlllLEELLEEL-------LHHHHLLLLLHHHHHHHHHHHHHH


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdva  287
DSSP  hhhhhhhllleellhhheeelllleelllleellleeeellleelllleelllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvph  347
DSSP  elllleelleeeeeeeelllleellleeellleeelllleeeeleeeelleelllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct ltyvgdadigeysnigassvfvnkrrttvgshvrtgsdtmfvapvtigdgaytgagtvvr  407
DSSP  lleeeleeelllllllllleeelllleeelllllllllleeellleelllleelllleel


DSSP  -----------------------------------
Query -----------------------------------  195
ident                                    
Sbjct edvppgalavsagpqrnienwvqrkrpgspaaqas  442
DSSP  llllllleelllllllllllhhhhhllllllllll


No 6: Query=mol1A Sbjct=1i52A Z-score=16.4

back to top
DSSP  ---LEEEEELLLLLLLLL--LLHHHLEELLEEHHHHHHHHHLL----LEEEEELlLHHHh
Query ---XKVAVLVGGVGRRIG--XEKTEVXLCGKKLIEWVLEKYSP----FQTVFVCrDEKQa   51
ident        |   | |||      |           |               |         
Sbjct hldVCAVVPAAGFGRRMQteCPKQYLSIGNQTILEHSVHALLAhprvKRVVIAI-SPGD-   58
DSSP  lllEEEEEEELLLLHHHLllLLHHHLEELLEEHHHHHHHHHHLllleEEEEEEE-LLLL-


DSSP  HHHHLLLL-----LLEELLlllLLLHHHHHHHHHHHH---LLEEEEELLLLLLLHHHHHH
Query EKLSSRYE-----AEFIWDlhkGVGSIAGIHAALRHF---GSCVVAAIDXPFVKPEVLEH  103
ident                       |        | |          |     |      |  
Sbjct SRFAQLPLanhpqITVVDG---GDERADSVLAGLKAAgdaQWVLVHDAARPCLHQDDLAR  115
DSSP  LLHHHLHHhhlllEEEEEL---LLLHHHHHHHHHHLLlllLEEEELLLLLLLLLHHHHHH


DSSP  HHhHHHHHLLLEEEEEL-------------------------LLLLlLEEEELH-HHHHH
Query LYkEGEKAGCDALIPKH-------------------------DYPEpLLAYYAE-SAADE  137
ident |            |                                            | 
Sbjct LL-ALSETSRTGGILAApvrdtmkraepgknaiahtvdrnglWHAL-TPQFFPReLLHDC  173
DSSP  HH-HHHHLLLLLEEEEEelllleeeelllllleeeeelllllEEEE-EEEEEEHhHHHHH


DSSP  HHHHHHLLLLLL--HHHHH--LLLEEEEEHhhhlllllLLHHhLLLLLHHHHHHHHHHHH
Query LERAILQGIRKI--LVPLE--RLNVVYYPVeklrkfdkELISfFNINTPDDLKRAEEICS  193
ident | ||   |         ||                             | ||  ||    
Sbjct LTRALNEGATITdeASALEycGFHPQLVEG--------RADN-IKVTRPEDLALAEFYLT  224
DSSP  HHHHHHLLLLLLlhHHHHHhlLLLLEEEEL--------LLLL-LLLLLHHHHHHHHHHHL


DSSP  Hl
Query Kx  195
ident   
Sbjct R-  225
DSSP  L-


No 7: Query=mol1A Sbjct=2vsiB Z-score=16.1

back to top
DSSP  --LEEEEELLLLLLlllLLHHHLEELLEEHHHHHHHHHLL----LEEEEELLLhHHHHHH
Query --XKVAVLVGGVGRrigXEKTEVXLCGKKLIEWVLEKYSP----FQTVFVCRDeKQAEKL   54
ident        | || |      |    |          ||          |            
Sbjct hmIYAGILAGGTGT---LPKQFLELGDRPILIHTIEKFVLepsiEKIVVGVHG-DWVSHA   56
DSSP  llEEEEEELLLLLL---LLLLLLEELLEEHHHHHHHHHHHllllLLEEEEELH-HHHHHH


DSSP  HLLLL---------LLEELLlllLLLHHHHHHHHHHHH---------LLEEEEELLLLLL
Query SSRYE---------AEFIWDlhkGVGSIAGIHAALRHF---------GSCVVAAIDXPFV   96
ident                        |      |                   |      || 
Sbjct EDLVDkylplykerIIITKG---GADRNTSIKNIIEAIdayrpltpeDIVVTHDSVRPFI  113
DSSP  HHHHHhhllhhhllEEEEEL---LLLHHHHHHHHHHHHhhhllllllLEEEEEELLLLLL


DSSP  LHHHHHHHHHHHhHHLLlEEEEEL------------------------LLLLlLEEEELH
Query KPEVLEHLYKEGeKAGCdALIPKH------------------------DYPEpLLAYYAE  132
ident                   |                                         
Sbjct TLRMIQDNIQLA-QNHD-AVDTVVeavdtivestngqfitdipnrahlYQGQ-TPQTFRC  170
DSSP  LHHHHHHHHHHH-LLLL-EEEEEEelllleeellllllllllllhhheEEEE-EEEEEEH


DSSP  -HHHHHHHHHhHLLL--LLLH-HHHHL--LLEEEEEHhhhlllllLLHHhLLLLLHHHHH
Query -SAADELERAiLQGI--RKIL-VPLER--LNVVYYPVeklrkfdkELISfFNINTPDDLK  186
ident     |                          |             |      | |  |||
Sbjct kDFMDLYGSLsDEEKeiLTDAcKIFVIkgKDVALAKG--------EYSN-LKITTVTDLK  221
DSSP  hHHHHHHHHLlLLHHhhLLLHhHHHHHllLLEEEEEL--------LLLL-LLLLLHHHHH


DSSP  HHHHHHhhl
Query RAEEICskx  195
ident  |       
Sbjct IAKSMI---  227
DSSP  HHHHHL---


No 8: Query=mol1A Sbjct=3fwwA Z-score=16.0

back to top
DSSP  --LEEEEELLLLLLLLL--LLHHHLEELLEEHHHHHHHHHLL---LEEEEELlLHHHhHH
Query --XKVAVLVGGVGRRIG--XEKTEVXLCGKKLIEWVLEKYSP---FQTVFVCrDEKQaEK   53
ident     |  |  | | |      |    | ||     |              |       | 
Sbjct ssMSVVILAAGKGTRMYsdLPKVLHPLAGKPMVQHVIDAAMKlgaQHVHLVY-GHGG-EL   58
DSSP  llEEEEEELLLLLHHHLllLLHHHLEELLEEHHHHHHHHHHHhllLLEEEEL-LLLH-HH


DSSP  HHL--LLLL-LEELLLlLLLLHHHHHHHHHHHHL---LEEEEELLLLLLLHHHHHHHHHH
Query LSS--RYEA-EFIWDLhKGVGSIAGIHAALRHFG---SCVVAAIDXPFVKPEVLEHLYKE  107
ident |                   |       |  ||           | |      |  |   
Sbjct LKKtlADPSlNWVLQA-EQLGTGHAMQQAAPHFAddeDILMLYGDVPLISVDTLQRLLAA  117
DSSP  HHHhlLLLLlEEELLL-LLLLHHHHHHHLHHHLLlllEEEEEELLLLLLLHHHHHHHLLL


DSSP  HhhHLLLEEEEEL-----------------------------------LLLLLlEEEELH
Query GekAGCDALIPKH-----------------------------------DYPEPlLAYYAE  132
ident                                                             
Sbjct K--PEGGIGLLTVkldnpsgygrivrengdvvgivehkdasdaqreinEINTG-ILVANG  174
DSSP  L--LLLLLEEEEEelllllllleeeelllleeeeellllllllhhhllEEEEE-EELLLH


DSSP  -HHHHHHHHHHHL-LLLLLHHHHHLL----LEEEEEHhhhlllLLLLHHHLLLLLHHHHH
Query -SAADELERAILQ-GIRKILVPLERL----NVVYYPVeklrkfDKELISFFNINTPDDLK  186
ident       |       |   |                           |      |    | 
Sbjct rDLKRWLSLLDNNqGEFYITDIIALAhadgKKIATVH------PTRLSEVEGVNNRLQLS  228
DSSP  hHHHHHHLLLLLLlLLLLHHHHHHHHhlllLLLEEEL------LLLHHHHLLLLLHHHHH


DSSP  HHHHHHHHL---------------------------------------------------
Query RAEEICSKX---------------------------------------------------  195
ident   |                                                         
Sbjct ALERVFQTEqaeklllagvmlldpsrfdlrgelthgrditidtnviieghvilgdrvrig  288
DSSP  HHHHHHHHHhhhhhhhllleellllleeeeeeeeelllleellleeeeeeeeelllleel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct tgcvlkncvigddseispytvledarldanctvgpfarlrpgaelaegahvgnfveikka  348
DSSP  llleeelleelllleelllleeelleelllleellleeelllleelllleeeeleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct rlgkgskaghlsylgdaeigagvnigagtitcnydnkfktiigddvfvgsdtqlvapvtv  408
DSSP  eelllleeeelleeeeeeelllleelllleeellllllleeelllleelllleeelleee


DSSP  ------------------------------------
Query ------------------------------------  195
ident                                     
Sbjct angatigagttvtrdvaenelvisrvkqvhiqgwkr  444
DSSP  lllleelllleelllllllleellllllllllllll


No 9: Query=mol1A Sbjct=1h7eA Z-score=15.9

back to top
DSSP  --LEEEEELLLLLLLLlLLHHHLEELLEEHHHHHHHHHLL----LEEEEELLLHHHHHHH
Query --XKVAVLVGGVGRRIgXEKTEVXLCGKKLIEWVLEKYSP----FQTVFVCRDEKQAEKL   54
ident               |    |      ||  |  | |                |       
Sbjct skAVIVIPARYGSSRL-PGKPLLDIVGKPMIQHVYERALQvagvAEVWVATDDPRVEQAV   59
DSSP  llEEEEEELLLLLLLL-LLHHHLEELLEEHHHHHHHHHHLllllLEEEEEELLHHHHHHH


DSSP  HlLLLLLEELLLLLLLLHHHHHHHHHHHH--LLEEEEELLLLLLLHHHHHHHHHHHHHHL
Query SsRYEAEFIWDLHKGVGSIAGIHAALRHF--GSCVVAAIDXPFVKPEVLEHLYKEGEKAG  112
ident         |                              | |   |   | |        
Sbjct Q-AFGGKAIMTRNDHESGTDRLVEVMHKVeaDIYINLQGDEPMIRPRDVETLLQGMRDDP  118
DSSP  H-HLLLEEEELLLLLLLHHHHHHHHHHHLllLEEEELLLLLLLLLHHHHHHHHHHHHHLL


DSSP  -LLEEEEEL------------------------------------------LLLLLlEEE
Query -CDALIPKH------------------------------------------DYPEPlLAY  129
ident         |                                                   
Sbjct aLPVATLCHaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekaryLKHVG-IYA  177
DSSP  lLLEEEEEEeelhhhhlllllleeeellllleeeeelllllllllhhhlleEEEEE-EEE


DSSP  ELHHHHHHHHHhhHLLL------lLLHHHHH--LLLEEEEEHhhhllllLLLHhhLLLLL
Query YAESAADELERaiLQGI------rKILVPLE--RLNVVYYPVeklrkfdKELIsfFNINT  181
ident |            |               |     |     |                 |
Sbjct YRRDVLQNYSQ--LPESmpeqaesLEQLRLMnaGINIRTFEV-------AATG--PGVDT  226
DSSP  EEHHHHHHHHH--LLLLhhhhhhlLLLHHHHhlLLLEEEEEL-------LLLL--LLLLL


DSSP  HHHHHHHHHHHHHL-----
Query PDDLKRAEEICSKX-----  195
ident |  |               
Sbjct PACLEKVRALMAQElaena  245
DSSP  HHHHHHHHHHHHHHhhhll


No 10: Query=mol1A Sbjct=3d8vA Z-score=15.7

back to top
DSSP  ------LEEEEELLLLLLLLL--LLHHHLEELLEEHHHHHHHHHLLL---EEEEELLLhh
Query ------XKVAVLVGGVGRRIG--XEKTEVXLCGKKLIEWVLEKYSPF---QTVFVCRDek   49
ident         | ||  | | |      |    | |      ||             |     
Sbjct mtfpgdTAVLVLAAGPGTRMRsdTPKVLHTLAGRSMLSHVLHAIAKLapqRLIVVLGH--   58
DSSP  llllllEEEEEELLLLLHHHLllLLHHHLEELLEEHHHHHHHHHHLLlllEEEEEELL--


DSSP  HHHHHHLLLL---------LLEELLLlLLLLHHHHHHHHHHHH-----LLEEEEELLLLL
Query QAEKLSSRYE---------AEFIWDLhKGVGSIAGIHAALRHF-----GSCVVAAIDXPF   95
ident                               |        |        |  ||   | | 
Sbjct DHQRIAPLVGeladtlgrtIDVALQD-RPLGTGHAVLCGLSALpddyaGNVVVTSGDTPL  117
DSSP  LHHHLHHHHHhhhhhllllLEEEELL-LLLLHHHHHHHHHLLLlllllLEEEEEELLLLL


DSSP  LLHHHHHHHHHHHHHHLLLEEEEELL----------------------------------
Query VKPEVLEHLYKEGEKAGCDALIPKHD----------------------------------  121
ident      |  |                                                   
Sbjct LDADTLADLIATHRAVSAAVTVLTTTlddpfgygrilrtqdhevmaiveqtdatpsqrei  177
DSSP  LLHHHHHHHHHHHHHLLLLEEEEEEElllllllleeeellllleeeeelhhhllllhhhl


DSSP  -llLLLEEEELHH-HHHHHHHH--hhlLLLLLHHHHHLL-----LEEEEEHHhhlllllL
Query -ypEPLLAYYAES-AADELERA--ilqGIRKILVPLERL-----NVVYYPVEklrkfdkE  172
ident                   | |                 |      |    |         
Sbjct revNAGVYAFDIAaLRSALSRLsnnaqQELYLTDVIAILrsdgqTVHASHVD-------D  230
DSSP  leeEEEEEEEEHHhHHHHHHLLlllllLLLLLLHHHHHHhhlllLEEEEELL-------L


DSSP  LHHHLLLLLHHHHHHHHHHHHHL-------------------------------------
Query LISFFNINTPDDLKRAEEICSKX-------------------------------------  195
ident        |    |                                               
Sbjct SALVAGVNNRVQLAELASELNRRvvaahqlagvtvvdpattwidvdvtigrdtvihpgtq  290
DSSP  HHHHLLLLLHHHHHHHHHHHHHHhhhhhhhllleellhhheeelllleelllleelllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct llgrtqiggrcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalga  350
DSSP  eellleelllleelllleeeeeeelllleelleeeeeeeelllleellleeellleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct dgklgafvevknstigtgtkvphltyvgdadigeysnigassvfvnydtskrrttvgshv  410
DSSP  lleeeeeeeeelleelllleeeeeeeeeleeelllleelllleeelllllllleeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct rtgsdtmfvapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaq  470
DSSP  eelllleeellleelllleelllleelllllllleelllllllllllhhhhhlllllllh


DSSP  -------
Query -------  195
ident        
Sbjct askrase  477
DSSP  hhhhhll


No 11: Query=mol1A Sbjct=2v0iA Z-score=15.7

back to top
DSSP  --LEEEEELLLLLLLLL--LLHHHLEELLEEHHHHHHHHHLL---LEEEEELL-lHHHHH
Query --XKVAVLVGGVGRRIG--XEKTEVXLCGKKLIEWVLEKYSP---FQTVFVCR-dEKQAE   52
ident        |  | | |      |      ||     |                        
Sbjct kaLSAVILAAGKGTRMYsdLPKVLHTIAGKPMVKHVIDTAHQlgsENIHLIYGhgGDLMR   60
DSSP  llEEEEEELLLLLHHHLllLLHHHLEELLEEHHHHHHHHHHHlllLLEEEEELllHHHHH


DSSP  HHHLLLLLLEELLLlLLLLHHHHHHHHHHHHL---LEEEEELLLLLLLHHHHHHHHHHHh
Query KLSSRYEAEFIWDLhKGVGSIAGIHAALRHFG---SCVVAAIDXPFVKPEVLEHLYKEGe  109
ident                   |       |   |      ||   | |    | || |     
Sbjct THLANEQVNWVLQT-EQLGTAHAVQQAAPFFKdneNIVVLYGDAPLITKETLEKLIEAK-  118
DSSP  HHLLLLLLEEEELL-LLLLHHHHHHHHHHHLLlllEEEEEELLLLLLLHHHHHHHHHHL-


DSSP  hHLLLEEEEEL-----------------------------------LLLLLlEEEELH-H
Query kAGCDALIPKH-----------------------------------DYPEPlLAYYAE-S  133
ident                                                            |
Sbjct -PENGIALLTVnldnptgygriirengnvvaiveqkdanaeqlnikEVNTG-VMVSDGaS  176
DSSP  -LLLLEEEEEEelllllllleeeeelleeeeeelhhhllllhhhllEEEEE-EEEEEHhH


DSSP  HHHHHHHHHHL---LLLLLHHHHHLL-----LEEEEEHHhhlllllLLHHHLLLLLHHHH
Query AADELERAILQ---GIRKILVPLERL-----NVVYYPVEklrkfdkELISFFNINTPDDL  185
ident     | |       |                 ||                    |    |
Sbjct FKKWLARVGNNnaqGEYYLTDLIALAnqdncQVVAVQAT-------DVMEVEGANNRLQL  229
DSSP  HHHHHLLLLLLlllLLLLLLHHHHHHhhlllLEEEEELL-------LLHHHLLLLLHHHH


DSSP  HHHHHHHHHL--------------------------------------------------
Query KRAEEICSKX--------------------------------------------------  195
ident    |                                                        
Sbjct AALERYFQNKqasklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvki  289
DSSP  HHHHHHHHHHhhhhhhhllleellhhheeeeeeeeelllleellleeeeeeeeellllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct gtgcvlknvvigndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikk  349
DSSP  lllleeeeeeelllleelllleeeeeeelllleellleeelllleelllleeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct stvgkgskvnhltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvap  409
DSSP  leelllleeeeeeeeeleeelllleelllleeeelllllllleeelllleelllleeeel


DSSP  -----------------------------------------
Query -----------------------------------------  195
ident                                          
Sbjct vkvangatigagttitrdvgenelvitrvaqrhiqgwqrpi  450
DSSP  eeelllleelllleelllllllleellllllllllllllll


No 12: Query=mol1A Sbjct=1hm8A Z-score=15.6

back to top
DSSP  -LEEEEELLLLLLLLLL--LHHHLEELLEEHHHHHHHHHLL---LEEEEELLlhHHHHHH
Query -XKVAVLVGGVGRRIGX--EKTEVXLCGKKLIEWVLEKYSP---FQTVFVCRdeKQAEKL   54
ident       |  | | |      |      |    | |           || |      ||  
Sbjct sNFAIILAAGKGTRMKSdlPKVLHKVAGISMLEHVFRSVGAiqpEKTVTVVG--HKAELV   58
DSSP  lEEEEEEELLLLHHHLLllLHHHLEELLEEHHHHHHHHHHLlllLEEEEEEL--LLHHHH


DSSP  HLLLL--LLEELLllLLLLHHHHHHHHhHHHL-----LEEEEELLLLLLLHHHHHHHHHH
Query SSRYE--AEFIWDlhKGVGSIAGIHAAlRHFG-----SCVVAAIDXPFVKPEVLEHLYKE  107
ident         ||        |                     | | | |    | |  |   
Sbjct EEVLAgqTEFVTQ-sEQLGTGHAVMMT-EPILeglsgHTLVIAGDTPLITGESLKNLIDF  116
DSSP  HHHLLllLEEEEL-lLLLLHHHHHHLL-HHHHlllllEEEEEELLLLLLLHHHHHHHHHH


DSSP  HHHHLLLEEEEEL------------------------------------LLLLlLEEEEL
Query GEKAGCDALIPKH------------------------------------DYPEpLLAYYA  131
ident        | |                                                  
Sbjct HINHKNVATILTAetdnpfgygrivrndnaevlriveqkdatdfekqikEINT-GTYVFD  175
DSSP  HHHHLLLEEEEEEelllllllleeeellllleeeeellllllhhhhlllEEEE-EEEEEE


DSSP  H-HHHHHHHHHHHLL---LLLLHHHHHLL-----LEEEEEHHhhlllllLLHHHLLLLLH
Query E-SAADELERAILQG---IRKILVPLERL-----NVVYYPVEklrkfdkELISFFNINTP  182
ident        |             |             |  |                  |  
Sbjct NeRLFEALKNINTNNaqgEYYITDVIGIFretgeKVGAYTLK-------DFDESLGVNDR  228
DSSP  HhHHHHHHHHHHHLLlllLLLHHHHHHHHhhhllLEEEEEEL-------LHHHHLLLLLH


DSSP  HHHHHHHHHHHHL-----------------------------------------------
Query DDLKRAEEICSKX-----------------------------------------------  195
ident   |  ||                                                     
Sbjct VALATAESVMRRRinhkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigae  288
DSSP  HHHHHHHHHHHHHhhhhhhhllleellhhhleelllleelllleelllleeellleelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct tvltngtyvvdstigagavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvev  348
DSSP  leelllleeelleelllleellleeelleelllleelllleelllleelllleeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct kgssigentkaghltyigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstii  408
DSSP  elleelllleeeeeeeeeleeelllleelllleeellllllllleeelllleelllleee


DSSP  --------------------------------------------------
Query --------------------------------------------------  195
ident                                                   
Sbjct apvelgdnslvgagstitkdvpadaiaigrgrqinkdeyatrlphhpknq  458
DSSP  lleeelllleelllleelllllllleelllllllllllhhhhllllhhhl


No 13: Query=mol1A Sbjct=3f1cB Z-score=15.5

back to top
DSSP  --LEEEEELLllllllLLLHHHLEELLEEHHHHHHHHHLLL----EEEEELlLHHHHHHH
Query --XKVAVLVGgvgrriGXEKTEVXLCGKKLIEWVLEKYSPF----QTVFVCrDEKQAEKL   54
ident        | |         |    | ||  |    ||                       
Sbjct slIYAQILAG--mgnvSMPKQFLPLNGKPIIVHTVEKFILNtrfdKILISS-PKEWMNHA   57
DSSP  llEEEEEELL--llllLLLHHHLEELLEEHHHHHHHHHHLLllllEEEEEE-LHHHHHHH


DSSP  HLLLL-------LLEELLlllLLLHHHHHHHHHHHH---------LLEEEEELLLLLLLH
Query SSRYE-------AEFIWDlhkGVGSIAGIHAALRHF---------GSCVVAAIDXPFVKP   98
ident                |     |      |    |              |      ||   
Sbjct EDNIKkyisddrIVVIEG---GEDRNETIMNGIRFVektygltddDIIVTHDAVRPFLTH  114
DSSP  HHHHHhhlllllEEEEEL---LLLHHHHHHHHHHHHhhhllllllLEEEEEELLLLLLLH


DSSP  HHHHHHHHHHHHhlLLEEEEEL------------------------LLLLlLEEEELH-H
Query EVLEHLYKEGEKagCDALIPKH------------------------DYPEpLLAYYAE-S  133
ident    |            |                                           
Sbjct RIIEENIDAALE--TGAVDTVIealdtivessnhevitdipvrdhmYQGQ-TPQSFNMkK  171
DSSP  HHHHHHHHHHHH--LLEEEEEEelllleeellllllllllllhhheEEEE-EEEEEEHhH


DSSP  HHHHHHHH--hHLLLLLL-HHHHHL--LLEEEEEHhhhllllllLHHHLLLLLHHHHHHH
Query AADELERA--iLQGIRKI-LVPLER--LNVVYYPVeklrkfdkeLISFFNINTPDDLKRA  188
ident               |              |               |    | || ||| |
Sbjct VFNHYQNLtpeKKQILTDaCKICLLagDDVKLVKG---------EIFNIKITTPYDLKVA  222
DSSP  HHHHHHLLlhhHHHHLLLhHHHHHHhlLLLEEEEL---------LLLLLLLLLHHHHHHH


DSSP  HHHHHHL-
Query EEICSKX-  195
ident   |     
Sbjct NAIIQERi  230
DSSP  HHHHHHHl


No 14: Query=mol1A Sbjct=1w55A Z-score=15.3

back to top
DSSP  --LEEEEELLLLLLLLL--LLHHHLEELLEEHHHHHHHHHLL----LEEEEELLlhhHHH
Query --XKVAVLVGGVGRRIG--XEKTEVXLCGKKLIEWVLEKYSP----FQTVFVCRdekQAE   52
ident        |  |   |      |    |    |        |        |          
Sbjct seMSLIMLAAGNSTRFNtkVKKQFLRLGNDPLWLYATKNLSSfypfKKIVVTSS---NIT   57
DSSP  llEEEEEELLLLLLLLLllLLHHHLEELLEEHHHHHHHHHHLllllLLEEEEEL---LHH


DSSP  HHHLLLL-LLEELllllLLLHHHHHHHHHHHH--LLEEEEELLLLLLLHHHHHHHHHHHh
Query KLSSRYE-AEFIWdlhkGVGSIAGIHAALRHF--GSCVVAAIDXPFVKPEVLEHLYKEGe  109
ident          |||     |         ||         |       |       |     
Sbjct YMKKFTKnYEFIE---gGDTRAESLKKALELIdsEFVMVSDVARVLVSKNLFDRLIENL-  113
DSSP  HHHLLLLlLEEEE---lLLLHHHHHHHHHLLLllLEEEEEELLLLLLLHHHHHHHHLLH-


DSSP  hHLLLEEEEELL-----------------llllLEEEELH-HHHHHHHHHHhlllLLLH-
Query kAGCDALIPKHD-----------------ypepLLAYYAE-SAADELERAIlqgiRKIL-  150
ident     |   |                                     |             
Sbjct -DKADCITPALKvadttlfdnealqrekikliqTPQISKTkLLKKALDQNL----EFTDd  168
DSSP  -HHLLEEEEEELlllleeelleeelhhhlleelLLEEEEHhHHHHHLLLLL----LLLLh


DSSP  -HHHHL--LLEEEEEHhhhllllllLHHHLLLLLHHHHHHHhHHHH--------------
Query -VPLER--LNVVYYPVeklrkfdkeLISFFNINTPDDLKRAeEICS--------------  193
ident                                     |||                     
Sbjct sTAIAAmgGKIWFVEG---------EENARKLTFKEDLKKL-DLPTpsfeiftgngfdvh  218
DSSP  hHHHHLllLLEEEEEL---------LHHHLLLLLHHHHHHL-LLLLlllleeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  193
ident                                                             
Sbjct efgenrplllagvqihptmglkahsdgdvlahsltdailgaaglgdigelypdtdmkfkn  278
DSSP  eeeeelleeelleeeelleeelllllllhhhhhhhhhhhhhlllllhhhhllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  193
ident                                                             
Sbjct ansmellkqaydkvreigfelinidicvmaqspklkdfkqamqsniahtldldefrinvk  338
DSSP  llhhhhhhhhhhhhhhlleeeeeeeeeeellllllhhhhhhhhhhhhhhhlllhhheeee


DSSP  -----------------------------hl
Query -----------------------------kx  195
ident                                
Sbjct attteklgfigrkegmavlssvnlkyfdwtr  369
DSSP  eelllllhhhhllleeeeeeeeeeeelllll


No 15: Query=mol1A Sbjct=3k8dA Z-score=15.2

back to top
DSSP  -LEEEEELLLLLLLLlLLHHHLEELLEEHHHHHHHHHLL---LEEEEELLLHHHHHHHHl
Query -XKVAVLVGGVGRRIgXEKTEVXLCGKKLIEWVLEKYSP---FQTVFVCRDEKQAEKLSs   56
ident    |         |    |  |   ||  |  |||                |  |     
Sbjct sFVVIIPARYASTRL-PGKPLVDINGKPMIVHVLERAREsgaERIIVATDHEDVARAVE-   58
DSSP  lLEEEEELLLLLLLL-LLHHHLEELLEEHHHHHHHHHHHlllLEEEEEELLHHHHHHHH-


DSSP  LLLLLEELLLLLLLLHHHHHHHHHHHH-----LLEEEEELLLLLLLHHHHHHHHHHHHHH
Query RYEAEFIWDLHKGVGSIAGIHAALRHF-----GSCVVAAIDXPFVKPEVLEHLYKEGEKA  111
ident     |                              |    | |                 
Sbjct AAGGEVCMTRADHQSGTERLAEVVEKCafsddTVIVNVQGDEPMIPATIIRQVADNLAQR  118
DSSP  HLLLEEEELLLLLLLHHHHHHHHHHHHlllllLEEEEELLLLLLLLHHHHHHHHHHHHLL


DSSP  LLLEEEEELL-------------------------------------------------l
Query GCDALIPKHD-------------------------------------------------y  122
ident                                                             
Sbjct QVGMATLAVPihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnfl  178
DSSP  LLLEEEEEEElllhhhhlllllleeeellllleeeeelllllllhhhhhhllllllllle


DSSP  lLLLEEEELHHHHHHHHHhhHLLL------LLLHHHHH--LLLEEEEEHhhhllllLLLH
Query pEPLLAYYAESAADELERaiLQGI------RKILVPLE--RLNVVYYPVeklrkfdKELI  174
ident        |             |                                   |  
Sbjct rHLGIYGYRAGFIRRYVN--WQPSplehieMLEQLRVLwyGEKIHVAVA-------QEVP  229
DSSP  eELLEEEEEHHHHHHHHH--LLLLhhhhhhLLLLHHHHhlLLLEEEEEL-------LLLL


DSSP  hhLLLLLHHHHHHHHHHHhhl
Query sfFNINTPDDLKRAEEICskx  195
ident       || || |        
Sbjct -gTGVDTPEDLERVRAEM---  246
DSSP  -lLLLLLHHHHHHHHHHL---


No 16: Query=mol1A Sbjct=1vicA Z-score=15.2

back to top
DSSP  -LEEEEELLLLLLLLlLLHHHLEELLEEHHHHHHHHHLL---LEEEEELLLHHHHHHHHl
Query -XKVAVLVGGVGRRIgXEKTEVXLCGKKLIEWVLEKYSP---FQTVFVCRDEKQAEKLSs   56
ident    |         |    |      ||  |  | ||               |  |     
Sbjct sFTVIIPARFASSRL-PGKPLADIKGKPMIQHVFEKALQsgaSRVIIATDNENVADVAK-   58
DSSP  lLEEEEELLLLLLLL-LLHHHLEELLEEHHHHHHHHHHHlllLEEEEEELLHHHHHHHH-


DSSP  LLLLLEELLLLLLLLHHHHHHHHHHHH-----LLEEEEELLLLLLLHHHHHHHHHHHHHH
Query RYEAEFIWDLHKGVGSIAGIHAALRHF-----GSCVVAAIDXPFVKPEVLEHLYKEGEKA  111
ident    ||                              |    | |   |           | 
Sbjct SFGAEVCMTSVNHNSGTERLAEVVEKLaipdnEIIVNIQGDEPLIPPVIVRQVADNLAKF  118
DSSP  HLLLEEEELLLLLLLHHHHHHHHHHHLlllllLEEEELLLLLLLLLHHHHHHHHHHHHHH


DSSP  LLLEEEEELL--------------------------------------------------
Query GCDALIPKHD--------------------------------------------------  121
ident                                                             
Sbjct NVNMASLAVKihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqls  178
DSSP  LLLEEEEEEElllhhhhlllllleeeellllleeeeelllllllhhhhlllllhhhllll


DSSP  ----lLLLLeEEELHHHHHHHHHhhHLLL------lLLHHHHH--LLLEEEEEHHhhlll
Query ----yPEPLlAYYAESAADELERaiLQGI------rKILVPLE--RLNVVYYPVEklrkf  169
ident             |                                               
Sbjct daylrHIGI-YAYRAGFIKQYVQ--WAPTqlenlekLEQLRVLynGERIHVELAK-----  230
DSSP  llleeEEEE-EEEEHHHHHHHHH--LLLLhhhhhhlLLLHHHHhlLLLEEEEELL-----


DSSP  lllLHHHLLLLLHHHHHHHHHHHHHL--
Query dkeLISFFNINTPDDLKRAEEICSKX--  195
ident            |  ||     |      
Sbjct ---EVPAVGVDTAEDLEKVRAILAANgs  255
DSSP  ---LLLLLLLLLHHHHHHHHHHHHHLll


No 17: Query=mol1A Sbjct=2e3dC Z-score=15.0

back to top
DSSP  -----LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---LLEEEEELlL
Query -----XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---PFQTVFVCrD   47
ident       |    | | | |         |    |  | ||  |            | |   
Sbjct intkvKKAVIPVAGLGTRMLpatkaIPKEMLPLVDKPLIQYVVNECIaagITEIVLVT-H   59
DSSP  lllllLEEEEELLLLLHHHLlhhhlLLHHHLEELLEEHHHHHHHHHHhllLLEEEEEE-L


DSSP  HHHhHHHHLLLL--------------------------LLEELLLlLLLLHHHHHHHHHH
Query EKQaEKLSSRYE--------------------------AEFIWDLhKGVGSIAGIHAALR   81
ident                                                  |       |  
Sbjct SSK-NSIENHFDtsfeleamlerqlldevqsicpphvtIMQVRQG-LAKGLGHAVLCAHP  117
DSSP  HHH-HHHHHHHLllhhhhhllllhhhhhhhllllllleEEEEELL-LLLLHHHHHHLLHH


DSSP  HH--LLEEEEELLLLL-----lLHHH-HHHHHHHHHHHLLlEEEEEL-------------
Query HF--GSCVVAAIDXPF-----vKPEV-LEHLYKEGEKAGCdALIPKH-------------  120
ident         |   |              |          |    |                
Sbjct VVgdEPVAVILPDVILdeyesdLSQDnLAEMIRRFDETGH-SQIMVEpvadvtaygvvdc  176
DSSP  HHllLLEEEELLLEEEllllllLLLLlHHHHHHHHHHHLL-EEEEEEelllhhhllleel


DSSP  --------------------------LLLLlLEEEELHHHHHHHHHHHHL--LLLLLHHH
Query --------------------------DYPEpLLAYYAESAADELERAILQ--GIRKILVP  152
ident                                            |                
Sbjct kgvelapgesvpmvgvvpkadvapsnLAIV-GRYVLSADIWPLLAKTPPGagDEIQLTDA  235
DSSP  llllllllleeeeleellllllllllEEEE-EEEEELLLHHHHHHHLLLLhhHLLLHHHH


DSSP  HHLLL----EEEEEHhhhlllllLLHHhLLLLLHHHHHHHHHHHHHL-------------
Query LERLN----VVYYPVeklrkfdkELISfFNINTPDDLKRAEEICSKX-------------  195
ident    |     |  |             |            |                    
Sbjct IDMLIeketVEAYHM--------KGKS-HDCGNKLGYMQAFVEYGIRhntlgtefkawle  286
DSSP  HHHHHhhllEEEEEL--------LLLE-EELLLHHHHHHHHHHHHHLllllhhhhhhhhh


DSSP  --
Query --  195
ident   
Sbjct ee  288
DSSP  hl


No 18: Query=mol1A Sbjct=2oi6B Z-score=14.8

back to top
DSSP  ---LEEEEELLLLLLLLLL--LHHHLEELLEEHHHHHHHHHLLL---EEEEELLlhhHHH
Query ---XKVAVLVGGVGRRIGX--EKTEVXLCGKKLIEWVLEKYSPF---QTVFVCRdekQAE   52
ident      |  |  | | |      |    | ||     |              |        
Sbjct nnaMSVVILAAGKGTRMYSdlPKVLHTLAGKAMVQHVIDAANELgaaHVHLVYG--hGGD   58
DSSP  lleEEEEEELLLLLHHHLLllLHHHLEELLEEHHHHHHHHHLLLlllLEEEEEL--lLHH


DSSP  HHHLLLL---LLEELLLlLLLLHHHHHHHHHHHHL---LEEEEELLLLLLLHHHHHHHHH
Query KLSSRYE---AEFIWDLhKGVGSIAGIHAALRHFG---SCVVAAIDXPFVKPEVLEHLYK  106
ident  |                   |       |   |           | |    | |  |  
Sbjct LLKQALKddnLNWVLQA-EQLGTGHAMQQAAPFFAddeDILMLYGDVPLISVETLQRLRD  117
DSSP  HHHHHLLlllEEEEELL-LLLLHHHHHHHHHHHLLlleEEEEEELLLLLLLHHHHHHHHH


DSSP  HHhhHLLLEEEEELL----------------------------------llllLEEEELH
Query EGekAGCDALIPKHD----------------------------------ypepLLAYYAE  132
ident                                                             
Sbjct AK--PQGGIGLLTVKlddptgygritrengkvtgivehkdatdeqrqiqeintGILIANG  175
DSSP  HL--LLLLEEEEEEElllllllleeeeelleeeeeellllllllhhhlleeeeEEEEEEH


DSSP  -HHHHHHHHHhHLLL----LLLHHHHHLL-----LEEEEEhhhhlllLLLLHHHLLLLLH
Query -SAADELERAiLQGI----RKILVPLERL-----NVVYYPveklrkfDKELISFFNINTP  182
ident       |              |              |             |      |  
Sbjct aDMKRWLAKL-TNNNaqgeYYITDIIALAyqegrEIVAVH-------PQRLSEVEGVNNR  227
DSSP  hHHHHHHLLL-LLLLllllLLLLHHHHHHhhlllLEEEEL-------LLLHHHHLLLLLH


DSSP  HHHHHHHHHHHHL-----------------------------------------------
Query DDLKRAEEICSKX-----------------------------------------------  195
ident   | | |                                                     
Sbjct LQLSRLERVYQSEqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghr  287
DSSP  HHHHHHHHHHHHHhhhhhhhllleellhhheeeeeeeeelllleellleeeeeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vkigtgcviknsvigddceispytvvedanlaaactigpfarlrpgaellegahvgnfve  347
DSSP  leelllleeelleelllleelllleeelleelllleellleeellleeelllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct mkkarlgkgskaghltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtql  407
DSSP  eeeeeelllleeeeeeeeeeeeelllleelllleeellllllllleeelllleellllee


DSSP  ---------------------------------------------
Query ---------------------------------------------  195
ident                                              
Sbjct vapvtvgkgatiaagttvtrnvgenalaisrvpqtqkegwrrpvk  452
DSSP  elleeelllleelllleelllllllleelllllllllllllllll


No 19: Query=mol1A Sbjct=3jtjA Z-score=14.7

back to top
DSSP  -LEEEEELLLLLLLLlLLHHHLEELLEEHHHHHHHHHLL---LEEEEELLLhHHHHHHHL
Query -XKVAVLVGGVGRRIgXEKTEVXLCGKKLIEWVLEKYSP---FQTVFVCRDeKQAEKLSS   56
ident              |    |      ||     | |                     |   
Sbjct sFIAIIPARYASTRL-PGKPLADIAGKPXVVHVXERALAsgaDRVIVATDH-PDVVKAVE   58
DSSP  lLEEEEEELLLLLLL-LLHHHLEELLEEHHHHHHHHHHHlllLEEEEEELL-HHHHHHHH


DSSP  LLLLLEELLLLLLLLHHHHHHHHHHHH-----LLEEEEELLLLLLLHHHHHHHHHHHHHH
Query RYEAEFIWDLHKGVGSIAGIHAALRHF-----GSCVVAAIDXPFVKPEVLEHLYKEGEKA  111
ident     |                    |         |    | | | |             
Sbjct AAGGEVCLTRADHQSGTERLAEVIEHYgfaddDIIVNVQGDEPLVPPVIIRQVADNLAAC  118
DSSP  HLLLEEEELLLLLLLHHHHHHHHHHHHlllllLEEEELLLLLLLLLHHHHHHHHHHHHHL


DSSP  LLLEEEEELL--------------------------------------------------
Query GCDALIPKHD--------------------------------------------------  121
ident                                                             
Sbjct SAGXATLAVPiasseeafnpnavkvvxdaqgyalyfsratipwererfaqsketigdcfl  178
DSSP  LLLEEEEEEElllhhhhlllllleeeellllleeeeelllllllhhhhhhllllllllle


DSSP  lLLLLeEEELHHHHHHHHHhhHLLL------lLLHHHHH--LLLEEEEEHHhhllllllL
Query yPEPLlAYYAESAADELERaiLQGI------rKILVPLE--RLNVVYYPVEklrkfdkeL  173
ident         |                                                   
Sbjct rHIGI-YAYRAGFIRRYVN--WAPSqleqielLEQLRVLwyGEKIHVAVAK--------A  227
DSSP  eEEEE-EEEEHHHHHHHLL--LLLLhhhhhhlLLLHHHHhlLLLLEEEELL--------L


DSSP  HHHLLLLLHHHHHHHHHHHHHL
Query ISFFNINTPDDLKRAEEICSKX  195
ident        |  || |   |    
Sbjct VPAVGVDTQSDLDRVRAIXLNQ  249
DSSP  LLLLLLLLHHHHHHHHHHHLLL


No 20: Query=mol1A Sbjct=1w77A Z-score=14.7

back to top
DSSP  ----LEEEEELLLlllllLLLHHHLEELLEEHHHHHHHHHLL----LEEEEELlLHHHHh
Query ----XKVAVLVGGvgrriGXEKTEVXLCGKKLIEWVLEKYSP----FQTVFVCrDEKQAe   52
ident       |  | ||        |    | |           |        | || |     
Sbjct meksVSVILLAGG-----SMPKQYIPLLGQPIALYSFFTFSRmpevKEIVVVC-DPFFR-   53
DSSP  llllEEEEEELLL-----LLLLLLLEELLEEHHHHHHHHHHLllleEEEEEEL-LHHHL-


DSSP  HHHLLLL------LLEELLlllLLLHHHHHHHHHHHH----lLEEEEELLLLLLLHHHHH
Query KLSSRYE------AEFIWDlhkGVGSIAGIHAALRHF----gSCVVAAIDXPFVKPEVLE  102
ident      ||        |      |          |                 | |  |  |
Sbjct DIFEEYEesidvdLRFAIP---GKERQDSVYSGLQEIdvnseLVCIHDSARPLVNTEDVE  110
DSSP  HHHHLLLllllleEEEELL---LLLHHHHHHHHHHLLlllllEEEEEELLLLLLLHHHHH


DSSP  HHHHHHHHHLllEEEEEL------------------LLLLlLEEEELHH-HHHHHHHHHH
Query HLYKEGEKAGcdALIPKH------------------DYPEpLLAYYAES-AADELERAIL  143
ident    | |   |  |                                          |    
Sbjct KVLKDGSAVG--AAVLGVpakatikevnsdslvvtlWEMQ-TPQVIKPElLKKGFELVKS  167
DSSP  HHHHHHHHHL--EEEEEEelllllllllllllllllEEEE-EEEEELHHhHHHHHHHHHH


DSSP  LLLLLLHH-HHHLL--LEEEEEHhhhlllllLLHHhLLLLLHHHHHHHHHHHHHl
Query QGIRKILV-PLERL--NVVYYPVeklrkfdkELISfFNINTPDDLKRAEEICSKx  195
ident  |     |   | |   |                      |||||  || | |  
Sbjct EGLEVTDVsIVEYLkhPVYVSQG--------SYTN-IKVTTPDDLLLAERILSE-  212
DSSP  LLLLLLLLlLLHHHllLLEEEEL--------LLLL-LLLLLHHHHHHHHHHHHL-


No 21: Query=mol1A Sbjct=1wvcA Z-score=14.6

back to top
DSSP  -LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---LLEEEEELL-lHHH
Query -XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---PFQTVFVCR-dEKQ   50
ident   |   | || | |         |  |   ||         ||          |      
Sbjct aSKAVILAGGLGTRLSeetivKPKPMVEIGGKPILWHIMKMYSvhgIKDFIICCGykGYV   60
DSSP  lLEEEEELLLLLHHHHhhhllLLHHHLEELLEEHHHHHHHHHHhllLLEEEEEELllLHH


DSSP  HHHHHLLL--------------------------lLLEELLLlLLLLHHHHHHHHhHHHL
Query AEKLSSRY--------------------------eAEFIWDLhKGVGSIAGIHAAlRHFG   84
ident        |                                                    
Sbjct IKEYFANYflhmsdvtfhmaenrmevhhkrvepwnVTLVDTG-DSSMTGGRLKRV-AEYV  118
DSSP  HHHHHHLHhhhhlleeeehhhleeeelllllllleEEEEELL-LLLLHHHHHHHL-HHHH


DSSP  ----LEEEEELLLlLLLHhHHHHHHHHHHHHLLLEEEEEL--------------------
Query ----SCVVAAIDXpFVKPeVLEHLYKEGEKAGCDALIPKH--------------------  120
ident            |                   |  |                         
Sbjct kddeAFLFTYGDG-VADL-DIKATIDFHKAHGKKATLTATfppgrgaldiqagqvrsfqk  176
DSSP  llllLEEEEELLE-EELL-LHHHHHHHHHHHLLLEEEEEEllllllleeeelleeeeell


DSSP  ----LLLLlLEEEELHHHHHHhHHHHhlLLLLLHHHHHLL----LEEEEEHhhhlllllL
Query ----DYPEpLLAYYAESAADElERAIlqGIRKILVPLERL----NVVYYPVeklrkfdkE  172
ident                 |  |               ||  |                    
Sbjct gdgaMING-GFFVLNPSVIDL-IDND--ATTWEQEPLMTLaqqgELMAFEH--------P  224
DSSP  llllLEEL-LLEEELHHHHHH-LLLL--LLLLLLLHHHHHhhllLEEEEEE--------L


DSSP  LHHhLLLLLHHHHHHHHHHHHHL--------
Query LISfFNINTPDDLKRAEEICSKX--------  195
ident         |  |    |    |         
Sbjct GFW-QPMDTLRDKVYLEGLWEKGkapwktwe  254
DSSP  LLE-EELLLHHHHHHHHHHHHLLllllllll


No 22: Query=mol1A Sbjct=3hl3A Z-score=14.3

back to top
DSSP  -LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---LLEEEEELlLHHHH
Query -XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---PFQTVFVCrDEKQA   51
ident   |   | || | |         |          |     |                   
Sbjct aMKGIILAGGTGSRLYpitkvTNKHLLPVGRYPMIYHAVYKLKqcdITDIMIIT-GKEHM   59
DSSP  lEEEEEELLLLLHHHLlllllLLHHHLEELLEEHHHHHHHHHHlllLLEEEEEE-ELLLH


DSSP  HHHHLLLL--------LLEELLllLLLLHHHHHHHHhHHHL---LEEEEELLLLLLLHhh
Query EKLSSRYE--------AEFIWDlhKGVGSIAGIHAAlRHFG---SCVVAAIDXPFVKPev  100
ident     |                   |  |           |      ||   |  |     
Sbjct GDVVSFLGsgqefgvsFTYRVQ-dKAGGIAQALGLC-EDFVgndRMVVILGDNIFSDD--  115
DSSP  HHHHHHHLllhhhlleEEEEEE-lLLLLHHHHHHLL-HHHHlllEEEEEELLEEELLL--


DSSP  HHHHHHHHHHHLLLEEEEELL------------------------------llllLEEEE
Query LEHLYKEGEKAGCDALIPKHD------------------------------ypepLLAYY  130
ident       |       |                                            |
Sbjct IRPYVEEFTNQKEGAKVLLQSvddperfgvaniqnrkiieieekpkepkssyavtGIYLY  175
DSSP  LHHHHHHHHLLLLLEEEEEEElllhhhleeeeeelleeeeeeelllllllleeeeEEEEE


DSSP  LHHHHHHHHHHhHLLL--LLLHHHHHLL----LEEEEEHhhhlllllLLHHhLLLLLHHH
Query AESAADELERAiLQGI--RKILVPLERL----NVVYYPVeklrkfdkELISfFNINTPDD  184
ident                     |              |                    |   
Sbjct DSKVFSYIKELkPSARgeLEITDINNWYlkrgVLTYNEM--------SGWW-TDAGTHVS  226
DSSP  LLHHHHHHHLLlLLHHhhLLHHHHHHHHhhllLEEEEEL--------LLLE-EELLLHHH


DSSP  HHHHHHHHHHL---------
Query LKRAEEICSKX---------  195
ident | ||                
Sbjct LQRANALARDInfgkqfnge  246
DSSP  HHHHHHHHLLLlllhhhhll


No 23: Query=mol1A Sbjct=1vgwB Z-score=14.2

back to top
DSSP  ----LEEEEELLlllllllllHHHLEELLEEHHHHHHHHHLL----LEEEEELlLHHH--
Query ----XKVAVLVGgvgrrigxeKTEVXLCGKKLIEWVLEKYSP----FQTVFVCrDEKQ--   50
ident                      |  |    |   | ||           || |        
Sbjct lkrkNIALIPAA---------KQYVEIGSKTVLEHVLGIFERheavDLTVVVV-SPEDtf   50
DSSP  llllEEEEEELL---------LLLLLLLLLLHHHHHHHHHHLllllLEEEEEL-LLLLlh


DSSP  HHHHHLLLL-LLEELLlllLLLHHHHHHHHHHHH---------LLEEEEELLLLLLLHHH
Query AEKLSSRYE-AEFIWDlhkGVGSIAGIHAALRHF---------GSCVVAAIDXPFVKPEV  100
ident | |                |                           |          | 
Sbjct ADKVQTAFPqVRVWKN--gGQTRAETVRNGVAKLletglaaetDNILVHDAARCCLPSEA  108
DSSP  HHHHHHHLLlLEEELL--lLLLHHHHHHHHHHHHhhhllllllLEEEELLLLLLLLLHHH


DSSP  HHHHHHHHHHHLLlEEEEELLL----------------------lllLEEEELH-HHHHH
Query LEHLYKEGEKAGCdALIPKHDY----------------------pepLLAYYAE-SAADE  137
ident |  |      |     |                                           
Sbjct LARLIEQAGNAAE-GGILAVPVadtlkraesgqisatvdrsglwqaqTPQLFQAgLLHRA  167
DSSP  HHHHHHHHLLLLL-LEEEEEELllleeeelllleeeeelllleeeeeEEEEEEHhHHHHH


DSSP  HHHhhhLLLLLL-HHHHHL--LLEEEEEHhhhlllllLLHHhLLLLLHHHHHHHHHHHHh
Query LERailQGIRKI-LVPLER--LNVVYYPVeklrkfdkELISfFNINTPDDLKRAEEICSk  194
ident |      |         |                             | |          
Sbjct LAA---LGGITDeASAVEKlgVRPLLIQG--------DARN-LKLTQPQDAYIVRLLLD-  214
DSSP  LLL---LLLLLLhHHHHHLllLLLEEEEL--------LLLL-LLLLLHHHHHHHHHHHL-


DSSP  l
Query x  195
ident  
Sbjct -  214
DSSP  -


No 24: Query=mol1A Sbjct=1mc3A Z-score=14.1

back to top
DSSP  -LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---lLEEEEELlLHHHH
Query -XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---pFQTVFVCrDEKQA   51
ident  ||   | || | |         |       |  |   |                     
Sbjct hXKGIILAGGSGTRLHpitrgVSKQLLPIYDKPXIYYPLSVLXlagiREILIIT-TPEDK   59
DSSP  lLEEEEELLLLLHHHHhhhllLLHHHLEELLEELLHHHHHHHHhlllLEEEEEE-LLLLH


DSSP  HHHHLLLL--------LLEELLLlllLLHHHHHHHHHHHH--LLEEEEELLLLL---lLH
Query EKLSSRYE--------AEFIWDLhkgVGSIAGIHAALRHF--GSCVVAAIDXPF---vKP   98
ident                  |         |                      |  |      
Sbjct GYFQRLLGdgsefgiqLEYAEQP-spDGLAQAFIIGETFLngEPSCLVLGDNIFfgqgFS  118
DSSP  HHHHHHHLllhhhlleEEEEELL-llLLLLHHHHHLHHHHllLLEEEEELLEEEelllLH


DSSP  HHHHHHHHhhhHHLLlEEEEELL-------------------------------llllLE
Query EVLEHLYKegeKAGCdALIPKHD-------------------------------ypepLL  127
ident   | |           |                                          |
Sbjct PKLRHVAA---RTEG-ATVFGYQvxdperfgvvefddnfraisleekpkqpksnwavtGL  174
DSSP  HHHHHHLL---LLLL-EEEEEEElllllllllleeelleeeeellllllllllleeeeEE


DSSP  EEELHHHHHHHHHhhHLLL----LLLHHHHHLL----LEEEEEHHhhllllLLLHhHLLL
Query AYYAESAADELERaiLQGI----RKILVPLERL----NVVYYPVEklrkfdKELIsFFNI  179
ident   |                      |           |                      
Sbjct YFYDSKVVEYAKQ--VKPSergeLEITSINQXYleagNLTVELLG------RGFA-WLDT  225
DSSP  EELLLHHHHHHHL--LLLLllllLLHHHHHHHHhhllLEEEEELL------LLLE-EEEL


DSSP  LLHHHHHHHHHHHHHL--------------------------------------------
Query NTPDDLKRAEEICSKX--------------------------------------------  195
ident  | | |  |                                                   
Sbjct GTHDSLIEASTFVQTVekrqgfkiacleeiawrngwlddegvkraasslaktgygqylle  285
DSSP  LLHHHHHHHHHHHHHHhhhhllllllhhhhhhhlllllhhhhhhhhhhllllhhhhhhhh


DSSP  ------
Query ------  195
ident       
Sbjct llrarp  291
DSSP  llllll


No 25: Query=mol1A Sbjct=2ux8A Z-score=14.0

back to top
DSSP  -----LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---LLEEEEELlL
Query -----XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---PFQTVFVCrD   47
ident       |    | | | |         |         ||             |  ||   
Sbjct tikplRKAVFPVAGLGTRFLpatkaMPKEMLPVVDRPLIQYAVDEAVeagIEQMIFVT-G   59
DSSP  lllllLEEEEEELLLLHHHLlllllLLHHHLEELLEEHHHHHHHHHHhllLLEEEEEE-L


DSSP  HHHhHHHHLLLL----------------------------LLEELLLlLLLLHHHHHHHH
Query EKQaEKLSSRYE----------------------------AEFIWDLhKGVGSIAGIHAA   79
ident       |                                            |       |
Sbjct RGK-SALEDHFDiayeleatmaargksldvldgtrlkpgnIAYVRQQ-EPMGLGHAVWCA  117
DSSP  LLL-HHHHHHLLllhhhhhhhhlllllhhhhlllllllllEEEEELL-LLLLHHHHHHLL


DSSP  HHHH--LLEEEEELLLLL-lLHHHHHHHHHHHHHHLLlEEEEEL---------------L
Query LRHF--GSCVVAAIDXPF-vKPEVLEHLYKEGEKAGCdALIPKH---------------D  121
ident           |   |      |  |        | |   ||                   
Sbjct RDIVgdEPFAVLLPDDFMfgQPGCLKQMVDAYNKVGG-NLICAEiitpgtqdgvltevnL  176
DSSP  HHHHllLLEEEELLLEEEelLLLHHHHHHHHHHHHLL-EEEEELlllllllllleeellL


DSSP  LLLlLEEEELHHHHHHHHHHHhllllLLHHhHHLLL----EEEEEHhhhlllllLLHHhL
Query YPEpLLAYYAESAADELERAIlqgirKILVpLERLN----VVYYPVeklrkfdkELISfF  177
ident                 ||               |                          
Sbjct SVI-GRYILQPEVMRILENQG-----LTDA-MQRMIgdqpFHGVTF--------QGTR-Y  220
DSSP  LEE-EEEEELLHHHHHHHHLL-----LLLL-HHHHLllllEEEEEL--------LLEE-E


DSSP  LLLLHHHHHHHHHHHHHL-----------------
Query NINTPDDLKRAEEICSKX-----------------  195
ident           |                        
Sbjct DCGDKAGFIQANLAVALSrpdlepavrafavkalg  255
DSSP  ELLLHHHHHHHHHHHHHHllllhhhhhhhhhhhhl


No 26: Query=mol1A Sbjct=1eyrA Z-score=13.8

back to top
DSSP  ----LEEEEELLLLLLLLlLLHHHLEELLEEHHHHHHHHHLL----LEEEEELLLHHHHH
Query ----XKVAVLVGGVGRRIgXEKTEVXLCGKKLIEWVLEKYSP----FQTVFVCRDEKQAE   52
ident          |           |      |  |                          ||
Sbjct xekqNIAVILARQNSKGL-PLKNLRKXNGISLLGHTINAAISskcfDRIIVSTDGGLIAE   59
DSSP  llleEEEEEELLLLLLLL-LLHHHLEELLEEHHHHHHHHHHHhlllLEEEEEELLHHHHH


DSSP  HHHlLLLLLEELLLLLL----LLHHHHHHHHHHHH----LLEEEEELLLLLLLHHHHHHH
Query KLSsRYEAEFIWDLHKG----VGSIAGIHAALRHF----GSCVVAAIDXPFVKPEVLEHL  104
ident         |              || |   ||       |         |          
Sbjct EAK-NFGVEVVLRPAELasdtASSISGVIHALETIgsnsGTVTLLQPTSPLRTGAHIREA  118
DSSP  HHH-HLLLEEEELLHHHhlllLLHHHHHHHHHHHHllllEEEEELLLLLLLLLHHHHHHH


DSSP  HHHHHHHLLLEEEEEL-------------------------------------LLLLLLE
Query YKEGEKAGCDALIPKH-------------------------------------DYPEPLL  127
ident                                                        |    
Sbjct FSLFDEKIKGSVVSACpxehhplktllqinngeyapxrhlsdleqprqqlpqaFRPNGAI  178
DSSP  HLLLLLLLLLLEEEEEelllllllleeellllleeelllhhhhlllhhhllleEEEEEEE


DSSP  EEELH-HHHHHHhhhhhllllllhhhhhlLLEEEEEHhhhlllllLLHHHLLLLLHHHHH
Query AYYAE-SAADELerailqgirkilvplerLNVVYYPVeklrkfdkELISFFNINTPDDLK  186
ident       |                                             | |  || 
Sbjct YINDTaSLIANN--------------cffIAPTKLYI-------xSHQDSIDIDTELDLQ  217
DSSP  EEEEHhHHHHHL--------------lllLLLLEEEE-------lLLLLLLLLLLHHHHH


DSSP  HHHHHHHHl
Query RAEEICSKx  195
ident  || |    
Sbjct QAENILNH-  225
DSSP  HHHHHHLL-


No 27: Query=mol1A Sbjct=3d5nA Z-score=13.8

back to top
DSSP  --LEEEEELLLlllllllLHHHLEELLEEHHHHHHHHHLLLEEEEELlLHHHhHHHHLL-
Query --XKVAVLVGGvgrrigxEKTEVXLCGKKLIEWVLEKYSPFQTVFVCrDEKQaEKLSSR-   57
ident     |  |  |        |          |      |                      
Sbjct xnIGVIILAAGegkrfggDKLLAKIDNTPIIXRTIRIYGDLEKIIIV-GKYV-NEXLPLl   58
DSSP  llEEEEEELLLlllllllLHHHLLLLLLLHHHHHHHHLLLLLLLEEE-LLLH-HHHHHHl


DSSP  LLLLEELLLL-LLLLhHHHHHHHHHHHL---LEEEEELLLLLLLHHHHHHHHHHHhHHLL
Query YEAEFIWDLH-KGVGsIAGIHAALRHFG---SCVVAAIDXPFVKPEVLEHLYKEGeKAGC  113
ident      |                 || |       ||  |||||  |          |  |
Sbjct XDQIVIYNPFwNEGI-STSLKLGLRFFKdydAVLVALGDXPFVTKEDVNKIINTF-KPNC  116
DSSP  LLLLEEELLLhHHLH-HHHHHHHHHHLLlllEEEEEELLLLLLLHHHHHHHHHLL-LLLL


DSSP  LEEEEEL-LLLLllEEEELHHHHHHHHHHHhlllLLLHHHHHLL---LEEEEEHhhhlll
Query DALIPKH-DYPEplLAYYAESAADELERAIlqgiRKILVPLERL---NVVYYPVeklrkf  169
ident  | || |             |   | |           | |                   
Sbjct KAVIPTHkGERG-nPVLISKSLFNEIEKLR--gdVGARVILNKIkieELCFIEC------  167
DSSP  LEEEEEElLEEL-lLEEEEHHHHHHHHHLL--llLLLHHHHLLLlhhHEEEEEL------


DSSP  lllLHHHLLLLLhhhhhhhhhhhhhl
Query dkeLISFFNINTpddlkraeeicskx  195
ident          |                
Sbjct --sEGVLIDIDK-------------k  178
DSSP  --lHHHLLLLLL-------------l


No 28: Query=mol1A Sbjct=2ux8G Z-score=13.6

back to top
DSSP  -----LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---LLEEEEELlL
Query -----XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---PFQTVFVCrD   47
ident       |    | | | |         |         ||             |  ||   
Sbjct tikplRKAVFPVAGLGTRFLpatkaMPKEMLPVVDRPLIQYAVDEAVeagIEQMIFVT-G   59
DSSP  lllllLEEEEEELLLLHHHLlllllLLHHHLEELLEEHHHHHHHHHHhllLLEEEEEE-L


DSSP  HHHhHHHHLLLL----------------------------LLEELLLlLLLLHHHHHHHH
Query EKQaEKLSSRYE----------------------------AEFIWDLhKGVGSIAGIHAA   79
ident       |                                            |       |
Sbjct RGK-SALEDHFDiayeleatmaargksldvldgtrlkpgnIAYVRQQ-EPMGLGHAVWCA  117
DSSP  LLL-HHHHHHLLllhhhhhhhhlllllhhhhlllllllllEEEEELL-LLLLHHHHHHLL


DSSP  HHHH--LLEEEEELLLLL-lLHHHHHHHHHHHHHHLLlEEEEEL----------------
Query LRHF--GSCVVAAIDXPF-vKPEVLEHLYKEGEKAGCdALIPKH----------------  120
ident           |   |      |  |        | |   ||                   
Sbjct RDIVgdEPFAVLLPDDFMfgQPGCLKQMVDAYNKVGG-NLICAEevpddqthrygiitpg  176
DSSP  HHHHllLLEEEELLLEEEeeLLLHHHHHHHHHHHHLL-EEEEEEellhhhhhhlleeeee


DSSP  ------------------------LLLLlLEEEELHHHHHHHHH--hhHLLLLLLHHHHH
Query ------------------------DYPEpLLAYYAESAADELER--aiLQGIRKILVPLE  154
ident                                          ||       |         
Sbjct tqdgvltevkglvekpapgtapsnLSVI-GRYILQPEVMRILENqgkgAGGEIQLTDAMQ  235
DSSP  eeelleeeeeeeelllllllllllEEEE-EEEEELLHHHHHHHLllllLLLLLLLHHHHH


DSSP  LLL----EEEEEHhhhlllllLLHHhLLLLLHHHHHHHHHHHHHL---------------
Query RLN----VVYYPVeklrkfdkELISfFNINTPDDLKRAEEICSKX---------------  195
ident |                                    |                      
Sbjct RMIgdqpFHGVTF--------QGTR-YDCGDKAGFIQANLAVALSrpdlepavrafavka  286
DSSP  HHLllllEEEEEL--------LEEE-EELLLHHHHHHHHHHHHHLllllhhhhhhhhhhh


DSSP  --
Query --  195
ident   
Sbjct lg  288
DSSP  hl


No 29: Query=mol1A Sbjct=2pa4B Z-score=13.4

back to top
DSSP  ---LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---LLEEEEELlLHH
Query ---XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---PFQTVFVCrDEK   49
ident      | |   | | |         |          ||                      
Sbjct navKTVVVPAAGLGTRFLpatktVPKELLPVVDTPGIELIAAEAAelgATRLAIIT-APN   59
DSSP  lllLEEEEELLLLLHHHLlhhhlLLHHHLEELLEEHHHHHHHHHHhllLLEEEEEE-LLL


DSSP  HhHHHHLLLL-----------------------------LLEELLLlLLLLHHHHHHHHH
Query QaEKLSSRYE-----------------------------AEFIWDLhKGVGSIAGIHAAL   80
ident          |                             |       |  |       | 
Sbjct K-AGVLAHFErsseleetlmergktdqveiirraadlikAVPVTQD-KPLGLGHAVGLAE  117
DSSP  L-LHHHHLLLllhhhhhhhhllllhhhhhhllhhhhhleEEEEELL-LLLLHHHHHHLLH


DSSP  HHH----LLEEEEELLLLLLLHHHHHHHHHHHHHHLLlEEEEELL---------------
Query RHF----GSCVVAAIDXPFVKPEVLEHLYKEGEKAGCdALIPKHD---------------  121
ident            |   |       | |         |                        
Sbjct SVLdddeDVVAVMLPDDLVLPTGVMERMAQVRAEFGG-SVLCAVEvseadvskygifeie  176
DSSP  HHLllllLEEEEELLLEEELLLLHHHHHHHHHHHHLL-EEEEEEElllllhhhleeeeee


DSSP  --------------------------llLLLEEEELHHHHHHHHHHhhLLLL----LLHH
Query --------------------------ypEPLLAYYAESAADELERAilQGIR----KILV  151
ident                                         | | |               
Sbjct adtkdsdvkkvkgmvekpaiedapsrlaATGRYLLDRKIFDALRRI--TPGAggelQLTD  234
DSSP  elllllleeeeeeeeelllhhhlllleeEEEEEEEELLHHHHHHHL--LLLHhhllLHHH


DSSP  HHHLL-----LEEEEEHhhhlllllLLHHhLLLLLHHHHHHHHHHHHHL-----------
Query PLERL-----NVVYYPVeklrkfdkELISfFNINTPDDLKRAEEICSKX-----------  195
ident     |      |                       |     |                  
Sbjct AIDLLideghPVHIVIH--------QGKR-HDLGNPGGYIPACVDFGLShpvygaqlkda  285
DSSP  HHHHHhhlllLEEEEEL--------LLLE-EELLLHHHHHHHHHHHHHHllllhhhhhhh


DSSP  --------------
Query --------------  195
ident               
Sbjct ikqilaeheaaeri  299
DSSP  hhhhhhhhhhhhhl


No 30: Query=mol1A Sbjct=1h5sB Z-score=13.4

back to top
DSSP  ---LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHLL---LEEEEELlLHH
Query ---XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYSP---FQTVFVCrDEK   49
ident     |   | || | |         |       |  |   |                   
Sbjct mkmRKGIILAGGSGTRLYpvtmaVSKQLLPIYDKPMIYYPLSTLMLagiRDILIIS-TPQ   59
DSSP  lllEEEEEELLLLLHHHLlhhhhLLHHHLEELLEELLHHHHHHHHHlllLEEEEEE-LLL


DSSP  HHHHHHLLLL--------LLEELLLlLLLLHHHHHHHHHHHH--LLEEEEELLLLL---l
Query QAEKLSSRYE--------AEFIWDLhKGVGSIAGIHAALRHF--GSCVVAAIDXPF---v   96
ident                              |                |     |  |    
Sbjct DTPRFQQLLGdgsqwglnLQYKVQP-SPDGLAQAFIIGEEFIggDDCALVLGDNIFyghd  118
DSSP  LHHHHHHHHLllhhhlleEEEEELL-LLLLLLHHHHHLHHHHllLEEEEEELLLEEelll


DSSP  LHHHHHHHHHHhhhhLLLEEEEELL-------------------------------llll
Query KPEVLEHLYKEgekaGCDALIPKHD-------------------------------ypep  125
ident  |   |            |                                         
Sbjct LPKLMEAAVNK----ESGATVFAYHvndperygvvefdkngtaisleekplepksnyavt  174
DSSP  HHHHHHHHHHL----LLLEEEEEEElllhhhleeeeellllleeeeeelllllllleeel


DSSP  LEEEELHHHHHHHHHhhHLLL----LLLHHHHHLL----LEEEEEHHhhllllLLLHhHL
Query LLAYYAESAADELERaiLQGI----RKILVPLERL----NVVYYPVEklrkfdKELIsFF  177
ident  |  |            |         |                                
Sbjct GLYFYDNDVVQMAKN--LKPSargeLEITDINRIYleqgRLSVALMG------RGYA-WL  225
DSSP  LEEEELLLHHHHHHL--LLLLllllLLHHHHHHHHhhhlLEEEEELL------LLLE-EE


DSSP  LLLLHHHHHHHHHHHHHL------------------------------------------
Query NINTPDDLKRAEEICSKX------------------------------------------  195
ident    |   |  |                                                 
Sbjct DTGTHQSLIEASNFIATIeerqglkvscpeeiafrkgfidveqvrklavpliknnygqyl  285
DSSP  LLLLHHHHHHHHHHHHHHhhhhllllllhhhhhhhlllllhhhhhhhhhhhlllhhhhhh


DSSP  ------
Query ------  195
ident       
Sbjct ykqtkd  291
DSSP  hhhhhl


No 31: Query=mol1A Sbjct=2ggoA Z-score=13.3

back to top
DSSP  LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---LLEEEEELlLHHHHH
Query XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---PFQTVFVCrDEKQAE   52
ident  |   |  | | |         |  |    | |||   |                 |  |
Sbjct MKAFILAAGSGERLEpithtRPKAFVPILSKPLIEYQIEYLRkcgIRDITVIV-SSKNKE   59
DSSP  LEEEEELLLLLHHHLlhhhlLLHHHLEELLEEHHHHHHHHHHhllLLEEEEEE-LHHHHH


DSSP  HHHLLLL-LLEELLLLLLLLHHHHHHHHhhHHLL-EEEEELLLLLLLHHHHHHHHHHHHh
Query KLSSRYE-AEFIWDLHKGVGSIAGIHAAlrHFGS-CVVAAIDXPFVKPEVLEHLYKEGEk  110
ident                    |  | |  |   |         |  |             | 
Sbjct YFEKKLKeISIVTQKDDIKGTGAAILSA--KFNDeALIIYGDLFFSNEKEICNIITLKE-  116
DSSP  HHHHHLLlLEEEELLLLLLLLLLLHHHL--LLLLeEEEEELLEEELLLHHHHHHLLLLL-


DSSP  hlllEEEEEL--------------------------------LLLLlLEEEELHHHHHHH
Query agcdALIPKH--------------------------------DYPEpLLAYYAESAADEL  138
ident       |                                                    |
Sbjct ----NAIIGVkvsnpkdygvlvldnqnnlskiiekpeippsnLINA-GIYKLNSDIFTYL  171
DSSP  ----EEEEEEelllllllleeeellllleeeeelllllllllEEEE-EEEEEELHHHHHH


DSSP  HHhhHLLL----LLLHHHHHLLL----EEEEEHhhhlllllLLHHhLLLLLHHHHHHHHH
Query ERaiLQGI----RKILVPLERLN----VVYYPVeklrkfdkELISfFNINTPDDLKRAEE  190
ident                            |             |      |  |        
Sbjct DK--ISISergeLELTDAINLMAkdhrVKVIEY--------EGYW-MDIGKPWNIIDVNK  220
DSSP  HH--LLLLllllLLHHHHHHHHHhhllEEEEEL--------LLLE-EELLLHHHHHHHHH


DSSP  HHHHL-------------------------------------------------------
Query ICSKX-------------------------------------------------------  195
ident                                                             
Sbjct WALDNlvfsqnlgnvednvkikgkviieedaeiksgtyiegpvyigkgseigpnsylrpy  280
DSSP  HHHHHlllleelleelllleeelleeelllleelllleeelleeelllleelllleelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct tilveknkigasvevkesvimegskiphlsyvgdsviaedvnfgagtlianlrfdekevk  340
DSSP  eeelllleeeelleeeleeelllleeeelleeelleelllleelllleelllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vnvkgkrissgrrklgafigghvrtginvtilpgvkigayariypgavvnrdvgygeffk  400
DSSP  eeelleeeelllllllleelllleelllleelllleelllleelllleelllllllleel


DSSP  -
Query -  195
ident  
Sbjct v  401
DSSP  l


No 32: Query=mol1A Sbjct=2cu2A Z-score=13.2

back to top
DSSP  --LEEEEELLLLLLLLL------LLHHHL-EELLEEHHHHHHHHHLLL----EEEEELlL
Query --XKVAVLVGGVGRRIG------XEKTEV-XLCGKKLIEWVLEKYSPF----QTVFVCrD   47
ident       |  || | |          |       || | |  ||   |      |      
Sbjct mkTYALVMAGGRGERLWplsredRPKPFLpLFEGKTLLEATLERLAPLvppeRTLLAV-R   59
DSSP  llEEEEEELLLLLHHHLllllllLLHHHLlLHHHLLHHHHHHHHHLLLllhhHEEEEE-E


DSSP  HHHHHHHHlLLLL--LEELLLlLLLLHHHHHHHHHHHHL-----LEEEEELLLLL----l
Query EKQAEKLSsRYEA--EFIWDLhKGVGSIAGIHAALRHFG-----SCVVAAIDXPF----v   96
ident   |       |            |                       |   |        
Sbjct RDQEAVAR-PYADgiRLLLEP-LGRDTAGAVLLGVAEALkegaeRLLVLPADHYVgddea  117
DSSP  HHHHHHHH-HHLLllEEEEEL-LLLHHHHHHHHHHHHHHhhlllEEEEEELLLEEllhhh


DSSP  LHHHHHHHHHHHhHHLLlEEEEELL-----------------------------------
Query KPEVLEHLYKEGeKAGCdALIPKHD-----------------------------------  121
ident   | |          |                                            
Sbjct YREALATMLEAA-EEGF-VVALGLRptrpeteygyirlgpregawyrgegfvekpsyaea  175
DSSP  HHHHHHHHHHHL-LLLL-EEEEEELllllllllleeeeeeeelleeeeeeeellllhhhh


DSSP  --------llLLLEEEELHH-HHHHH---HHHH------------------HLLLLLL-H
Query --------ypEPLLAYYAES-AADEL---ERAI------------------LQGIRKI-L  150
ident                  |    |                                  |  
Sbjct leyirkgyvwNGGVFAFAPAtMAELFrrhLPSHhealerllagasleevyaGLPKISIdY  235
DSSP  hhhhhllleeEEEEEEELHHhHHHHHhhhLHHHhhhhhhhhllllhhhhhhLLLLLLHhH


DSSP  HHHHLL-LEEEEEHhhhlllllLLHHhLLLLLHHHHHHHHH-------------------
Query VPLERL-NVVYYPVeklrkfdkELISfFNINTPDDLKRAEE-------------------  190
ident    |    |                          | |                      
Sbjct GVMEKAeRVRVVLG--------RFPW-DDVGNWRALERVFSqdphenvvlgegrhvaldt  286
DSSP  HLHHHLlLEEEEEE--------LLLE-ELLLLLLHHHHHHLlllllleeellleeeeell


DSSP  --------------------------------------------hhhhl
Query --------------------------------------------icskx  195
ident                                                  
Sbjct fgcvvyadrgvvatlgvsglvvakvgdevlvvpkdwarevrevvkrlea  335
DSSP  llleeeellleeeeelllleeeeeelleeeeeehhhhhhhhhhhhhhhl


No 33: Query=mol1A Sbjct=2i5kB Z-score=13.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nsvaasqmrnalnkldaarakfeneldsfftlfrrylvekssrttlewdkikspnpdevv   60
DSSP  llhhhhhhllhhhhllllllllhhhhhhhhhhhhhhhhhllllllllhhheellllllee


DSSP  -----------------LEEEEELLLLLLLLLL--LHHHLEEL-LEEHHHHHHHHHL---
Query -----------------XKVAVLVGGVGRRIGX--EKTEVXLC-GKKLIEWVLEKYS---   37
ident                    |  | || |   |    |       |               
Sbjct kyeiisqqpenvsnlskLAVLKLNGGLGTSMGCvgPKSVIEVReGNTFLDLSVRQIEyln  120
DSSP  lhhhhhllllllhhhhlEEEEEELLLEEHHHLEeeEHHHLEEElLEEHHHHHHHHHHhhh


DSSP  -----LLEEEEELLLhHHHHHHHLLLL--------LLEELLLLL----------------
Query -----PFQTVFVCRDeKQAEKLSSRYE--------AEFIWDLHK----------------   68
ident                                                             
Sbjct rqydsDVPLLLMNSF-NTDKDTEHLIKkysanrirIRSFNQSRFprvykdsllpvpteyd  179
DSSP  hhlllLLLEEEEELL-LLHHHHHHHHHhhllllllLEEEELLLEeleellllllllllll


DSSP  -------LLLHHHHHHHH--hHHHL--------LEEEEELLLLLLLHhhHHHHHHHHHHH
Query -------GVGSIAGIHAA--lRHFG--------SCVVAAIDXPFVKPevLEHLYKEGEKA  111
ident          |                          |   |                   
Sbjct spldawyPPGHGDLFESLhvsGELDaliaqgreILFVSNGDNLGATV--DLKILNHMIET  237
DSSP  llhhheeLLLLLLHHHHHhhlLHHHhhhhllllEEEEELLLLLLLLL--LHHHHHHHHHL


DSSP  LLLEEEEEL------------------------------------------LLLLLlEEE
Query GCDALIPKH------------------------------------------DYPEPlLAY  129
ident |                                                           
Sbjct GAEYIMELTdktradvkggtlisydgqvrllevaqvpkehidefknirkftNFNTN-NLW  296
DSSP  LLLEEEEEEellllllllleeeeelleeeeelhhhlllllhhhhhllllllEEEEE-EEE


DSSP  ELHHHHH-----hhhHHHHLL----------lLLLHHHHHLLL-EEEEEHHhhllllllL
Query YAESAAD-----eleRAILQG----------iRKILVPLERLN-VVYYPVEklrkfdkeL  173
ident     |                                            |          
Sbjct INLKAVKrliessnlEMEIIPnqktinvlqleTACGAAIRHFDgAHGVVVP--------R  348
DSSP  EEHHHHHhhhhllllLLLLEEellllleeeeeLLHHHHHHHLLlLEEEELL--------H


DSSP  HHHLLLLLHHHHHHHHHhHHHL--------------------------------------
Query ISFFNINTPDDLKRAEEiCSKX--------------------------------------  195
ident   |    |  ||                                                
Sbjct SRFLPVKTCSDLLLVKSdLFRLehgslkldpsrfgpnpliklgshfkkvsgfnariphip  408
DSSP  HHLLLLLLHHHHHHLLLlLEEEelleeeellllllllleeeelhhhllhhhhhhhlllll


DSSP  ----------------------------------------------------------
Query ----------------------------------------------------------  195
ident                                                           
Sbjct kiveldhltitgnvflgkdvtlrgtviivcsdghkidipngsilenvvvtgnlqileh  466
DSSP  eeeeeeeeeeelleeelllleeeeeeeeelllllleeelllleeeeeeeeeeeeeeel


No 34: Query=mol1A Sbjct=3gueA Z-score=13.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sgaalaclekmqasgveekcihifliqhalvrkgetgyipeksispveslpflqgietkg   60
DSSP  lhhhhhhhhhhhhllllhhhhhhhhhhhhhhhllllllllhhhleellllllhhhhllll


DSSP  --------LEEEEELLLLLLLLLL--LHHHLEEL-LEEHHHHHHHHHL--------LLEE
Query --------XKVAVLVGGVGRRIGX--EKTEVXLC-GKKLIEWVLEKYS--------PFQT   41
ident           |  | || |   |    |       |                        
Sbjct entallrqAVVLKLNGGLGTGMGLngPKSLLQVKnGQTFLDFTALQLEhfrqvrncNVPF  120
DSSP  llhhhhllEEEEEEELLLLHHHLLllLHHHLEEElLEEHHHHHHHHHHhhhhhhllLLLE


DSSP  EEELLLhHHHHHHHLLLL-----------lLEELLLLL----------------------
Query VFVCRDeKQAEKLSSRYE-----------aEFIWDLHK----------------------   68
ident                                                             
Sbjct MLMNSF-STSGETKNFLRkyptlyevfdsdIELMQNRVpkirqdnffpvtyeadptcewv  179
DSSP  EEEELL-LLHHHHHHHHHhlhhhhllhhhhHEEELLLEeleellllllllllllhhhhee


DSSP  lLLHHHHHHHH-hHHHL---------LEEEEELLLLLLlhhHHHH-HHHHHHHHLLLEEE
Query gVGSIAGIHAA-lRHFG---------SCVVAAIDXPFVkpeVLEH-LYKEGEKAGCDALI  117
ident   |                              |        |   |           | 
Sbjct pPGHGDVYTVLysSGKLdyllgkgyrYMFISNGDNLGA---TLDVrLLDYMHEKQLGFLM  236
DSSP  lLLHHHHHHHHhhHLHHhhhhhllllEEEEEELLLLLL---LLLHhHHHHHHHLLLLEEE


DSSP  EEL--------------------------------------------LLLLlLEEEELH-
Query PKH--------------------------------------------DYPEpLLAYYAE-  132
ident                                                             
Sbjct EVCrrtesdkkgghlaykdtrrrfvlresaqcpkededsfqniakhcFFNT-NNIWINLm  295
DSSP  EEEelllllllleeeeeelllleeeeeehhhllhhhhhhhlllllllEEEE-EEEEEEHh


DSSP  HHHHH------hHHHHHL------------------llLLLHHHHHLL-LEEEEEHHhhl
Query SAADE------lERAILQ------------------giRKILVPLERL-NVVYYPVEklr  167
ident              |                                         |    
Sbjct ELKKMmdeqlgvLRLPVMrnpktvnpqdsqstkvyqleVAMGAAISLFdRSEAVVVP---  352
DSSP  HHHHHhhhllllLLLLLEeeeeellllllllleeeeeeLLHHHHHLLLlLEEEEELL---


DSSP  lllllLHHHLLLLLHHHHHHHHH-HHHHL-------------------------------
Query kfdkeLISFFNINTPDDLKRAEE-ICSKX-------------------------------  195
ident         |    |  ||                                          
Sbjct -----RERFAPVKTCSDLLALRSdAYQVTedqrlvlceerngkppaidldgehykmidgf  407
DSSP  -----HHHLLLLLLHHHHHHHHLlLEEELlllleeelhhhllllleeeelllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct eklvkggvpslrqctsltvrglvefgadvsvrgnvviknlkeepliigsgrvldnevvvv  467
DSSP  hhhhllllllllleeeeeeelleeelllleeeeeeeeeellllleeelllleeelleeee


DSSP  -
Query -  195
ident  
Sbjct e  468
DSSP  l


No 35: Query=mol1A Sbjct=1fxoB Z-score=12.9

back to top
DSSP  --LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---lLEEEEELlLHHH
Query --XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---pFQTVFVCrDEKQ   50
ident    |   | || | |         |       |  |   |                    
Sbjct mkRKGIILAGGSGTRLHpatlaISKQLLPVYDKPMIYYPLSTLMlagiREILIIS-TPQD   59
DSSP  llEEEEEELLLLLHHHLlhhhhLLHHHLEELLEELLHHHHHHHHhlllLEEEEEE-LLLL


DSSP  HHHHHLLLL--------LLEELLLlLLLLHHHHHHHHHHHH--LLEEEEELLLLL---lL
Query AEKLSSRYE--------AEFIWDLhKGVGSIAGIHAALRHF--GSCVVAAIDXPF---vK   97
ident                             |                      |        
Sbjct TPRFQQLLGdgsnwgldLQYAVQP-SPDGLAQAFLIGESFIgnDLSALVLGDNLYyghdF  118
DSSP  HHHHHHHHLllhhhlleEEEEELL-LLLLLLHHHHHLHHHHllLEEEEEELLEEEelllH


DSSP  HHHHHHHHHHhhhhLLLEEEEELL--------------------------------lLLL
Query PEVLEHLYKEgekaGCDALIPKHD--------------------------------yPEP  125
ident  | |             |                                          
Sbjct HELLGSASQR----QTGASVFAYHvldperygvvefdqggkaisleekplepksnyaVTG  174
DSSP  HHHHHHHHLL----LLLEEEEEEElllhhhleeeeellllleeeeeelllllllleeEEE


DSSP  LeEEELHHHHHHHHHHhhLLLL----LLHHHHHLL----LEEEEEHHhhllllLLLHhHL
Query LlAYYAESAADELERAilQGIR----KILVPLERL----NVVYYPVEklrkfdKELIsFF  177
ident |   |     |                |                                
Sbjct L-YFYDQQVVDIARDL--KPSPrgelEITDVNRAYlergQLSVEIMG------RGYA-WL  224
DSSP  E-EEELLLHHHHHHHL--LLLLllllLHHHHHHHHhhllLEEEEELL------LLLE-EE


DSSP  LLLLHHHHHHHHHHHHHL------------------------------------------
Query NINTPDDLKRAEEICSKX------------------------------------------  195
ident    | | |  |                                                 
Sbjct DTGTHDSLLEAGQFIATLenrqglkvacpeeiayrqkwidaaqleklaaplakngygqyl  284
DSSP  ELLLHHHHHHHHHHHHHHhhhhllllllhhhhhhhlllllhhhhhhhhhhhlllhhhhhh


DSSP  ---------
Query ---------  195
ident          
Sbjct krlltetvy  293
DSSP  hhlllllll


No 36: Query=mol1A Sbjct=1lvwA Z-score=12.5

back to top
DSSP  ---LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHL---lLEEEEELlLHH
Query ---XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYS---pFQTVFVCrDEK   49
ident     |  || || | |         |       |  |   |                   
Sbjct gahMKGIVLAGGSGTRLYpitraVSKQLLPIYDKPMIYYPLSVLMlagiRDILIIS-TPR   59
DSSP  lllLEEEEELLLLLLLLLlllllLLHHHLEELLEELLHHHHHHHHhlllLEEEEEE-LLL


DSSP  HHHHHHLLLL--------LLEELLLlLLLLHHHHHHHHHHHH--LLEEEEELLLLL---l
Query QAEKLSSRYE--------AEFIWDLhKGVGSIAGIHAALRHF--GSCVVAAIDXPF---v   96
ident                              |                      |  |    
Sbjct DLPLYRDLLGdgsqfgvrFSYRVQE-EPRGIADAFIVGKDFIgdSKVALVLGDNVFyghr  118
DSSP  LHHHHHHHHLllhhhlleEEEEELL-LLLLHHHHHHHLHHHHllLLEEEEELLLLEelll


DSSP  LHHHHHHHHHHhhhhLLLEEEEE---------LLLL----------------------ll
Query KPEVLEHLYKEgekaGCDALIPK---------HDYP----------------------ep  125
ident   | |             | |                                       
Sbjct FSEILRRAASL----EDGAVIFGyyvrdprpfGVVEfdsegrvisieekpsrpksnyvvp  174
DSSP  HHHHHHHHHLL----LLLEEEEEeelllllllEEEEellllleeeeeelllllllleell


DSSP  LEEEELHHHHHHHHHhhHLLL----LLLHHHHHLL----LEEEEEHHhhllllLLLHhHL
Query LLAYYAESAADELERaiLQGI----RKILVPLERL----NVVYYPVEklrkfdKELIsFF  177
ident  |  |         |            |    |                           
Sbjct GLYFYDNQVVEIARR--IEPSdrgeLEITSVNEEYlrmgKLRVELMG------RGMA-WL  225
DSSP  LEEEELLLHHHHHHH--LLLLllllLLHHHHHHHHhhllLEEEEEEL------LLLE-EL


DSSP  LLLLHHHHHHHHHHHHHL------------------------------------------
Query NINTPDDLKRAEEICSKX------------------------------------------  195
ident    | | |  |                                                 
Sbjct DTGTHDGLLEASSFIETIqkrqgfyiacleeiaynngwitredvlemaeklektdygkyl  285
DSSP  LLLLHHHHHHHHHHHHHHhhhhllllllhhhhhhhlllllhhhhhhhhhhllllhhhhhh


DSSP  ----------
Query ----------  195
ident           
Sbjct rdlaegnfhg  295
DSSP  hhhhhlllll


No 37: Query=mol1A Sbjct=2icyB Z-score=12.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtpv   60
DSSP  lhhhhhhhhlllllllhhhhhhhhhhhhhhhhlllllllhhhlllllllleeehhhllll


DSSP  -------------LEEEEELLLLLLLLLL--LHHHLEEL-LEEHHHHHHHHHL-------
Query -------------XKVAVLVGGVGRRIGX--EKTEVXLC-GKKLIEWVLEKYS-------   37
ident                |  | || |   |    |       |                   
Sbjct sqdvaetknlldkLVVLKLNGGLGTTMGCtgPKSVIEVRdGLTFLDLIVIQIEnlnnkyg  120
DSSP  lllhhhhhhhhllEEEEEELLLLLHHHLLllLHHHLEEElLEEHHHHHHHHHHhhhhhhl


DSSP  -LLEEEEELLLhHHHHHHHLLLL--------LLEELLLLL--------------------
Query -PFQTVFVCRDeKQAEKLSSRYE--------AEFIWDLHK--------------------   68
ident      |                |                                     
Sbjct cKVPLVLMNSF-NTHDDTHKIVEkytnsnvdIHTFNQSKYprvvadefvpwpskgktdke  179
DSSP  lLLLEEEEELL-LLHHHHHHHHHhhllllllEEEEELLLEeleelllleellllllllhh


DSSP  ---LLLHHHHHHHHH-HHHL---------LEEEEELLLLLLLHhhHHHHHHHHHHHLLLE
Query ---GVGSIAGIHAAL-RHFG---------SCVVAAIDXPFVKPevLEHLYKEGEKAGCDA  115
ident      |      |                   ||  |             |         
Sbjct gwyPPGHGDVFPALMnSGKLdtflsqgkeYVFVANSDNLGAIV--DLTILKHLIQNKNEY  237
DSSP  heeLLLHHHHHHHHHhLLHHhhhhhllllEEEEEELLLLLLLL--LHHHHHHHHHHLLLE


DSSP  EEEEL------------------------------------------LLLLlLEEEELHH
Query LIPKH------------------------------------------DYPEpLLAYYAES  133
ident                                                             
Sbjct CMEVTpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkIFNT-NNLWVNLK  296
DSSP  EEEEEellhhhlllleeeeelleeeeelhhhllhhhhhhhlllllllEEEE-EEEEEEHH


DSSP  HH-HHHH--HHHHLLL---------------LLLHHHHHLLL-EEEEEHHhhllllllLH
Query AA-DELE--RAILQGI---------------RKILVPLERLN-VVYYPVEklrkfdkeLI  174
ident |     |        |                                |           
Sbjct AIkKLVEadALKMEIIpnpkevdgvkvlqleTAAGAAIRFFDnAIGVNVP--------RS  348
DSSP  HHhHHHHllLLLLLLLllleeelleeeelllLLLHHHHHHLLlLEEEELL--------HH


DSSP  HHLLLLLHHHHHHHHH-HHHHL--------------------------------------
Query SFFNINTPDDLKRAEE-ICSKX--------------------------------------  195
ident  |       ||                                                 
Sbjct RFLPVKASSDLLLVQSdLYTLVdgfvtrnkartnpsnpsielgpefkkvatflsrfksip  408
DSSP  HLLLLLLHHHHHHHHLlLEEEElleeeelllllllllleeellhhhllhhhhhhllllll


DSSP  -------------------------------------------------------
Query -------------------------------------------------------  195
ident                                                        
Sbjct siveldslkvsgdvwfgssivlkgkvtvaaksgvkleipdravvenkningpedl  463
DSSP  eeeeeeeeeeeleeeelllleeeeeeeeellllleeeelllleeeeeeellhhhl


No 38: Query=mol1A Sbjct=3cgxA Z-score=12.3

back to top
DSSP  ---LEEEEELL-----lLLLLLL--------LLHHHleelleEHHHHHHHHHLL--LEEE
Query ---XKVAVLVG-----gVGRRIG--------XEKTEvxlcgkKLIEWVLEKYSP--FQTV   42
ident          |       |  | |                         |           
Sbjct xseSCILFFVKypepgkVKTRLGevvgndkaAXLYR------HFVQDXLQGLARlhADLH   54
DSSP  lllEEEEEEELllllllLLHHHHhhhlhhhhHHHHH------HHHHHHHHHHLLllLEEE


DSSP  EELLLHH--HHHHHHLLLL--LLEELLLlLLLLhHHHHHHHHHHHL-----LEEEEELLL
Query FVCRDEK--QAEKLSSRYE--AEFIWDLhKGVGsIAGIHAALRHFG-----SCVVAAIDX   93
ident            ||          |                |            |    | 
Sbjct ICYVPGDadLPEKFKAWLGpqHXFAAQQ-GLDL-GERXKHAXQKAFddgydRVVLXGSDI  112
DSSP  EEELLLLllHHHHHHHHHLllLEEEELL-LLLH-HHHHHHHHHHHHhllllEEEEELLLL


DSSP  LLLLHHHHHHHHHHHhHHLLlEEEEEllllLLLEEEELH--HHHHHHHhhhhLLLL----
Query PFVKPEVLEHLYKEGeKAGCdALIPKhdypEPLLAYYAE--SAADELErailQGIR----  147
ident |    |               | |         |          |               
Sbjct PDYPCELVQKALNDL-QHYD-AAIGPafdgGYYLIGFRKdsFCPDVFD----GIRWgead  166
DSSP  LLLLHHHHHHHHHHL-LLLL-EEEEEllllLEEEEEEEHhhLLHHHHL----LLLLllll


DSSP  LLHHHHHLL----LEEEEEHhhhlllllllhhHLLLLLHHHHHHHHHHHHHL--------
Query KILVPLERL----NVVYYPVeklrkfdkelisFFNINTPDDLKRAEEICSKX--------  195
ident       |        |                     |  ||                  
Sbjct VYQPTVEKXrrarLEVLQLP-----------dWNDVDTVWDLNVLYRTNKNSsfrrssty  215
DSSP  LHHHHHHHHhhllLLEEELL-----------lLLLLLLHHHHHHHHHHLLLLhhhhlhhh


DSSP  ----------------
Query ----------------  195
ident                 
Sbjct allrendalirqydid  231
DSSP  hhhhhlhhhhllllll


No 39: Query=mol1A Sbjct=1jykA Z-score=12.3

back to top
DSSP  ---LEEEEELLLLLLLLL-----LLHHHLEELLEEHHHHHHHHHLL---LEEEEELLlhh
Query ---XKVAVLVGGVGRRIG-----XEKTEVXLCGKKLIEWVLEKYSP---FQTVFVCRdek   49
ident     |   |  | | |         |  |    | |||   |                  
Sbjct eirVKAIILAAGLGTRLRpltenTPKALVQVNQKPLIEYQIEFLKEkgiNDIIIIVG--y   58
DSSP  lllLEEEEEELLLLHHHLlllllLLHHHLEELLEEHHHHHHHHHHHlllLLEEEEEL--l


DSSP  HHHHHhLLLL----LLEELL-llllLLHHHHHHHHHHHHLLEEEEELLLLLLLHhHHHHh
Query QAEKLsSRYE----AEFIWD-lhkgVGSIAGIHAALRHFGSCVVAAIDXPFVKPeVLEHl  104
ident   |                                        |   |    |       
Sbjct LKEQF-DYLKekygVRLVFNdkyadYNNFYSLYLVKEELANSYVIDADNYLFKN-XFRN-  115
DSSP  LHHHH-LHHHhhhlLEEEELlllllLLLHHHHHLLHHHLLLEEEEELLEEELLL-LLLL-


DSSP  hHHHHhhlllEEEEEL----------------------------LLLLLLEEEELHHHHH
Query yKEGEkagcdALIPKH----------------------------DYPEPLLAYYAESAAD  136
ident                                                           | 
Sbjct -DLTR-----STYFSVyredctnewflvygddykvqdiivdskaGRILSGVSFWDAPTAE  169
DSSP  -LLLL-----EEEEELeellllllleeeellllleeeeelllllEELLLLEEEELHHHHH


DSSP  HHHHHHHLLL-------LLLHHHHH----LLLEEEEEHhhhlllllLLHHHLLLLLHHHH
Query ELERAILQGI-------RKILVPLE----RLNVVYYPVeklrkfdkELISFFNINTPDDL  185
ident      |                        | |             |  |   |    | 
Sbjct KIVSFIDKAYvsgefvdLYWDNXVKdnikELDVYVEEL--------EGNSIYEIDSVQDY  221
DSSP  HHHHHHHHHHlllllllLLLLHHHHllhhHLLEEEEEL--------LLLLEEELLLHHHH


DSSP  HHHHHHHHhl
Query KRAEEICSkx  195
ident    |||    
Sbjct RKLEEILK--  229
DSSP  HHHHHHHL--


No 40: Query=mol1A Sbjct=2dpwA Z-score=12.3

back to top
DSSP  --LEEEEELLLLLLLLL----LLHHHLEELLEEHHHHHHHHHL--LLEEEEELllhhHHH
Query --XKVAVLVGGVGRRIG----XEKTEVXLCGKKLIEWVLEKYS--PFQTVFVCrdekQAE   52
ident       || ||            |  |   |    |||||         | |        
Sbjct xrPSAIVLAGGKEAWAErfgvGSKALVPYRGRPXVEWVLEALYaaGLSPVYVG----ENP   56
DSSP  llLEEEEELLLLLLHHHllllLLHHHLEELLEELHHHHHHHHHhlLLEEEEEL----LLL


DSSP  HHhlLLLL-LEELllllLLLHHHHHHHHHHHHL-LEEEEELLLLLLLHHHHHHHHHHHhh
Query KLssRYEA-EFIWdlhkGVGSIAGIHAALRHFG-SCVVAAIDXPFVKPEVLEHLYKEGek  110
ident  |                 |       || |      ||  | |    |           
Sbjct GL--VPAPaLTLP---dRGGLLENLEQALEHVEgRVLVATGDIPHLTEEAVRFVLDKA--  109
DSSP  LL--LLLLlEEEL---lLLLHHHHHHHHHHLLLlEEEEEELLLLLLLHHHHHHHHHHL--


DSSP  HLLLEEEEEL-----------------------LLLLlLEEEELH-HHHHHHHHHHHLLL
Query AGCDALIPKH-----------------------DYPEpLLAYYAE-SAADELERAILQGI  146
ident        |                               |           |  |     
Sbjct PEAALVYPIVpkeavearfprtkrtyarlregtFTGG-NLLLLDKsLFRKALPLARRVVA  168
DSSP  LLLLEEEEEEehhhhhhhlllllllleeelleeEEEL-LEEEEEHhHHLLLHHHHHHHHH


DSSP  LL------------------------------lhhhhHLLLEEEEEHHhhllllllLHHH
Query RK------------------------------ilvplERLNVVYYPVEklrkfdkeLISF  176
ident                                                             
Sbjct LRkrplalarlvgwdvllklllgrlslaevearaqriLGVEARALVTP-------yPEVG  221
DSSP  LLllhhhhhhhhlhhhhhhhhhllllhhhhhhhhhhhHLLLEEEEELL-------lHHHL


DSSP  LLLLLHHHHHhhhhhhhhl
Query FNINTPDDLKraeeicskx  195
ident        ||          
Sbjct VDVDREEDLV---------  231
DSSP  LLLLLHHHHL---------


No 41: Query=mol1A Sbjct=2yqcA Z-score=12.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vksqqqiidsfkqanqdqlfqyydsltidqqqefidqlstieepaklistveqaiqfsqs   60
DSSP  lllhhhhhhhhhhlllhhhhllhhhllhhhhhhhhhhhhllllhhhhhhhhhhhhhhlll


DSSP  -------------------------------------LEEEEELLLLLLLLLL--LHHHL
Query -------------------------------------XKVAVLVGGVGRRIGX--EKTEV   21
ident                                        |    || | | |    |   
Sbjct rnftqlpneqtastldlskdilqnwtelglkaigngeVAVLLMAGGQGTRLGSsaPKGCF  120
DSSP  lleelllhhheeelllllhhhhhhhhhhhhhhhhlllEEEEEEEELLLHHHLLllLHHHL


DSSP  EEL---LEEHHHHHHHHHLL----------------LEEEEELLLhHHHHHHHLLLL---
Query XLC---GKKLIEWVLEKYSP----------------FQTVFVCRDeKQAEKLSSRYE---   59
ident        | |     ||                                    |      
Sbjct NIElpsQKSLFQIQAEKILKieqlaqqylkstkkpiINWYIMTSG-PTRNATESFFIenn  179
DSSP  LLLlllLLLHHHHHHHHHHHhhhhhhhhhlllllllLEEEEEELH-HHHHHHHHHHHhlh


DSSP  --------LLEELLLL---------------------lLLLHHHHHHHH----hHHHL--
Query --------AEFIWDLH---------------------kGVGSIAGIHAA----lRHFG--   84
ident           |                             |      |            
Sbjct yfglnshqVIFFNQGTlpcfnlqgnkillelknsicqsPDGNGGLYKALkdngiLDDLns  239
DSSP  hhhllhhhEEEEELLEeelllllllllleeelleeleeELLHHHHHHHHhhllhHHHHhh


DSSP  ----LEEEEELLLLLLLHhhHHHHHHHHHHHLLLEEEEEL--------------------
Query ----SCVVAAIDXPFVKPevLEHLYKEGEKAGCDALIPKH--------------------  120
ident            |   ||                |                          
Sbjct kgikHIHMYCVDNCLVKV-aDPIFIGFAIAKKFDLATKVVrkrdanesvglivldqdnqk  298
DSSP  hlllEEEEEELLLLLLLL-lLHHHHHHHHHHLLLEEEEEEellllllllleeeeelllle


DSSP  ----------------------------LLLLlLEEEELHHHH-HHHHHHHHLL------
Query ----------------------------DYPEpLLAYYAESAA-DELERAILQG------  145
ident                                     ||            |         
Sbjct pcvieyseisqelankkdpqdssklflrAANI-VNHYYSVEFLnKMIPKWISSQkylpfh  357
DSSP  eeeelhhhllhhhhhleelleeeeelllEEEE-EEEEEEHHHHhHHHHHHLLLLllllle


DSSP  ---------------------------lLLLHHHHHLL---LEEEEEHhhhllllLLLHH
Query ---------------------------iRKILVPLERL---NVVYYPVeklrkfdKELIS  175
ident                               |                |         |  
Sbjct iakkkipslnlengefykptepngikleQFIFDVFPSVelnKFGCLEV-------DRLDE  410
DSSP  eeeellleelllllleelllllleeeeeLLHHHHHHHLlhhHEEEEEE-------LHHHH


DSSP  HLLLLLHH-----HHHHHHHHHHHL-----------------------------------
Query FFNINTPD-----DLKRAEEICSKX-----------------------------------  195
ident |      |                                                    
Sbjct FSPLKNADgakndTPTTCRNHYLERsskwviqnggvidnqglvevdsktsyggeglefvn  470
DSSP  LLLLLLLLlllllLHHHHHHHHHHHhhhhhhhllleelllllllllllllllllllhhhl


DSSP  ----------
Query ----------  195
ident           
Sbjct gkhfkngdii  480
DSSP  lleellllll


No 42: Query=mol1A Sbjct=1jv1A Z-score=11.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mnindlkltlskagqehllrfwneleeaqqvelyaelqamnfeelnfffqkaiegfrmep   60
DSSP  llhhhhhhhhhhlllhhhhllhhhllhhhhhhhhhhhhlllhhhhhhhhhhhhhllllll


DSSP  -------------------------------LEEEEELLLLLLLLLL--LHHHLEEL---
Query -------------------------------XKVAVLVGGVGRRIGX--EKTEVXLC---   24
ident                                  |  | || | | |    |         
Sbjct vprevlgsatrdqdqlqaweseglfqisqnkVAVLLLAGGQGTRLGVayPKGMYDVGlps  120
DSSP  llhhheeellllhhhhhhhhhhhhhhhhlllEEEEEELLLLLLLLLLllLHHHLLLLlll


DSSP  LEEHHHHHHHHHLL--------------LEEEEELLLhHHHHHHHLLLL-----------
Query GKKLIEWVLEKYSP--------------FQTVFVCRDeKQAEKLSSRYE-----------   59
ident  | |     |                               |                  
Sbjct RKTLFQIQAERILKlqqvaekyygnkciIPWYIMTSG-RTMESTKEFFTkhkyfglkken  179
DSSP  LLLHHHHHHHHHHHhhhhhhhhhlllllLLEEEEELL-LLHHHHHHHHHhlhhhhllhhh


DSSP  LLEELLL--------------------lllLLHHHH-----hhhhHHHH-----LLEEEE
Query AEFIWDL--------------------hkgVGSIAG-----ihaaLRHF-----GSCVVA   89
ident   |                            |                       |  | 
Sbjct VIFFQQGmlpamsfdgkiileeknkvsmapDGNGGLyralaaqniVEDMeqrgiWSIHVY  239
DSSP  EEEEELLeeeleelllllleeelleeleeeLLHHHHhhhhhhllhHHHHhhlllLEEEEE


DSSP  ELLLLLLLHhhHHHHHHHHHHHLLLEEEEE---------LLLL-----------------
Query AIDXPFVKPevLEHLYKEGEKAGCDALIPK---------HDYP-----------------  123
ident   |   ||              | |                                   
Sbjct CVDNILVKV-aDPRFIGFCIQKGADCGAKVvektnptepVGVVcrvdgvyqvveyseisl  298
DSSP  ELLLLLLLL-lLHHHHHHHHHLLLLEEEEEeelllllllLLEEeeelleeeeelhhhllh


DSSP  -----------------LLLEEEELHHHHHHHH-HHHHLLL-------------------
Query -----------------EPLLAYYAESAADELE-RAILQGI-------------------  146
ident                                       |                     
Sbjct ataqkrssdgrllfnagNIANHFFTVPFLRDVVnVYEPQLQhhvaqkkipyvdtqgqlik  358
DSSP  hhhhllllllllllleeEEEEEEEEHHHHHHHHhLLHHHLLleeeeellleellllleel


DSSP  ----------LLLHHHHHLL-LEEEEEHhhhllllLLLHHHLLLLLHH------HHHHHH
Query ----------RKILVPLERL-NVVYYPVeklrkfdKELISFFNINTPD------DLKRAE  189
ident                        | | |            |      |          | 
Sbjct pdkpngikmeKFVFDIFQFAkKFVVYEV-------LREDEFSPLKNADsqngkdNPTTAR  411
DSSP  llllleeeeeLLHHHHHHHLlLEEEEEE-------LHHHHLLLLLLLLllllllLHHHHH


DSSP  HHHHHL------------------------------------------------------
Query EICSKX------------------------------------------------------  195
ident                                                             
Sbjct HALMSLhhcwvlnagghfidengsrlpaiprlkdandvpiqceisplisyageglesyva  471
DSSP  HHHHHHhhhhhhhllleellllllllllllllllllllllleeelllllllllllhhhhl


DSSP  -------------------
Query -------------------  195
ident                    
Sbjct dkefhapliidengvhelv  490
DSSP  lleellleeeelleeeell


No 43: Query=mol1A Sbjct=3brkX Z-score=11.9

back to top
DSSP  ------LEEEEELLLLLLLLL-----LLHHHLEELL-EEHHHHHHHHHL---LLEEEEEL
Query ------XKVAVLVGGVGRRIG-----XEKTEVXLCG-KKLIEWVLEKYS---PFQTVFVC   45
ident           || || | |         |  |   |    |   |               
Sbjct qplardAXAYVLAGGRGSRLKeltdrRAKPAVYFGGkARIIDFALSNALnsgIRRIGVAT   60
DSSP  llhhhhEEEEEEELLLLHHHHhhhllLLHHHLEELLlEELHHHHHHHHHhllLLEEEEEE


DSSP  L--lhhHHHHHHLLLL---------LLEELLllLLLLHHHHHHHHHHHH-----LLEEEE
Query R--dekQAEKLSSRYE---------AEFIWDlhKGVGSIAGIHAALRHF-----GSCVVA   89
ident           |                         |                    |  
Sbjct QykahsLIRHLQRGWDffrpernesFDILPA-sWYEGTADAVYQNIDIIepyapEYXVIL  119
DSSP  LlllhhHHHHHHHHLLlllhhhlleEEEELL-lLLLLHHHHHHLLHHHHhhhllLEEEEE


DSSP  ELLLLLLLhhHHHHHHHHHHHHLLLEEEEELLL---------------------------
Query AIDXPFVKpeVLEHLYKEGEKAGCDALIPKHDY---------------------------  122
ident | |         |         | |  |                                
Sbjct AGDHIYKX--DYEYXLQQHVDSGADVTIGCLEVprxeatgfgvxhvnekdeiidfiekpa  177
DSSP  ELLLEELL--LLHHHHHHHHHLLLLEEEEEEEEellhhhhleeeeellllleeeeeelll


DSSP  -------------lLLLEEEELH-HHHHHHHHHHHlllLLLHhHHHL-LLEEEEEHHHHL
Query -------------pEPLLAYYAE-SAADELERAILqgiRKILvPLER-LNVVYYPVEKLR  167
ident                                |        |          |        
Sbjct dppgipgnegfalaSXGIYVFHTkFLXEAVRRDAA---DIIP-YIVEhGKAVAHRFADSC  233
DSSP  lllllllllleeeeEEEEEEEEHhHHHHHHLLLLL---LLLL-HHHHhLLEEEEEHHHHL


DSSP  ---lllLLLHhHLLLLLHHHHHHHHHHHHH------------------------------
Query ---kfdKELIsFFNINTPDDLKRAEEICSK------------------------------  194
ident        |        | |    |                                    
Sbjct vrsdfeHEPY-WRDVGTIDAYWQANIDLTDvvpdldiydkswpiwtyaeitppakfvhdd  292
DSSP  llllllLLLL-EELLLLHHHHHHHHHHLLLlllllllllllllllllllllllleeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct edrrgsavssvvsgdciisgaalnrsllftgvransysrlenavvlpsvkigrhaqlsnv  352
DSSP  llllleeelleelllleeelleeelleelllleelllleeeeeeelllleelllleeeee


DSSP  ------------------------------------------l
Query ------------------------------------------x  195
ident                                            
Sbjct vidhgvvipeglivgedpeldakrfrrtesgiclitqsxidkl  395
DSSP  eelllleelllleelllhhhhhhhleellllleeelhhhhhll


No 44: Query=mol1A Sbjct=1yp3C Z-score=11.8

back to top
DSSP  -----------LEEEEELLLLLLL-LLLL----HHHLEELL-EEHHHHHHHHHL---LLE
Query -----------XKVAVLVGGVGRR-IGXE----KTEVXLCG-KKLIEWVLEKYS---PFQ   40
ident                 | || | |         |  | |     ||              
Sbjct qtcldpdasrsVLGIILGGGAGTRlYPLTkkraKPAVPLGAnYRLIDIPVSNCLnsnISK   60
DSSP  lllllllhhhhEEEEEELLLLLLLlLLLLllllHHHLEELLlEELLHHHHHHHHhllLLE


DSSP  EEEELLLHHhhHHHHLLLL--------LLEELL------llllLLHHHHHHHHHHHHL--
Query TVFVCRDEKqaEKLSSRYE--------AEFIWD------lhkgVGSIAGIHAALRHFG--   84
ident              |              |               |        |  |   
Sbjct IYVLTQFNS--ASLNRHLSrayasegfVEVLAAqqspenpdwfQGTADAVRQYLWLFEeh  118
DSSP  EEEEELLLL--HHHHHHHHhhhlllleEEEEELllllllllllLLHHHHHHHHHHHHLll


DSSP  ---LEEEEELLLLLLLHhhHHHHHHHHHHHLLLEEEEELL--------------------
Query ---SCVVAAIDXPFVKPevLEHLYKEGEKAGCDALIPKHD--------------------  121
ident         | |         |           |                           
Sbjct tvlEYLILAGDHLYRMD--YEKFIQAHRETDADITVAALPmdekratafglmkideegri  176
DSSP  lllEEEEEELLEELLLL--HHHHHHHHHHLLLLEEEEEEEelhhhhllleeeeellllle


DSSP  -----------------------------------LLLLlEEEELHHHH-HHHH-HHHHl
Query -----------------------------------YPEPlLAYYAESAA-DELE-RAILq  144
ident                                                     |       
Sbjct iefaekpqgeqlqamkvdttilglddkrakempfiASMG-IYVISKDVMlNLLRdKFPG-  234
DSSP  eeeeelllhhhhhlllllhhhhlllhhhhhhlleeEEEE-EEEEEHHHHhHHHHlLLLL-


DSSP  lLLLL-HHHHHLL-----LEEEEEHhhhlllllLLHHhLLLLLHHHHHHHHHHHHH----
Query gIRKI-LVPLERL-----NVVYYPVeklrkfdkELISfFNINTPDDLKRAEEICSK----  194
ident                    |  |                 | |      |     |    
Sbjct -ANDFgSEVIPGAtslgmRVQAYLY--------DGYW-EDIGTIEAFYNANLGITKkpvp  284
DSSP  -LLLLlLLHHHHHhllllLEEEEEL--------LLLL-EELLLHHHHHHHHHHHHLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai  344
DSSP  lllllllllllllllllllleeeeeeeeeeeeelllleeeeeeeelleelllleelllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv  404
DSSP  eelleellllllllhhhhhhhhhlllllllllllleeeleeelllleelllleellllll


DSSP  ------------------------------l
Query ------------------------------x  195
ident                                
Sbjct qeaaretdgyfiksgivtvikdalipsgiii  435
DSSP  leeeehhhleeeelleeeelllleellllll


No 45: Query=mol1A Sbjct=1qwjB Z-score=11.5

back to top
DSSP  ---LEEEEELLlLLLLlLLLHHHLEELLEEHHHHHHHHHLL----LEEEEELlLHHH-HH
Query ---XKVAVLVGgVGRRiGXEKTEVXLCGKKLIEWVLEKYSP----FQTVFVCrDEKQ-AE   52
ident        ||           |    | |  || |||                 |      
Sbjct pphLAALVLARgGSKG-IPLKNIKRLAGVPLIGWVLRAALDagvfQSVWVST-DHDEiEN   58
DSSP  lllEEEEEELLlLLLL-LLLHHHLEELLEELHHHHHHHHHHhlllLEEEEEE-LLHHhHH


DSSP  HHHlLLLLLEELLLLLL----LLHHHHHHHHHHH---HLLEEEEELLLLLLLHHHHHHHH
Query KLSsRYEAEFIWDLHKG----VGSIAGIHAALRH---FGSCVVAAIDXPFVKPEVLEHLY  105
ident        |               |   |   |                |   |  |    
Sbjct VAK-QFGAQVHRRSSETskdsSTSLDAIVEFLNYhneVDIVGNIQATSPCLHPTDLQKVA  117
DSSP  HHH-HLLLEEEELLLLLllllLLHHHHHHHHHLLlllLLEEEEELLLLLLLLHHHHHHHH


DSSP  HHHHHHLLLEEEEEL-------------------------------------LLLLllEE
Query KEGEKAGCDALIPKH-------------------------------------DYPEplLA  128
ident       | |                                            |      
Sbjct EMIREEGYDSVFSVVrrhqfrwseiqkgvrevteplnlnpakrprrqdwdgeLYENgsFY  177
DSSP  HHHHHLLLLEEEEEEeellllllllllllllllllllllllllllhhhllleEEEEeeEE


DSSP  EELHHHHHHHhhhhhllllllhhhhhlLLEEEEEHhhhlllllLLHHHLLLLLHHHHHHH
Query YYAESAADELerailqgirkilvplerLNVVYYPVeklrkfdkELISFFNINTPDDLKRA  188
ident                                ||                 |    |   |
Sbjct FAKRHLIEMG-------------ylqgGKMAYYEM--------RAEHSVDIDVDIDWPIA  216
DSSP  EEEHHHHLLL-------------llllLLEEEEEL--------LHHHHLLHHHHLLHHHH


DSSP  HHHHHHL------
Query EEICSKX------  195
ident |            
Sbjct EQRVLRFgyfgke  229
DSSP  HHHHHHHllllll


No 46: Query=mol1A Sbjct=2oefA Z-score=11.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct slsaaaqacvkkxrdakvneacirtfiaqhvxvskgetgsipdsaixpvdsldaldslti   60
DSSP  llllhhhhhhhhhhhllllhhhhhhhhhhhhhhhllllllllhhhlllllllllllllll


DSSP  ---------LEEEEELLLLLLLLLL--LHHHLEEL-LEEHHHHHHHHHLL--------LE
Query ---------XKVAVLVGGVGRRIGX--EKTEVXLC-GKKLIEWVLEKYSP--------FQ   40
ident            |  | || |   |    ||      ||                      
Sbjct ecdnavlqsTVVLKLNGGLGTGXGLcdAKTLLEVKdGKTFLDFTALQVQYlrqhcsehLR  120
DSSP  lllhhhhhlEEEEEELLLLLHHHLLllLHHHLEEElLEEHHHHHHHHHHHhhhhllllLE


DSSP  EEEELlLHHHHHHHHLLLL------------lLEELLLLL--------------------
Query TVFVCrDEKQAEKLSSRYE------------aEFIWDLHK--------------------   68
ident                |                                            
Sbjct FXLXD-SFNTSASTKSFLKarypwlyqvfdseVELXQNQVpkilqdtlepaawaenpaye  179
DSSP  EEEEE-LLLLHHHHHHHHHhhlhhhhllhhhhLEEELLLEeleellllllllllllhhhh


DSSP  --LLLHHHHHHHH-hHHHL---------LEEEEELLLLLLLHHhhHHHHHHHHHHLLLEE
Query --GVGSIAGIHAA-lRHFG---------SCVVAAIDXPFVKPEvlEHLYKEGEKAGCDAL  116
ident     |      |                   |   |                ||   | |
Sbjct waPPGHGDIYTALygSGKLqelveqgyrYXFVSNGDNLGATID--KRVLAYXEKEKIDFL  237
DSSP  eeLLLLLHHHHHHhhLLHHhhhhhllllEEEEEELLLLLLLLL--HHHHHHHHHHLLLEE


DSSP  EEELL-------------------------------------------------------
Query IPKHD-------------------------------------------------------  121
ident                                                             
Sbjct XEVCRrtesdkkgghlarqtvyvkgkdgqpdaekrvlllresaqcpkadxesfqdinkys  297
DSSP  EEEEEllhhhlllleeeeeeeeelllllllleeeeeeeeelllllllllhhhhhllllll


DSSP  -LLLLlEEEELH-HHHHH------hHHHHHLL------------------lLLLHHHHHL
Query -YPEPlLAYYAE-SAADE------lERAILQG------------------iRKILVPLER  155
ident                                                             
Sbjct fFNTN-NLWIRLpVLLETxqehggtLPLPVIRnektvdssnsaspkvyqleTAXGAAIAX  356
DSSP  eEEEE-EEEEEHhHHHHHhhhllllLLLLLEEeeeellllllllleeeeeeLLHHHHHHH


DSSP  L-LEEEEEHHhhllllllLHHHLLLLLHHHHHHHHH-HHHHL------------------
Query L-NVVYYPVEklrkfdkeLISFFNINTPDDLKRAEE-ICSKX------------------  195
ident         |            |    |  ||                             
Sbjct FeSASAIVVP--------RSRFAPVKTCADLLALRSdAYVVTddfrlvlddrchghppvv  408
DSSP  LlLEEEEELL--------HHHLLLLLLHHHHHHHHLlLEEELlllleeelhhhlllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct dldsahykxxngfeklvqhgvpslveckrvtvkglvqfgagnvltgtvtientdsasafv  468
DSSP  eelllllllhhhhhhhlllllllllleeeeeeelleellllleeeeeeeeelllllllee


DSSP  --------------
Query --------------  195
ident               
Sbjct ipdgaklndttasp  482
DSSP  llllleeelleell


No 47: Query=mol1A Sbjct=2bo4A Z-score=11.1

back to top
DSSP  LEEEEELLllllllllLHHHleelleEHHHHHHHHHLL----LEEEEELLLHH-HHHHHH
Query XKVAVLVGgvgrrigxEKTEvxlcgkKLIEWVLEKYSP----FQTVFVCRDEK-QAEKLS   55
ident   |                                                     |   
Sbjct SLVVFPFK--------HEHP------EVLLHNVRVAAAhprvHEVLCIGYERDqTYEAVE   46
DSSP  LEEEEELL--------LLLH------HHHHHHHHHHHHllllLEEEEEELLLLhHHHHHH


DSSP  LLLL---------LLEELLLLL---lLLHHHHHHHHHHHHL------LEEEEELLLLLLL
Query SRYE---------AEFIWDLHK---gVGSIAGIHAALRHFG------SCVVAAIDXPFVK   97
ident                            |   |   ||| |              |     
Sbjct RAAPeisratgtpVSVRLQERLgtlrPGKGDGMNTALRYFLeetqweRIHFYDADITSFG  106
DSSP  HHHHhhhhhhlllEEEEELLLLllllLLHHHHHHHHHHHHHhhllllEEEELLLLLLLLL


DSSP  HHHHHHHHHHHhHHLLLEEEEEL-----------------------------LLLL-LLE
Query PEVLEHLYKEGeKAGCDALIPKH-----------------------------DYPE-PLL  127
ident |             |                                             
Sbjct PDWITKAEEAA-DFGYGLVRHYFprastdamitwmitrtgfallwphtelswIEQPlGGE  165
DSSP  HHHHHHHHHHH-HLLLLEEEEELlllllllhhhhhlhhhhhhhhlllllhhhLLLLlLLL


DSSP  EEELHHHHHHHH---HHHH-lllLLLHHHHHLL-----LEEEEEHhhhlllllLLHHhlL
Query AYYAESAADELE---RAIL-qgiRKILVPLERL-----NVVYYPVeklrkfdkELISffN  178
ident        |  |    |                                            
Sbjct LLMRREVAAMLYedeRVRRrsdwGIDTLYTFVTvqqgvSIYECYI--------PEGK--A  215
DSSP  EEEEHHHHHHHHhlhHHHLllllLHHHHHHHHHhhlllLEEEEEL--------LLLL--L


DSSP  LLLHH-------------------------------------------------------
Query INTPD-------------------------------------------------------  183
ident                                                             
Sbjct HRLYGglddlrtmlvecfaaiqslqhevvgqpaihrqehphrvpvhiaervgydveatlh  275
DSSP  LLLLLlhhhhhhhhhhhhhhhhhhlllllllllleeelllllllhhhhllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  183
ident                                                             
Sbjct rlmqhwtprqvellelfttpvreglrtcqrrpafnfmdemawaatyhvllehfqpgdpdw  335
DSSP  hhlllllhhhhhhhhhllhhhhhhhhhlllllllllllhhhhhhhhhhhhhhlllllhhh


DSSP  ---------------------------------hhhhhhhhhhhl
Query ---------------------------------dlkraeeicskx  195
ident                                              
Sbjct eellfklwttrvlnytmtvalrgydyaqqylyrmlgryryqaale  380
DSSP  hhhhhhhhhhhhhhhhhhlhhhlhhhhhhhhhhhhhhhhhhhhhl


No 48: Query=mol1A Sbjct=1vm8A Z-score=10.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nvndlkqrlsqagqehllqfwnelseaqqxelyxelqaxnfeelnsffrkaigefdrssh   60
DSSP  lhhhhhhhhhllllhhhhllhhhllhhhhhhhhhhhhlllllhhhhhhhhhhhhhlllll


DSSP  -----------------------------------------LEEEEELLLLLLLLLL--L
Query -----------------------------------------XKVAVLVGGVGRRIGX--E   17
ident                                            |  | || | | |    
Sbjct qekvdarxepvprqvlgsatrdqeqlqaweseglsqisqnkVAVLLLAGGQGTRLGVsyP  120
DSSP  lllhhhleelllhhheeellllllhhhhhhhhhhhhhhlllEEEEEELLLLLLLLLLllL


DSSP  HHHLEEL--LEEH-hhHHHHHHLLL--------------EEEEELLLhHHHHHHHLLLL-
Query KTEVXLC--GKKL-ieWVLEKYSPF--------------QTVFVCRDeKQAEKLSSRYE-   59
ident |          |       |                               |        
Sbjct KGXYDVGlpSHKTlfqIQAERILKLqqlaekhhgnkctiPWYIXTSG-RTXESTKEFFTk  179
DSSP  HHHLLLLllLLLLhhhHHHHHHHHHhhhhhhhhllllllLEEEEELL-LLHHHHHHHHHh


DSSP  ----------LLEELLLL--------------------lLLLHHHH-----hhhhHHHH-
Query ----------AEFIWDLH--------------------kGVGSIAG-----ihaaLRHF-   83
ident             |                            |                  
Sbjct hkffglkkenVVFFQQGXlpaxsfdgkiileeknkvsxaPDGNGGLyralaaqniVEDXe  239
DSSP  lhhhhllhhhEEEEELLEeeleelllllleeelleeleeELLLLHHhhhhhhllhHHHHh


DSSP  ----LLEEEEELLLLLLLHhhHHHHHHHHHHHLLLEEEEE---------LLLL-------
Query ----GSCVVAAIDXPFVKPevLEHLYKEGEKAGCDALIPK---------HDYP-------  123
ident      |  |   |   ||              | |                         
Sbjct qrgiCSIHVYCVDNILVKV-aDPRFIGFCIQKGADCGAKVvektnptepVGVVcrvdgvy  298
DSSP  hhllLEEEEEELLLLLLLL-lLHHHHHHHHHLLLLEEEEEeelllllllLLEEeeellee


DSSP  ---------------------------LLLEEEELHHHHHHHH-HHHHLL----------
Query ---------------------------EPLLAYYAESAADELE-RAILQG----------  145
ident                                                 |           
Sbjct qvveyseislataqrrssdgrllfnagNIANHFFTVPFLKDVVnVYEPQLqhhvaqkkip  358
DSSP  eeellllllhhhhhllllllllllleeEEEEEEEEHHHHHHHHhLHHHHLlleeeeelll


DSSP  -------------------lLLLHHHHHLL-LEEEEEHhhhlllLLLLhHHLLLLLHH--
Query -------------------iRKILVPLERL-NVVYYPVeklrkfDKELiSFFNINTPD--  183
ident                                  | | |        |   |      |  
Sbjct yvdsqgyfikpdkpngikxeKFVFDIFQFAkKFVVYEV------LRED-EFSPLKNADsq  411
DSSP  eellllleelllllleeeeeLLHHHHHHHLlLEEEEEE------LHHH-HLLLLLLLLll


DSSP  ---HHHHHhhhHHHL---------------------------------------------
Query ---DLKRAeeiCSKX---------------------------------------------  195
ident        |                                                    
Sbjct gkdNPTTA---RHALxslhhcwvlnagghfidengsrlpaipvpiqceisplisyagegl  468
DSSP  lllLHHHH---HHHHhhhhhhhhhhlleeelllllllllllllllleeelllllllllll


DSSP  -----------------------
Query -----------------------  195
ident                        
Sbjct egyvadkefhapliidengvhel  491
DSSP  hhhhlleeellleeeelleeeel


No 49: Query=mol1A Sbjct=2i5eA Z-score=10.5

back to top
DSSP  --LEEEEELL--lLLLLLL---------LLHHhleelleEHHHHHHHHHL---LLEEEEE
Query --XKVAVLVG--gVGRRIG---------XEKTevxlcgkKLIEWVLEKYS---PFQTVFV   44
ident   |             |                           |          |    
Sbjct naXRAVIPYKkagAKSRLSpvlslqereEFVE-------LXLNQVISSLKgagIEQVDIL   53
DSSP  llLEEEEELLlllLLHHHLllllhhhhhHHHH-------HHHHHHHHHHHhllLLEEEEE


DSSP  LlLHHHhhHHHLLLLLLEELLllLLLLhHHHHHHHHHHH-LLEEEEELLLLLLLHHHHHH
Query CrDEKQaeKLSSRYEAEFIWDlhKGVGsIAGIHAALRHF-GSCVVAAIDXPFVKPEVLEH  103
ident          |    ||    |              |            | |   ||    
Sbjct S-PSVY--GLEEXTEARVLLD--EKDL-NEALNRYLKEAeEPVLIVXADLPLLSPEHIKE  107
DSSP  E-LLLL--LLLLLLLLEEEEL--LLLH-HHHHHHHHHHLlLLEEEELLLLLLLLHHHHHH


DSSP  HHHHhhhhLLLEEEEellLLLLLEEEEL--HHHHhhhhhhhhllLLLL-HHHHHLL----
Query LYKEgekaGCDALIPkhdYPEPLLAYYA--ESAAdelerailqgIRKI-LVPLERL----  156
ident           |  |                                   |          
Sbjct ISST----EKDVCIVpgkGGGTNALFIKnpSKYR-------vkyYGSSfLTHCSIAtdsg  156
DSSP  HLLL----LLLEEEEelhHHLEEEEEELlhHHLL-------lllLLLHhHHHHHHHhlll


DSSP  -LEEEEEHhhhllllllLHHHLLLLLHHHHHHHHHHH-----------------------
Query -NVVYYPVeklrkfdkeLISFFNINTPDDLKRAEEIC-----------------------  192
ident      |                 |  | ||                              
Sbjct qDFEIYDS---------FXAGTDIDEPEDLVELLIHGkgaakdyieskfrlevkkgrvgl  207
DSSP  lLEEELLL---------LLLLLLLLLHHHHHHHHHHLllhhhhhhhlleeeeelllleee


DSSP  hhl
Query skx  195
ident    
Sbjct vpl  210
DSSP  eel


No 50: Query=mol1A Sbjct=2qh5B Z-score=9.9

back to top
DSSP  --LEEEEELllllllllLLHHHLE-ELLEEHHHHHHHHHLLL--EEEEELlLHHHHHHHH
Query --XKVAVLVggvgrrigXEKTEVX-LCGKKLIEWVLEKYSPF--QTVFVCrDEKQAEKLS   55
ident    |   |           |        | | |            |  ||  ||      
Sbjct lkIKNILLS----srslYPKQFLKlFDHKSLFELSFKRNASLvdETLIVC-NEKHYFLAL   55
DSSP  llEEEEEEL----llllLLHHHLLlLLLLLHHHHHHHHHHLLllEEEEEE-EHHHHHHHH


DSSP  LLLL-------LLEELLllLLLLHHHHHHHHHHHH---LLEEEEELLLLL----lLHHHH
Query SRYE-------AEFIWDlhKGVGSIAGIHAALRHF---GSCVVAAIDXPF----vKPEVL  101
ident              |             |              |   |             
Sbjct EEIKneiknksVGFLLE-sLSKNTANAIALSALMSdkeDLLIVTPSDHLIkdlqaYENAI  114
DSSP  HHLLlllllleEEEEEE-lLLLLHHHHHHHHHHLLlllLEEEEEELLLLLllhhhHHHHH


DSSP  HHHHHHHhHHLLlEEEEELL----------------------------------------
Query EHLYKEGeKAGCdALIPKHD----------------------------------------  121
ident           |                                                 
Sbjct KKAIDLA-QKGF-LVTFGVSidkpntefgyiespngldvkrfiekpsldkaiefqksggf  172
DSSP  HHHHHHH-LLLL-EEEEEELllllllllleeelllllllleeellllhhhhhhhhhhlle


DSSP  llllLEEEELH-HHHHHH----hHHHHL-----------------------------LLL
Query ypepLLAYYAE-SAADEL----eRAILQ-----------------------------GIR  147
ident                |||                                          
Sbjct yfnsGMFVFQAgVFLDELkkhapTILKGcerafeslenayffekkiarlseksmqdlEDM  232
DSSP  eeeeEEEEEEHhHHHHHHhhhlhHHHHHhhhhhhlleeeelllleeeeelhhhhlllLLL


DSSP  LL-HHHHHLL-LEEEEEHhhhllllllLHHHLLlllhhhhhhhhhhhhhl
Query KI-LVPLERL-NVVYYPVeklrkfdkeLISFFNintpddlkraeeicskx  195
ident  |                                                
Sbjct SIdIALMQQShKIKMVEL---------NAKWSD-----------------  256
DSSP  LHhHHLLLLLlLEEEEEL---------LLLLLL-----------------


No 51: Query=mol1A Sbjct=3ckqA Z-score=9.5

back to top
DSSP  -----------------------------------LEEEEELLllllllllLHHHleell
Query -----------------------------------XKVAVLVGgvgrrigxEKTEvxlcg   25
ident                                      |                      
Sbjct glrdtrpgdtwladrswnrpgwtvaeleaakagrtISVVLPAL--------DEED-----   47
DSSP  llllllllleeellleeelllllhhhhhhllllllEEEEEEEL--------LLLL-----


DSSP  eeHHHHHHHHHLLL------EEEEELLL--hhHHHHHHlLLLLLEELLL------LLLLL
Query kkLIEWVLEKYSPF------QTVFVCRD--ekQAEKLSsRYEAEFIWDL------HKGVG   71
ident    |  |    ||                             |                |
Sbjct --TIGSVIDSISPLvdglvdELIVLDSGstddTEIRAV-AAGARVVSREqalpevPIRPG  104
DSSP  --LHHHHHHHHHHHllllllEEEEEELLllllHHHHHH-LLLLEEEEHHhhllllLLLLL


DSSP  HHHHHHHHHHHH--LLEEEEELLLLLLLHHHHHHHHHHHHH-hLLLEEEEE---------
Query SIAGIHAALRHF--GSCVVAAIDXPFVKPEVLEHLYKEGEK-aGCDALIPK---------  119
ident         |        |    |     |     |        |                
Sbjct KGEALWRSLAASrgDIVVFVDSDLINPHPMFVPWLVGPLLTgdGVHLVKSFyrrplggrv  164
DSSP  HHHHHHHHHHHLllLEEEELLLLLLLLLLLHHHHHHHHHHLllLLLEEEEEeelllllhh


DSSP  ------------------LLLLLLLEEEELH-HHHHHhHHHHhllLLLL-HHHHHLL---
Query ------------------HDYPEPLLAYYAE-SAADElERAIlqgIRKI-LVPLERL---  156
ident                      |                  |            |      
Sbjct telvarpllaalrpelgcILQPLGGEYAATReLLTSV-PFAP---GYGVeIGLLVDTfdr  220
DSSP  hhhlhhhhhhhhlhhhhhLLLLLLLLEEEEHhHHLLL-LLLL---HHHHhHHHHHHHhhh


DSSP  ----LEEEEEHhhhllllllLHHHlLLLLHH-----------------------------
Query ----NVVYYPVeklrkfdkeLISFfNINTPD-----------------------------  183
ident                            | |                              
Sbjct lgldAIAQVNL---------GVRE-HRNRPLaelgamsrqviatllsrcgipdsgvgltq  270
DSSP  hlhhHEEEEEE---------EELL-LLLLLHhhhhhhhhhhhhhhhhhllllllllllee


DSSP  --------------------hhhhhhhhhhhl
Query --------------------dlkraeeicskx  195
ident                                 
Sbjct fvadgpegqsytqhtwpvsladrppmqairpr  302
DSSP  eeellllllleeeeellllllllllhhhhlll


No 52: Query=mol1A Sbjct=3e26A Z-score=9.5

back to top
DSSP  ----------------------LEEEEELLllllllllLHHHleelleeHHHHHHHHHLL
Query ----------------------XKVAVLVGgvgrrigxEKTEvxlcgkkLIEWVLEKYSP   38
ident                         |                         || |    ||
Sbjct dttwhrpgwtigeleaakagrtISVVLPAL--------NEEA-------TIESVIDSISP   45
DSSP  lleellllllhhhhhhhlllllEEEEEEEL--------LLLL-------LHHHHHHLLHH


DSSP  L------EEEEELLLHH-hhHHHHlLLLLLEELLL------LLLLLHHHHHHHHHHHH--
Query F------QTVFVCRDEK-qaEKLSsRYEAEFIWDL------HKGVGSIAGIHAALRHF--   83
ident                     |       |                |        |     
Sbjct LvdglvdELIVLDSGSTddtEIRAiASGARVVSREqalpevPVRPGKGEALWRSLAATsg  105
DSSP  HllllllEEEEEELLLLllhHHHHhHLLLEEEEHHhhllllLLLLLHHHHHHHHLLLLll


DSSP  LLEEEEELLLLLLLHHHHHHHHHHHHHH-LLLEEEEE----------------------L
Query GSCVVAAIDXPFVKPEVLEHLYKEGEKA-GCDALIPK----------------------H  120
ident    |    |     |     |        |                              
Sbjct DIVVFIDSDLINPHPLFVPWLVGPLLTGeGIQLVKSFyrrvtelvarpllaalrpelgcV  165
DSSP  LEEEELLLLLLLLLLLHHHHHHHHHHHLlLLLEEEEElllhhhhlhhhhhhhhlhhhhhL


DSSP  LLLLLLEEEELH-HHHHHhHHHHhllLLLL-HHHHHLL-------LEEEEEHHhhlllll
Query DYPEPLLAYYAE-SAADElERAIlqgIRKI-LVPLERL-------NVVYYPVEklrkfdk  171
ident   |                  |            |                         
Sbjct LQPLSGEYAASReLLTSL-PFAP---GYGVeIGLLIDTfdrlgldAIAQVNLG-------  214
DSSP  LLLLLLLEEEEHhHHLLL-LLLL---HHHHhHHHHHHHhhhhlhhHEEEEELL-------


DSSP  llhhhLLLLLHH----------------------------------------hhhhhhhh
Query elisfFNINTPD----------------------------------------dlkraeei  191
ident                                                             
Sbjct ----vRAHRNRPldelgamsrqviatllsrcgipdsgvgltqfytrhtwpvslvdrppmk  270
DSSP  ----lLLLLLLLhhhhhhhhhhhhhhhhhhlllllllllleelllleellllllllllhh


DSSP  hhhl
Query cskx  195
ident     
Sbjct vmrp  274
DSSP  hhll


No 53: Query=mol1A Sbjct=1ss9A Z-score=9.3

back to top
DSSP  LEEEEELLllllllllLHHHleelleeHHHHHHHHHL------LLEEEEELLlhhHHHH-
Query XKVAVLVGgvgrrigxEKTEvxlcgkkLIEWVLEKYS------PFQTVFVCRdekQAEK-   53
ident                                                             
Sbjct MDIVFAAD-------dNYAA-------YLCVAAKSVEaahpdtEIRFHVLDA---GISEa   43
DSSP  LEEEEEEL-------hHHHH-------HHHHHHHHHHhlllllLLEEEEEEL---LLLHh


DSSP  HHLLLL---------LLEELLL-LLLL-----------LHHHhHHHHHHHH---LLEEEE
Query LSSRYE---------AEFIWDL-HKGV-----------GSIAgIHAALRHF---GSCVVA   89
ident                  ||                      |                  
Sbjct NRAAVAanlrggggnIRFIDVNpEDFAgfplnirhisiTTYA-RLKLGEYIadcDKVLYL  102
DSSP  HHHHHHhllhhhlllEEEEELLhHHHLllllllllllhHHHH-HHHHHHHLlllLLEEEE


DSSP  ELLLlLLLHHHhHHHHHHhHHHLLLEEEEELL-------------------LLLLLEEEE
Query AIDXpFVKPEVlEHLYKEgEKAGCDALIPKHD-------------------YPEPLLAYY  130
ident  ||   |       |                                    |        
Sbjct DIDV-LVRDSL-TPLWDT-DLGDNWLGACIDLfverqegykqkigmadgeyYFNAGVLLI  159
DSSP  LLLE-EELLLL-HHHHLL-LLLLLLEEEEELHhhhlllllhhhhlllllllLEEEEEEEE


DSSP  LHHHH--HHHHHHHHLLL---------LLLHHHHHLL--LEEEEEH--------------
Query AESAA--DELERAILQGI---------RKILVPLERL--NVVYYPV--------------  163
ident                                         | |                 
Sbjct NLKKWrrHDIFKMSCEWVeqykdvmqyQDEDILNGLFkgGVCYANSrfnfmptnyafman  219
DSSP  LHHHHllLLHHHHHHHHHhhlllllllLHHHHHHHHHllLEEELLHhhlllhhhhhhhll


DSSP  ------------HHHLlllLLLHHHLLLLLH---hhhHHHHhHHHH--------------
Query ------------EKLRkfdKELISFFNINTP---ddlKRAEeICSK--------------  194
ident                                        |                    
Sbjct asrhtdplyrdrTNTV---MPVAVSHYCGPAkpwhrdCTAW-GAERftelagslttvpee  275
DSSP  llllllhhhhhhLLLL---LLLLEEELLLLLllllllLLLL-LLHHhhhhhlllllllhh


DSSP  ----l
Query ----x  195
ident      
Sbjct wrgkl  280
DSSP  hllll


No 54: Query=mol1A Sbjct=1on8A Z-score=9.2

back to top
DSSP  ----LEEEEELLllllllllLHHHleelleeHHHHHHHHHLL----LEEEEELLLHHHhH
Query ----XKVAVLVGgvgrrigxEKTEvxlcgkkLIEWVLEKYSP----FQTVFVCRDEKQaE   52
ident                       |        |    |  |           |        
Sbjct aldsFTLIMQTY--------NRTD-------LLLRLLNHYQAvpslHKVIVVWNNVGE-K   44
DSSP  llllEEEEEEEL--------LLHH-------HHHHHHHHHLLllleEEEEEEELLLLL-L


DSSP  HHHLLLL--------LLEELLLlLLLLhHHHHHhhHHHHL---LEEEEELLLlLLLHHHH
Query KLSSRYE--------AEFIWDLhKGVGsIAGIHaaLRHFG---SCVVAAIDXpFVKPEVL  101
ident                  |                                |        |
Sbjct GPEELWNslgphpipVIFKPQT-ANKM-RNRLQ--VFPEVetnAVLMVDDDT-LISAQDL   99
DSSP  LLHHHHHhlllllllEEEEELL-LLLH-HHHHL--LLLLLlllEEEEELLLE-EELHHHH


DSSP  HHHHHHHHHHLLLEEE-EELL----------------------------lLLLLEEEELH
Query EHLYKEGEKAGCDALI-PKHD----------------------------yPEPLLAYYAE  132
ident                                                             
Sbjct VFAFSIWQQFPDQIIGfVPRKhvstssgiysyggfelqtpgpgngdqysmVLIGASFFNS  159
DSSP  HHHHHHHLLLLLLEEElLEEEeeeeelleeeeelllllllllllllllleELLLEEEEEL


DSSP  HHHHHHHH---hhHLLL----LLLHHHH-HLLL------EEEEEhhHHLLlllllhHHLL
Query SAADELER---aiLQGI----RKILVPL-ERLN------VVYYPveKLRKfdkeliSFFN  178
ident                 |                             |             
Sbjct KYLELFQKqpaavHALIdetqNCDDIAMnFLVTrhtgkpSGIFV--KPIN------MVNL  211
DSSP  HHHHHHHLllhhhHHHHhhhlLLHHHHHhHHHHhhhlllLEEEE--LLLL------EEEL


DSSP  LLL-------------------------------------hhhhhhhhhhhhhl
Query INT-------------------------------------pddlkraeeicskx  195
ident                                                       
Sbjct EKEtngysgmwhraehflqrsycinklvniydgmplkysnimisqfgfpyanhk  265
DSSP  LLLllllllhhhlllhhhhhhhhhhhhhhhlllllllllleeeeelllllllll


No 55: Query=mol1A Sbjct=1ll0B Z-score=9.0

back to top
DSSP  ---------LEEEEELLllllllllLHHHleelleeHHHHHHHHHL----LLEEEEELlL
Query ---------XKVAVLVGgvgrrigxEKTEvxlcgkkLIEWVLEKYS----PFQTVFVCrD   47
ident               |                                             
Sbjct vprgshmtdQAFVTLTT------ndAYAK-------GALVLGSSLKqhrtSRRLAVLT-T   46
DSSP  lllllllllEEEEEEEL------lhHHHH-------HHHHHHHHHHhlllLLEEEEEE-L


DSSP  HHHHHHHHLLLL---LLEELLLLL---------------lLLHHHHhHHHHHHH--LLEE
Query EKQAEKLSSRYE---AEFIWDLHK---------------gVGSIAGiHAALRHF--GSCV   87
ident            |    | |                                       ||
Sbjct PQVSDTMRKALEivfDEVITVDILdsgdsahltlmkrpelGVTLTK-LHCWSLTqySKCV  105
DSSP  LLLLHHHHHHHHhhlLLLLLLLLLllllllhhhhhhlhhhHHHHHH-HHHHHLLllLEEE


DSSP  EEELLLLlLLHHHhHHHHHHHhhhllLEEEEE----LLLLLLLEEEELHH--HHHHHHHH
Query VAAIDXPfVKPEVlEHLYKEGekagcDALIPK----HDYPEPLLAYYAES--AADELERA  141
ident     |   |       |                    |        |  |      |   
Sbjct FMDADTL-VLANI-DDLFERE-----ELSAAPdpgwPDCFNSGVFVYQPSveTYNQLLHV  158
DSSP  EELLLEE-ELLLL-HHHHHLL-----LLEEEEllllLLLEEEEEEEELLLhhHHHHHHHH


DSSP  HHLLLL-------LLHHHHHL----lleEEEEH-------------hhhllllLLLHHHL
Query ILQGIR-------KILVPLER----lnvVYYPV-------------eklrkfdKELISFF  177
ident                                |                            
Sbjct ASEQGSfdggdqgLLNTFFNSwattdirKHLPFiynlssisiysylpafkafgANAKVVH  218
DSSP  HHHHLLllllhhhHHHHHLLLlllllhhHLLLHhhhllllhhhhlhhhhhhhhHHLLEEE


DSSP  LLLLH-------------hhhhHHHHHHH------------------hl
Query NINTP-------------ddlkRAEEICS------------------kx  195
ident                                                  
Sbjct FLGQTkpwnytydtktksvrsmTHPQFLNvwwdifttsvvpllqqfglv  267
DSSP  LLLLLlhhhlleelllleelllHHHHHHHhhhhhhhhhhhhhhhlllll


No 56: Query=mol1A Sbjct=2z86C Z-score=8.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct avididaatkimcsnakaislnevekneiiskyreitakkseraelkevepipldwpsdl   60
DSSP  llllllhhhhhhhhhlllllllhhhhhhhhhhhhhhllllleelllllllllllllllll


DSSP  -----------------------------LEEEEELLllllllllLHHHleelleeHHHH
Query -----------------------------XKVAVLVGgvgrrigxEKTEvxlcgkkLIEW   31
ident                                                             
Sbjct tlpplpestndyvwagkrkelddqliidgLSIVIPTY--------NRAK-------ILAI  105
DSSP  lllllllllllhhhhhhllllllllllllEEEEEEEL--------LLHH-------HHHH


DSSP  HHHHHLL------LEEEEELLLHH-hhHHHHLLLL----LLEELLLLLlLLHHHHHHHHH
Query VLEKYSP------FQTVFVCRDEK-qaEKLSSRYE----AEFIWDLHKgVGSIAGIHAAL   80
ident  |                     |   |      |                  |     |
Sbjct TLACLCNqktiydYEVIVADDGSKeniEEIVREFEsllnIKYVRQKDYgYQLCAVRNLGL  165
DSSP  HHHHHHLllllllEEEEEEEELLLlllHHHHHHHLllllEEEEEELLLlLLHHHHHHHHH


DSSP  HHH--LLEEEEELLLLlLLHHHHHHHHHHHHHHLLlEEEEE-------------------
Query RHF--GSCVVAAIDXPfVKPEVLEHLYKEGEKAGCdALIPK-------------------  119
ident |            |     |                |||                     
Sbjct RAAkyNYVAILDCDMA-PNPLWVQSYMELLAVDDNvALIGPrkyidtskhtyldflsqks  224
DSSP  HHLllLEEEEELLLEE-ELLLHHHHHHHHHHHLLLeEEELLeeeellllllhhhhhhlll


DSSP  -----------------------------------llLLLLLEEEELHHHH--HHHHhHH
Query -----------------------------------hdYPEPLLAYYAESAA--DELErAI  142
ident                                               |             
Sbjct lineipeiitnqnksvdwriehfkntdnlrlcntpfrFFSGGNVAFAKKWLfrAGWF-DE  283
DSSP  lllllllllllllllllhhhhhhhhlllllllllhhhHLLLLEEEEELHHHhhHLLL-LL


DSSP  HLL--LLLLHHHHHLL----LEEEEEHhhhlllllllhHHLLLLLHH-------------
Query LQG--IRKILVPLERL----NVVYYPVeklrkfdkeliSFFNINTPD-------------  183
ident               ||                                            
Sbjct EFThwGGEDNEFGYRLyregCYFRSVE--------gamAYHQEPPGKenitvqllqqkvp  335
DSSP  LLLllLLHHHHHHHHHhhllLEEEELH--------hhlEEEELLLLLllllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  183
ident                                                             
Sbjct yfyrkkekiesatlkrvplvsiyipayncskyivrcvesalnqtitdlevcicddgstdd  395
DSSP  llllllllllllllllllleeeeeeelllhhhhhhhhhhhhlllllleeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  183
ident                                                             
Sbjct tlrilqehyanhprvrfisqknkgigsasntavrlcrgfyigqldsddflepdavelcld  455
DSSP  hhhhhhhhhllllleeeeeellllhhhhhhhhhhhlllleeeellllleelllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  183
ident                                                             
Sbjct efrkdlslacvyttnrnidregnlisngynwpiysrekltsamichhfrmftarawnlte  515
DSSP  hhhhllllleeeeeeeeellllleeeellllllllhhhhllllllllleeeehhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  183
ident                                                             
Sbjct gfnesisnavdydmylklsevgpfkhinkicynrvlhgentsikkldiqkenhfkvvnes  575
DSSP  lllllllllhhhhhhhhhllllleeeeeeeeeeeehhhllllllhhhhhhhhhhhhhhhh


DSSP  ----------------hhhhhhhhhhhl
Query ----------------dlkraeeicskx  195
ident                             
Sbjct lsrlgikkykyspltnlnecrkytweki  603
DSSP  lllllllleeeeellllllllleeeeel


No 57: Query=mol1A Sbjct=2d0jA Z-score=8.8

back to top
DSSP  ----LEEEEELLlllllllLLHHHleelleEHHHHHHHHHLL---LEEEEELLLHHHHHH
Query ----XKVAVLVGgvgrrigXEKTEvxlcgkKLIEWVLEKYSP---FQTVFVCRDEKQAEK   53
ident                                                   |       | 
Sbjct qlptIYAITPTY------sRPVQK------AELTRLANTFRQvaqLHWILVEDAAARSEL   48
DSSP  llllEEEEEEEL------lLLLHH------HHHHHHHHHHLLlllEEEEEEELLLLLLHH


DSSP  HHLLLL-----LLEELLLLL---llLHHHHHHHHHHHH-----------lLEEEEELLLl
Query LSSRYE-----AEFIWDLHK---gvGSIAGIHAALRHF-----------gSCVVAAIDXp   94
ident  |                              | |                   |  |  
Sbjct VSRFLAraglpSTHLHVPTPrrglpRATEQRNAGLAWLrqrhqhqraqpgVLFFADDDN-  107
DSSP  HHHHHHhllllEEEEELLLLlllllLLHHHHHHHHHHHhhhlllllllllEEEELLLLL-


DSSP  LLLHHHHHHHhHHHHhhllLEEEE-----------ELLL-------------------LL
Query FVKPEVLEHLyKEGEkagcDALIP-----------KHDY-------------------PE  124
ident     |                                                       
Sbjct TYSLELFQEM-RTTR----KVSVWpvglvggrryeRPLVengkvvgwytgwradrpfaID  162
DSSP  EELLHHHHHH-LLLL----LEEELleeeelleeeeEEEEelleeeeeellllllllllLL


DSSP  LLEEEELH----hhhHHHHhhHHLL---lLLLHHHHHLLL----EEEE--EHHHhlllll
Query PLLAYYAE----saaDELEraILQG---iRKILVPLERLN----VVYY--PVEKlrkfdk  171
ident                         |          |                 |      
Sbjct MAGFAVSLqvilsnpKAVF--KRRGsqpgMQESDFLKQITtveeLEPKanNCTK------  214
DSSP  HHHEEEEHhhhhhllLLLL--LLLLllhhHHHHHHHHLLLlhhhLEELhhHHLL------


DSSP  lLHHHLLLLLH-----hhhhhhhhhhhhl
Query eLISFFNINTP-----ddlkraeeicskx  195
ident                              
Sbjct -VLVWHTRTEKvnlanepkyhldtvkiev  242
DSSP  -LLEELLLLLLllllllllllllllllll


No 58: Query=mol1A Sbjct=1fggA Z-score=8.6

back to top
DSSP  --LEEEEElLLLLllllLLHHhleelleEHHHHHHHHHLL---LEEEEELLLHHHHHHHH
Query --XKVAVLvGGVGrrigXEKTevxlcgkKLIEWVLEKYSP---FQTVFVCRDEKQAEKLS   55
ident     |                                 |         |   |      |
Sbjct mtIYVVTP-TYAR----LVQK-------AELVRLSQTLSLvprLHWLLVEDAEGPTPLVS   48
DSSP  leEEEEEE-ELLL----LLHH-------HHHHHHHHHHLLlllEEEEEEELLLLLLHHHH


DSSP  LLLL-----LLEELLLLL--llLHHHHHHHHHHHH-------------------llEEEE
Query SRYE-----AEFIWDLHK--gvGSIAGIHAALRHF-------------------gsCVVA   89
ident                |              ||                           |
Sbjct GLLAasgllFTHLVVLTPwvhpRGVEQRNKALDWLrgrggavggekdppppgtqgvVYFA  108
DSSP  HHHHhhlleEEEEELLLLllllLLHHHHHHHHHHHllllleeeelllllllllleeEEEL


DSSP  ELLLlLLLHHHHHHHhHHHHhhllLEEEE------------------------------e
Query AIDXpFVKPEVLEHLyKEGEkagcDALIP------------------------------k  119
ident   |      |  |                                               
Sbjct DDDN-TYSRELFEEM-RWTR----GVSVWpvglvgglrfegpqvqdgrvvgfhtawepsr  162
DSSP  LLLL-EELHHHHHHH-LLLL----LEEELleeeelleeeeeeeeelleeeeeelllllll


DSSP  llLLLLLEEEELHH----hhHHHHhHHHLLL-lLLHHHHHLLL---eEEEEHHHHLLlll
Query hdYPEPLLAYYAES----aaDELErAILQGI-rKILVPLERLN---vVYYPVEKLRKfdk  171
ident            |                          |  |                  
Sbjct pfPVDMAGFAVALPllldkpNAQF-DSTAPRghLESSLLSHLVdpkdLEPRAANCTR---  218
DSSP  llLLLHHHEEEEHHhhhlllLLLL-LLLLLLllHHHHHHLLLLlhhhLEELHHHHLL---


DSSP  lLHHHLLLLLH---------hhhhhhhhhhhhl
Query eLISFFNINTP---------ddlkraeeicskx  195
ident                                  
Sbjct -VLVWHTRTEKpkmkqeeqlqrqgrgsdpaiev  250
DSSP  -LLEELLLLLLlllhhhhhhhhlllllllllll


No 59: Query=mol1A Sbjct=2p73A Z-score=8.5

back to top
DSSP  ---LEEEEeLLLLlllllllhHHLEelleeHHHHHHHHHLLL-----EEEEELLLHHhhh
Query ---XKVAVlVGGVgrrigxekTEVXlcgkkLIEWVLEKYSPF-----QTVFVCRDEKqae   52
ident                       |                                     
Sbjct tpcITILS-GHFP--------KETI----yARKTKELVEEYCsihgyNFYYEESEPL---   44
DSSP  lllEEEEE-ELLL--------LLLH----hHHHHHHHHHHHHhhhllEEEEELLLLL---


DSSP  hhhlllllleelllllllLHHHHHHHHHHHH---LLEEEEELLLlLLLH--hhhhhhhhH
Query klssryeaefiwdlhkgvGSIAGIHAALRHF---GSCVVAAIDXpFVKP--evlehlykE  107
ident                        |  |   |           |   | |           
Sbjct ---------eteehalhfRRSWIIQQAAEKFpstEWFLWLDSDV-YVNPknknkpitsfI   94
DSSP  ---------lllhhhhhhLHHHHHHHHHHHLlllLEEEEELLLE-EELLllllllhhhlL


DSSP  HHHHL-LLEEEEELL-----LLLLLEEEELHHHHHHHHHHHHLL-----------lLLLH
Query GEKAG-CDALIPKHD-----YPEPLLAYYAESAADELERAILQG-----------iRKIL  150
ident                                 |                           
Sbjct DLSDPnILYHTFHEApwgsyPINTGVKFVHKDALEIEKIVWSLRneapwntfpyeqKTVY  154
DSSP  LLLLLlLLEEEELLLlllllLLLLLEEEEEHHHHHHHHHHHHLLllllllllllhhHHHH


DSSP  -HHHHLL--LEEEEEHH-------hhlLLLLLL-hHHLLLLlhhHHHHHHHHHHHL
Query -VPLERL--NVVYYPVE-------klrKFDKEL-iSFFNINtpdDLKRAEEICSKX  195
ident      |                        |                   |     
Sbjct eYVFPRIpgRYIVHDPYtlncivkaypEHVKDAlfVHMCGT---SRAERDEHMEMV  207
DSSP  hLHHHHLllLEEEELLLllleelllllLLHHHLleEELLLL---LHHHHHHHHHHL


No 60: Query=mol1A Sbjct=1foaA Z-score=8.4

back to top
DSSP  -LEEEEELLLLLlllllLHHHleelleEHHHHHHHHH--LLLEEEEELLLHH---hHHHH
Query -XKVAVLVGGVGrrigxEKTEvxlcgkKLIEWVLEKY--SPFQTVFVCRDEK---qAEKL   54
ident                                  |            |  |      |   
Sbjct aVIPILVIACDR-----STVR------RCLDKLLHYRpsAELFPIIVSQDCGheetAQVI   49
DSSP  lLLLEEEEELLL-----LLHH------HHHHHHHHHLllLLLLLEEEEELLLlhhhHHHH


DSSP  HLLLL-LLEELLL------------------lllLLHHHHHHHHHH--HHLLEEEEELLL
Query SSRYE-AEFIWDL------------------hkgVGSIAGIHAALR--HFGSCVVAAIDX   93
ident  |       |                                           ||   | 
Sbjct ASYGSaVTHIRQPdlsniavqpdhrkfqgyykiaRHYRWALGQIFHnfNYPAAVVVEDDL  109
DSSP  HLLHHhLEEEELLlllllllllllhhhhhhhhhhHHHHHHHHHHHHllLLLEEEEEELLE


DSSP  LLL--LHHHHHHHHHHHHHHLLlEEEE--------------------eLLLLLLLEEEEL
Query PFV--KPEVLEHLYKEGEKAGCdALIP--------------------kHDYPEPLLAYYA  131
ident        |     |                                   |    |     
Sbjct EVApdFFEYFQATYPLLKADPSlWCVSawndngkeqmvdsskpellyrTDFFPGLGWLLL  169
DSSP  EELllHHHHHHHHHHHHHHLLLeEEEElllllllhhhlllllllleeeELLLLLLLEEEE


DSSP  HHHHHHHHHHHhLLLLLLHHH--hHLLL-EEEEEHHhhllllllLHHHLLLLL-----HH
Query ESAADELERAIlQGIRKILVP--lERLN-VVYYPVEklrkfdkeLISFFNINT-----PD  183
ident      |||                |          |                        
Sbjct AELWAELEPKW-PKAFWDDWMrrpEQRKgRACVRPE--------ISRTMTFGRkgvshGQ  220
DSSP  HHHHHHHHHHL-LLLLHHHHHllhHHHLlLEEEEEL--------LLLEEELLLlllllLH


DSSP  HHH-HHHHH---------------------------------------------------
Query DLK-RAEEI---------------------------------------------------  191
ident         |                                                   
Sbjct FFDqHLKFIklnqqfvpftqldlsylqqeaydrdflarvygapqlqvekvrtndrkelge  280
DSSP  HHHhLHHHLllllllllhhhlllhhhlhhhhhhhhhhhhhhlllllhhhhhlllllllle


DSSP  ----------------------------------------------------------hh
Query ----------------------------------------------------------cs  193
ident                                                             
Sbjct vrvqytgrdsfkafakalgvmddlksgvpragyrgivtflfrgrrvhlappqtwdgydps  340
DSSP  eeeelllhhhhhhhhhhhllllleelleellllllleeeeelleeeeeelllllllllll


DSSP  hl
Query kx  195
ident   
Sbjct wt  342
DSSP  ll


No 61: Query=mol1A Sbjct=3f1yA Z-score=8.3

back to top
DSSP  ----------------------------------LEEEEELLllllllllLHHHleelle
Query ----------------------------------XKVAVLVGgvgrrigxEKTEvxlcgk   26
ident                                                             
Sbjct gpasaaewfrqrsydygqfppedlarrkrelgltVSAVLPSR--------NVAD------   46
DSSP  llllhhhhhhhheeehhhllhhhhhhhhhhhlllEEEEEEEL--------LLLL------


DSSP  eHHHHHHHHHLL--------LEEEEELLL--hHHHHHHHlLLLLLEELLL------LLLL
Query kLIEWVLEKYSP--------FQTVFVCRD--eKQAEKLSsRYEAEFIWDL------HKGV   70
ident                      |   |  |     |        ||               
Sbjct -TVGGIIDEIHAlnerapliDQILVVDADsedGTAGVAA-SHGAEVYSENelmsgyGDAH  104
DSSP  -LHHHHHHHHHHhhhhllllLEEEEEELLlllLHHHHHH-HLLLEEEEHHhllhhhLLLL


DSSP  LHHHHHHHHHHHH--LLEEEEELLLLLLLHHHHHHHHHHHHHH-LLLEEEEE--------
Query GSIAGIHAALRHF--GSCVVAAIDXPFVKPEVLEHLYKEGEKA-GCDALIPK--------  119
ident |       ||             |     |              |               
Sbjct GKGDAMWRALSVTrgDLVLYIDADTRDFRPQLAYGVLGPVLEVpGVRFVKAAyrrpeedg  164
DSSP  LHHHHHHHHLLLLllLEEEELLLLLLLLLLHHHHLLHHHHHHLlLLLEEEEEeellllll


DSSP  ----------------------LLLLLLLEEEELH-HHHHHhHHHHhllLLLL-HHHHHL
Query ----------------------HDYPEPLLAYYAE-SAADElERAIlqgIRKI-LVPLER  155
ident                          |                                  
Sbjct ggrvteltakplfnlfypelagFVQPLAGEFVADReLFCSI-PFLT---GYAVeTGIMID  220
DSSP  llhhhhhlhhhhhhhhlhhhllLLLLLLLLEEEEHhHHLLL-LEEL---LLLHhHHHHHH


DSSP  LL-------EEEEEHHhhlllllllhhHLLLLLHH-------------------------
Query LN-------VVYYPVEklrkfdkelisFFNINTPD-------------------------  183
ident                              |                              
Sbjct VLkkvglgaMAQVDLG----------eRQNRHQHLrdlsrmsyavvravarrlrqegrlq  270
DSSP  HHhhhlhhhEEEEEEE----------eLLLLLLLHhhhhhhhhhhhhhhhhhhhhhllll


DSSP  ------------------------------------hhhhhhhhhhhl
Query ------------------------------------dlkraeeicskx  195
ident                                                 
Sbjct qlrepglpesffqlsdylhavatpeglklqeyveelverppinevlrv  318
DSSP  llllllllhhhlllleeeeeeeelleeeeeeeelllleellhhhllll


No 62: Query=mol1A Sbjct=2j0aA Z-score=8.2

back to top
DSSP  ------LEEEEELLllllllllLHHHleelleEHHHHHH-HHHLLL--EEEEELlLHHHh
Query ------XKVAVLVGgvgrrigxEKTEvxlcgkKLIEWVL-EKYSPF--QTVFVCrDEKQa   51
ident          ||                           |    |    ||     |    
Sbjct elqlgdIFIAVKTT-------wAFHR------SRLDLLLdTWVSRIrqQTFIFT-DSPD-   45
DSSP  lllhhhEEEEEELL-------hHHLL------LLHHHHHhLHHHHLhhHEEEEE-LLLL-


DSSP  HHHHLLLLLLEE-lllllLLLHhHHHHHHHHHH--LLEEEEELLLlLLLHHHHHHHHHHh
Query EKLSSRYEAEFI-wdlhkGVGSiAGIHAALRHF--GSCVVAAIDXpFVKPEVLEHLYKEg  108
ident | |  |                 |    |              |   | |  |  | |  
Sbjct ERLQERLGPHLVvtqcalSCKM-AAEFDAFLVSglRWFCHVDDDN-YVNPKALLQLLKT-  102
DSSP  HHHHHHHHHHEEelllllLHHH-HHHHHHHHHHllLEEEEEELLE-EELHHHHHHHHLL-


DSSP  HHHL-LLEEEEELL--lLLLL-EEEELHHHHHHHHHHHHLL-------------llLLHH
Query EKAG-CDALIPKHD--yPEPL-LAYYAESAADELERAILQG-------------irKILV  151
ident                               |                             
Sbjct FPQDrDVYVGKPSLfwfATGGaGFCINRQLALKMVPWASGShfvdtsalirlpddcTVGY  162
DSSP  LLLLlLLEEELEELlleELHHhLEEEEHHHHHHHHHHHLLLllllllllllllhhhHHHH


DSSP  HHH---LLLEEEEEH-----------hhhLLLLllLHHHlLLLL---HHHHhhhhhHHHH
Query PLE---RLNVVYYPV-----------eklRKFDkeLISFfNINT---PDDLkraeeICSK  194
ident   |          |                                              
Sbjct IIEcklGGRLQPSPLfhshletlqllgaaQLPE--QVTL-SYGVfegKLNV----iKLPG  215
DSSP  HHHhllLLLEEELLLlllllllhhhllllLHHH--LLEE-ELEEellEEEL----lLLLL


DSSP  ---------------------------l
Query ---------------------------x  195
ident                             
Sbjct pfsheedpsrfrslhcllypdtpwcpll  243
DSSP  llllllllllhhhhhhhhllllllllll


No 63: Query=mol1A Sbjct=2zu8A Z-score=8.0

back to top
DSSP  ------------------------------------------------LEEEEELLllll
Query ------------------------------------------------XKVAVLVGgvgr   12
ident                                                 | | |       
Sbjct xlleapvykeifgavtihevqkvikxdtvpiytisniprekiydllgkXAVIVPXK----   56
DSSP  leeelllleeeelleeeelleeeeelllllllleeellhhhhhhhhllEEEEEEEL----


DSSP  llllLHHHleelleEHHHHHHHHHLL-LEEEEELLLHH----HHHHHHLLLL--------
Query rigxEKTEvxlcgkKLIEWVLEKYSP-FQTVFVCRDEK----QAEKLSSRYE--------   59
ident                |   ||           |                           
Sbjct ----NEKL------HLVDGVLKAIPHkCPIIIVSNSKRegpnRYKLEVDLIRhfynlths  106
DSSP  ----LLLH------HHHHHHHHHLLLlLLEEEEELLLLllllHHHHHHHHHHhhhhhhll


DSSP  -LLEELLL---------------------lLLLLHHHHHHHHHHHHL-----LEEEEELL
Query -AEFIWDL---------------------hKGVGSIAGIHAALRHFG-----SCVVAAID   92
ident     |                            |   |    |                |
Sbjct kIIXIHQKdpglakafkevgytdildengxIRSGKGEGXLVGLLLAKaigaeYVGFVDAD  166
DSSP  lEEEEELLlhhhhhhhhhllllllllllllLLLLHHHHHHHHHHHHHhllllEEEELLLL


DSSP  LLL--LLHHHHHHHhHHHHHHL---LLEEEEEL---------------------------
Query XPF--VKPEVLEHLyKEGEKAG---CDALIPKH---------------------------  120
ident         |        |                                          
Sbjct NYIpgAVNEYVKDY-AAGFLXSeseYTXVRLHWwgrvseitnhylnllvsehtafettix  225
DSSP  LLLhhHHHHHHHHH-HHHHHLLlllEEEEEEELlllhhhhhhhhhhhhhhhhhlllllll


DSSP  llLLLLEEEELH-HHHHHhHHHHhllLLLL-HHHHHLL---------------------L
Query dyPEPLLAYYAE-SAADElERAIlqgIRKI-LVPLERL---------------------N  157
ident               |              |                              
Sbjct vtGNAGEHAXTXkLAEIL-PFST---GYSIePYEIVYIlerfgkwenveefkdvfdqgiE  281
DSSP  llLLLLLEEEEHhHHLLL-LLLL---HHHHhHHHHHHHhhhhllllllhhhhhhhhhleE


DSSP  EEEEEHhhhlllllLLHHhLLLLLHH----------------------------------
Query VVYYPVeklrkfdkELISfFNINTPD----------------------------------  183
ident                    |                                        
Sbjct IFQIET--------LNPH-FHEDKGKehvkexlllslatiyhsklatdnlrkrilkdlrd  332
DSSP  EEEEEL--------LLLL-LLLLLLHhhhhhhhhhhhhhhhllllllhhhhhhhhhhhhl


DSSP  -----------------------------hhhhhhhhhhhl
Query -----------------------------dlkraeeicskx  195
ident                                          
Sbjct hgilgenppkplvxrpikeipikewxdivegnsetllrfel  373
DSSP  lllllllllllllllllllllhhhhhhhhhhhlllleeell


No 64: Query=mol1A Sbjct=2d7iA Z-score=7.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gqklkdwhdkeairrdaqrvgngeqgrpypmtdaervdqayrengfniyvsdkislnrsl   60
DSSP  llleellllhhhhhhhhllllllhhhllllllllllllhhhhlllllhhhhhllllllll


DSSP  -------------------LEEEEELLllllllllLHHHleelleEHHHHHHHHHLL---
Query -------------------XKVAVLVGgvgrrigxEKTEvxlcgkKLIEWVLEKYSP---   38
ident                                                             
Sbjct pdirhpncnskryletlpnTSIIIPFH--------NEGW------SSLLRTVHSVLNrsp  106
DSSP  lllllhhhhllleelllllEEEEEEEL--------LLLH------HHHHHHHHHHHHhll


DSSP  ----LEEEEELLLHH---hhHHHHLLLL----LLEELLLlLLLLHHHHHHHHHHHH--lL
Query ----FQTVFVCRDEK---qaEKLSSRYE----AEFIWDLhKGVGSIAGIHAALRHF--gS   85
ident        | |            |                 |  | |              
Sbjct pelvAEIVLVDDFSDrehlkKPLEDYMAlfpsVRILRTK-KREGLIRTRMLGASVAtgdV  165
DSSP  hhheEEEEEEELLLLlhhhlHHHHHHHLllllEEEEELL-LLLLHHHHHHHHHHHLlllE


DSSP  EEEEELLLlLLLHHHHHHHHHHHHHHLLlEEEE-------------------ELLL----
Query CVVAAIDXpFVKPEVLEHLYKEGEKAGCdALIP-------------------KHDY----  122
ident                |  |                                         
Sbjct ITFLDSHC-EANVNWLPPLLDRIARNRK-TIVCpmidvidhddfryetqagdAMRGafdw  223
DSSP  EEELLLLE-EELLLLLHHHHHHHHHLLL-EEEEeeeeeelllllleelllllLLEEeell


DSSP  --------------------------LLLLEEEELH-HHHH-HHHHhHHLL-lLLLH-HH
Query --------------------------PEPLLAYYAE-SAAD-ELERaILQG-iRKIL-VP  152
ident                               |                             
Sbjct emyykripippelqkadpsdpfespvMAGGLFAVDRkWFWElGGYD-PGLEiwGGEQyEI  282
DSSP  llleeeelllllllllllllleelllLLLLLEEEEHhHHHHlLLLL-LLLLllLLHHhHH


DSSP  HHLL----LEEEEehhhHLLLLlllhHHLLLLLH--------------------------
Query LERL----NVVYYpvekLRKFDkeliSFFNINTP--------------------------  182
ident                                                             
Sbjct SFKVwmcgGRMED----IPCSR----VGHIYRKYvpykvpagvslarnlkrvaevwmdey  334
DSSP  HHHHhhllLEEEE----EEEEE----EEELLLLLllllllllllhhhhhhhhhhhhlhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  182
ident                                                             
Sbjct aeyiyqrrpeyrhlsagdvavqkklrsslncksfkwfmtkiawdlpkfyppveppaaawg  394
DSSP  hhhhhlllhhhllllllllhhhhhhhhhhllllhhhhhhhllllhhhhllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  182
ident                                                             
Sbjct eirnvgtglcadtkhgalgsplrlegcvrgrgeaawnnmqvftftwredirpgdpqhtkk  454
DSSP  eeeellllleelllllllllllleellllllllhhhllllleeellllleeellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  182
ident                                                             
Sbjct fcfdaishtspvtlydchsmkgnqlwkyrkdktlyhpvsgscmdcsesdhrifmntcnps  514
DSSP  lllllllllllllllllllllllllleellllleelllllleeeelllllleeeelllll


DSSP  ---------hhhhhhhhhhhhl
Query ---------ddlkraeeicskx  195
ident                       
Sbjct sltqqwlfehtnstvlekfnrn  536
DSSP  llllleeeeellhhhhllllll


No 65: Query=mol1A Sbjct=1xhbA Z-score=7.5

back to top
DSSP  -----------------------LEEEEELLllllllllLHHHleelleEHHHHHHHHHL
Query -----------------------XKVAVLVGgvgrrigxEKTEvxlcgkKLIEWVLEKYS   37
ident                          |                                  
Sbjct nrslpdvrlegcktkvypdnlptTSVVIVFH--------NEAW------STLLRTVHSVI   46
DSSP  lllllllllhhhhllllllllllEEEEEEEL--------LLLH------HHHHHHHHHHH


DSSP  L-------LEEEEELLLHH---hhHHHHLLLL-----LLEELLLLLlLLHHHHHHHHHHH
Query P-------FQTVFVCRDEK---qaEKLSSRYE-----AEFIWDLHKgVGSIAGIHAALRH   82
ident            | |            | |           |       | |         
Sbjct NrsprhmiEEIVLVDDASErdflkRPLESYVKklkvpVHVIRMEQR-SGLIRARLKGAAV  105
DSSP  HlllhhheEEEEEEELLLLlhhhlHHHHHHHHlllllEEEEELLLL-LLHHHHHHHHHHH


DSSP  H--LLEEEEELLLlLLLHHHHHHHHHHHHHHLLLEEEE----------------eLLLL-
Query F--GSCVVAAIDXpFVKPEVLEHLYKEGEKAGCDALIP----------------kHDYP-  123
ident                     || |             |                   |  
Sbjct SrgQVITFLDAHC-ECTAGWLEPLLARIKHDRRTVVCPiidvisddtfeymagsdMTYGg  164
DSSP  LllLEEEEEELLE-EELLLLHHHHHHHHHHLLLEEEEEeeeeelllllleellllLEEEe


DSSP  ---------------------------------LLLEEEELH-HHHH-HHHHhHHLL--L
Query ---------------------------------EPLLAYYAE-SAAD-ELERaILQG--I  146
ident                                     |                       
Sbjct fnwklnfrwypvpqremdrrkgdrtlpvrtptmAGGLFSIDRdYFQEiGTYD-AGMDiwG  223
DSSP  ellllleeeeellhhhhhhlllllllleellllLLLLEEEEHhHHHHlLLLL-LLLLllL


DSSP  LLLHHHHHLL----LEEEEeHHHHlllllllhHHLLL-----------------------
Query RKILVPLERL----NVVYYpVEKLrkfdkeliSFFNI-----------------------  179
ident    |    |           |                                       
Sbjct GENLEISFRIwqcgGTLEI-VTCS-------hVGHVFgqiinknnrrlaevwmdefknff  275
DSSP  LLLLHHHHHHhhllLEEEE-EEEE-------eEEEELlhhhhhhhhhhhhhhlhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  179
ident                                                             
Sbjct yiispgvtkvdygdissrlglrrklqckpfswyleniypdsqiprhyfslgeirnvetnq  335
DSSP  hhllllhhhllllllhhhhhhhhhlllllhhhhhhhlllllllllleeeeeleeelllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  179
ident                                                             
Sbjct cldnmarkenekvgifnchgmggnqvfsytankeirtddlcldvsklngpvtmlkchhlk  395
DSSP  eeellllllleeleeeelllllhhhleeeelllleeelleeeelllllllleeeelllll


DSSP  ------------------------------------llhhhhhhhhhhhhhl
Query ------------------------------------ntpddlkraeeicskx  195
ident                                                     
Sbjct gnqlweydpvkltlqhvnsnqcldkateedsqvpsirdctgsrsqqwllrnv  447
DSSP  hhhleeeelllleeeelllleeeelllllllllleeeellllhhhleeelll


No 66: Query=mol1A Sbjct=2vkdA Z-score=7.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mnlvnkaqlqkmayvkfriqedeyvailnaleeyhnmsessvvekylklkdinnltdnyl   60
DSSP  lllllhhhhhhhhllllllllhhhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhh


DSSP  -----------------------------------LEEEEELLlllllllLLHHhleell
Query -----------------------------------XKVAVLVGgvgrrigXEKTevxlcg   25
ident                                                             
Sbjct ntykksgrnkalkkfkeyltmevlelknnsltpveKNLHFIWI------gGQIN------  108
DSSP  hhllllllhhhhhhhhhhhhhhhhhhhhllleellLEEEEELL------lLLLL------


DSSP  eEHHHHHHHHHLL----LEEEEELlLHHH-------------------------------
Query kKLIEWVLEKYSP----FQTVFVCrDEKQ-------------------------------   50
ident                          |                                  
Sbjct -DTAINYINQWKDvnsdYTVKVFY-DSNAflintlkktivesatnntlesfrenlndpef  166
DSSP  -HHHHHHHHHHHHhlllLEEEEEE-LLLLllhhhhhhhhhhhhhhhhhhlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   50
ident                                                             
Sbjct dynkfyrkrmeiiydkqkhfidyyksqieenpefiidniiktylsneyskdlealnkyie  226
DSSP  lhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhllllhhhhhhhhh


DSSP  --hHHHHllLLLLEEL---------llLLLL------------LHHHHHHHHHHHHlLEE
Query --aEKLSsrYEAEFIW---------dlHKGV------------GSIAGIHAALRHFgSCV   87
ident     |                                       |       |      |
Sbjct eslNKIT--ANNGNDIrnlekfadedlVRLYnqelverwnlaaASDILRISMLKED-GGV  283
DSSP  hhhHHHH--LLLEEEHhhllllllhhhHHHHhhhhhllllhhhHHHHHHHHHHHHH-LEE


DSSP  EEELLLlLLLH-------------------------------------------------
Query VAAIDXpFVKP-------------------------------------------------   98
ident     |                                                       
Sbjct YLDVDM-LPGIqpdlfksinkpdsitntswemikleaimkykeyipgytsknfdmldeev  342
DSSP  EELLLL-LLLLlhhhhllllllllllhhhhhhhhhhhhhhhlllllllllllhhhllhhh


DSSP  ------------------HHHHHhhHHHHhhLLLEEEEE-LLLLLLLEEEEL--HHHHHH
Query ------------------EVLEHlyKEGEkaGCDALIPK-HDYPEPLLAYYA--ESAADE  137
ident                     |               |                     | 
Sbjct qrsfesalssksdkseifLPLDD--IKVS--PLEVKIAFaNNSVINQALISLkdSYCSDL  398
DSSP  hhhhhhhllllllhhhllLLLLL--LEEL--LLLLEEEElLLLEEEEEEEELllLHHHHH


DSSP  HHHHHHLLL---------------------------------------------------
Query LERAILQGI---------------------------------------------------  146
ident     |                                                       
Sbjct VINQIKNRYkilndnlnpsinegtdfnttmkifsdklasisnednmmfmikitnylkvgf  458
DSSP  HHHHHHHHHhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhlllllhhhhhhhllhhhlll


DSSP  ---------LLLHHHHHLLL---------------------eEEEEHhhhlllllllHHH
Query ---------RKILVPLERLN---------------------vVYYPVeklrkfdkelISF  176
ident                                              |           || 
Sbjct apdvrstinLSGPGVYTGAYqdllmfkdnstnihllepelrnFEFPK--------tkISQ  510
DSSP  lllllhhhhHLLHHHHHHHHhhhhhlllllllllllhhhhhhHLLLH--------hhLLL


DSSP  L---LLLL----------hhhhhhhhhhhhhl
Query F---NINT----------pddlkraeeicskx  195
ident      |                          
Sbjct LteqEITSlwsfnqaraksqfeeykkgyfega  542
DSSP  LllhHHLLlllllhhhhhhhhhhhhhllllll


No 67: Query=mol1A Sbjct=2ffuA Z-score=7.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kvrwpdfnqeayvggtmvrsgqdpyarnkfnqvesdklrmdraipdtrhdqcqrkqwrvd   60
DSSP  lllhhhllhhhhhhlllllllllllllllllhhhhhhllllllllllllhhhhhllllll


DSSP  ---LEEEEELLllllllllLHHHleelleEHHHHHHHHHL-------LLEEEEELLL---
Query ---XKVAVLVGgvgrrigxEKTEvxlcgkKLIEWVLEKYS-------PFQTVFVCRD---   47
ident      |                                               |      
Sbjct lpaTSVVITFH--------NEAR------SALLRTVVSVLkkspphlIKEIILVDDYsnd  106
DSSP  lllEEEEEEEL--------LLLH------HHHHHHHHHHHhhllhhhEEEEEEEELLlll


DSSP  HHHHHHHHlLLLL-LEELLLlLLLLHHHHHHHHHHHH--lLEEEEELLlLLLLHHHHHHH
Query EKQAEKLSsRYEA-EFIWDLhKGVGSIAGIHAALRHF--gSCVVAAIDxPFVKPEVLEHL  104
ident       |    |            |                               || |
Sbjct PEDGALLG-KIEKvRVLRND-RREGLMRSRVRGADAAqakVLTFLDSH-CECNEHWLEPL  163
DSSP  LHHHHHHH-HLLLeEEEELL-LLLHHHHHHHHHHHHLlllEEEELLLL-EEELLLLHHHH


DSSP  HHHHHHHLL-----------------leeeeeLLLL------------------------
Query YKEGEKAGC-----------------dalipkHDYP------------------------  123
ident                                                             
Sbjct LERVAEDRTrvvspiidvinmdnfqyvgasadLKGGfdwnlvfkwdymtpeqrrsrqgnp  223
DSSP  HHHHHHLLLeeeeeeeeeelllllleelllllEEEEellllleeeeellhhhhhhlllll


DSSP  ---------LLLEEEEL-HHHH-HHHHhHHHLL-lLLLH-HHHHLL----LEEEEehhhH
Query ---------EPLLAYYA-ESAA-DELErAILQG-iRKIL-VPLERL----NVVYYpvekL  166
ident             |                               |               
Sbjct vapiktpmiAGGLFVMDkFYFEeLGKY-DMMMDvwGGENlEISFRVwqcgGSLEI----I  278
DSSP  llleellllLLLLEEEEhHHHHhLLLL-LLLLLllLLHHhHHHHHHhhllLEEEE----E


DSSP  LLLLlllhHHLLLLLH--------------------------------------------
Query RKFDkeliSFFNINTP--------------------------------------------  182
ident                                                             
Sbjct PCSR----VGHVFRKQhpytfpggsgtvfarntrraaevwmdeyknfyyaavpsarnvpy  334
DSSP  EEEE----EEELLLLLllllllllhhhhhhhhhhhhhhhhlhhhhhhhhhhlhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  182
ident                                                             
Sbjct gniqsrlelrkklsckpfkwylenvypelrvpdhqdiafgalqqgtncldtlghfadgvv  394
DSSP  lllhhhhhhhhhlllllhhhhhhhlllllllllllllleeeeeelleeeellllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  182
ident                                                             
Sbjct gvyechnaggnqewaltkeksvkhmdlcltvvdrapgsliklqgcrendsrqkweqiegn  454
DSSP  eeeelllllhhhleeellllleeelleeeelllllllllleeeelllllhhhleeeelll


DSSP  ---------------------------hhhhhhhhhhhhl
Query ---------------------------ddlkraeeicskx  195
ident                                         
Sbjct sklrhvgsnlcldsrtaksgglsvevcgpalsqqwkftln  494
DSSP  leeeelllleeeelllhhhllleeeellllhhhlleeeel


No 68: Query=mol1A Sbjct=2vs4A Z-score=7.1

back to top
DSSP  ------------------------------------------------LEEEEELLllll
Query ------------------------------------------------XKVAVLVGgvgr   12
ident                                                     |       
Sbjct sklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitVGLTVFAV----   56
DSSP  llllhhhhllhhhllllllllllllleellllllhhhhhhhhhhllllEEEEEEEL----


DSSP  llllLHHHLeelleeHHHHHHHHHLL-------LEEEEELLlhhHHHHHhLLLL------
Query rigxEKTEVxlcgkkLIEWVLEKYSP-------FQTVFVCRdekQAEKLsSRYE------   59
ident        |         |  |                                |      
Sbjct ---gRYIEH------YLEEFLTSANKhfmvghpVIFYIMVD---DVSRM-PLIElgplrs  103
DSSP  ---lLHHHH------HHHHHHHHHHHhllllllEEEEEEEL---LHHHL-LLLLllllee


DSSP  LLEEL---lllllLLHHHHHHHHHHHH--------lLEEEEELLLlLLLHHhHHHHhHHH
Query AEFIW---dlhkgVGSIAGIHAALRHF--------gSCVVAAIDXpFVKPEvLEHLyKEG  108
ident                |         |                 |               |
Sbjct FKVFKikpekrwqDISMMRMKTIGEHIvahiqhevdFLFCMDVDQ-VFQDK-FGVE-TLG  160
DSSP  EEEEEllllllhhHHHHHHHHHHHHHHhhlhhhhllEEEEELLLE-EELLL-LLHH-HLL


DSSP  HhhlllEEEEELL-----------------------------LLLLLEEEE----LHHHH
Query EkagcdALIPKHD-----------------------------YPEPLLAYY----AESAA  135
ident |                                         |                 
Sbjct E-----SVAQLQAwwykadpndftyerrkesaayipfgegdfYYHAAIFGGtptqVLNIT  215
DSSP  L-----EEEEELLllllllhhhllllllllllllllllllllLEEEEEEEElhhhHHHHH


DSSP  HHHHHHHHLL--------lLLLH---HHHHLLLE-EEEEHH----------hhLLLLlll
Query DELERAILQG--------iRKIL---VPLERLNV-VYYPVE----------klRKFDkel  173
ident  |    ||                                |             |     
Sbjct QECFKGILKDkkndieaqwHEEShlnKYFLLNKPtKILSPEycwdyhiglpadIKLV---  272
DSSP  HHHHHHHHHHhhlllllllLHHHhhhHHHHHLLLlEEELHHhlllhhhlllllLLLL---


DSSP  hHHLLLLLHHhhhhhhhhhhhl
Query iSFFNINTPDdlkraeeicskx  195
ident                       
Sbjct kMSWQTKEYN------vvrnnv  288
DSSP  lEEELLLLHH------hhllll


No 69: Query=mol1A Sbjct=3bcvA Z-score=7.1

back to top
DSSP  ---LEEEEELLLLLlllllLHHHleelleEHHHHHHHHHLLLEEEEELL------lHHHH
Query ---XKVAVLVGGVGrrigxEKTEvxlcgkKLIEWVLEKYSPFQTVFVCR------dEKQA   51
ident                                    |                     |  
Sbjct lipKVSVIVPIYNV----eKYLD------QCVQALLAQTLSDIEIILIDdespdncPKIC   50
DSSP  lllLEEEEEEELLL----lLLHH------HHHHHHHLLLLLLEEEEEEEllllllhHHHH


DSSP  HHHHLLLLLLEELlLLLLLLhHHHHHHHHHHHL--LEEEEELLLLlLLHHHHHHHHHH-h
Query EKLSSRYEAEFIWdLHKGVGsIAGIHAALRHFG--SCVVAAIDXPfVKPEVLEHLYKE-g  108
ident       |                     |             |   |        |    
Sbjct DDYAAQYPNIKVIhKKNAGL-GXACNSGLDVATgeYVAFCDSDDY-VDSDXYXTXYNVaq  108
DSSP  HHHHHHLLLEEEEeLLLLLH-HHHHHHHHHHLLllEEEELLLLLL-LLLLHHHHHHHHhh


DSSP  hHHLLlEEEE----------------------------eLLLLLLlEEEE-LHHH--hHH
Query eKAGCdALIP----------------------------kHDYPEPlLAYY-AESA--aDE  137
ident       |                                          |          
Sbjct kYTCD-AVFTfklyknkneihtllkdliasdpyareeraIQVSAK-VVLYrRNLIekkHL  166
DSSP  hHLLL-EEELleeellhhhhhhhhhhhllllhhhhhhhhHHHLLL-LEEEeHHHHhhlLL


DSSP  HHhHHHLLLL-LLHHHHHLLL-----eEEEEhhhhlllllllhhhlllllhhhhhhhhhh
Query LErAILQGIR-KILVPLERLN-----vVYYPveklrkfdkelisffnintpddlkraeei  191
ident              |                |                             
Sbjct RF-VSERILPsEDLIFNVDVLansnivCVLP-----------------------------  196
DSSP  LL-LLLLLLLlHHHHHHHHHHllllleEELL-----------------------------


DSSP  hhhl
Query cskx  195
ident     
Sbjct ----  196
DSSP  ----


No 70: Query=mol1A Sbjct=1v82A Z-score=6.9

back to top
DSSP  -LEEEEELLLLLlllLLLHHhleelleEHHHHHHHHHLLL-EEEEELLL-----hhhHHH
Query -XKVAVLVGGVGrriGXEKTevxlcgkKLIEWVLEKYSPF-QTVFVCRD-----ekqAEK   53
ident      |                                                      
Sbjct lPTIHVVTPTYS---RPVQK-------AELTRMANTLLHVpNLHWLVVEdaprrtplTAR   50
DSSP  lLEEEEEEEELL---LLLHH-------HHHHHHHHHHLLLlLEEEEEEEllllllhhHHH


DSSP  HHLLLLLLEELL--------------llllLLHHHHHHHH-------hhhhLLEEEEELL
Query LSSRYEAEFIWD--------------lhkgVGSIAGIHAA-------lrhfGSCVVAAID   92
ident |                                                  |    |  |
Sbjct LLRDTGLNYTHLhvetprnyklrgriprgtMQRNLALRWLretfprnssqpGVVYFADDD  110
DSSP  HHHHHLLEEEEEellllhhhhllllllllhHHHHHHHHHHhhhllllllllEEEEELLLL


DSSP  LlLLLHHHHHHHhHHHHhhllLEEEE-----------ELLL-------------------
Query XpFVKPEVLEHLyKEGEkagcDALIP-----------KHDY-------------------  122
ident       |  |                                                  
Sbjct N-TYSLELFEEM-RSTR----RVSVWpvafvgglryeAPRVngagkvvrwktvfdphrpf  164
DSSP  L-EELHHHHHHH-LLLL----LEEELleelllllleeEEEEllllleeeeelllllllll


DSSP  -LLLLEEEELHHHH---HHHHhHHHLLL---lLLHHHHHLLL----EEEE--EHHHhlll
Query -PEPLLAYYAESAA---DELErAILQGI---rKILVPLERLN----VVYY--PVEKlrkf  169
ident                         | |          |  |              |    
Sbjct aIDMAGFAVNLRLIlqrSQAY-FKLRGVkggyQESSLLRELVtlndLEPKaaNCTK----  219
DSSP  lLLHHHEEEEHHHHhhlLLLL-LLLLLLllllHHHHHHHHHLlhhhEEELhhHHLL----


DSSP  lllLHHHLLLLLHH-----hhhhhhhhhhhl
Query dkeLISFFNINTPD-----dlkraeeicskx  195
ident                                
Sbjct ---ILVWHTRTEKPvlvnegkkgftdpsvei  247
DSSP  ---LLEELLLLLLLllhhhllllllllllll


No 71: Query=mol1A Sbjct=1h7qA Z-score=6.7

back to top
DSSP  lEEEEELLLLlllllllhhHLEElleeHHHHHHHHHLL---LEEEEELL-------lhhh
Query xKVAVLVGGVgrrigxektEVXLcgkkLIEWVLEKYSP---FQTVFVCR-------dekq   50
ident  || |                                                       
Sbjct pKVSVIMTSY---------NKSD----YVAKSISSILSqtfSDFELFIMddnsneetlnv   47
DSSP  lLEEEEEEEL---------LLLL----LHHHHHHHHHLlllLLEEEEEEellllhhhhhh


DSSP  hHHHHllLLLLEEL-------------lllllLLHHHHHHHHhhHHLLEeEEELLLLLLL
Query aEKLSsrYEAEFIW-------------dlhkgVGSIAGIHAAlrHFGSCvVAAIDXPFVK   97
ident                                       |  |          | |     
Sbjct iRPFL--NDNRVRFyqsdisgvkertektryaALINQAIEMA--EGEYI-TYATDDNIYM  102
DSSP  hHHHH--HLLLEEEeelllllhhhhhhllhhhHHHHHHHHHL--LLLEE-EEEELLEEEL


DSSP  HHHHHHHHHHHHHHL-LLEEEEE------------------------llLLLLLEEEELH
Query PEVLEHLYKEGEKAG-CDALIPK------------------------hdYPEPLLAYYAE  132
ident |  |     |                                                  
Sbjct PDRLLKMVRELDTHPeKAVIYSAsktyhlndivketvrpaaqvtwnapcAIDHCSVMHRY  162
DSSP  LLHHHHHHHHHHHLLlLLEEEEEeeeeeelleeeeeeelllllllllllLLLHHHEEEEH


DSSP  HHHHHHHHhhHLLLL------------LLHHHHH-LLLEEEEEHhhhlllllllhHHLLl
Query SAADELERaiLQGIR------------KILVPLE-RLNVVYYPVeklrkfdkeliSFFNi  179
ident |                                                         | 
Sbjct SVLEKVKE-kFGSYWdespafyrigdaRFFWRVNhFYPFYPLDE----------eLDLN-  210
DSSP  HHHHHHHH-hHLLLLlllhhhlllhhhHHHHHHLlLLLLEEEEE----------eEEEE-


DSSP  llhhHHHH------------------hhhhhhhl
Query ntpdDLKR------------------aeeicskx  195
ident                                   
Sbjct ----YITDnefvrnlppqrncrelreslkklgmg  240
DSSP  ----EEELlllhhhllllllhhhhhhhhhhhlll


No 72: Query=mol1A Sbjct=2gakA Z-score=6.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct rhlelnvnctkilqgdpeeiqkvkleiltvqfkkrprwtphdyinmtrdcasfirtrkyi   60
DSSP  llllllllhhhhhlllhhhhhhhhhhhhlhhhhllllllhhhhhhhlllhhhhhhhhlll


DSSP  ------------LEEEEELLllllllllLHHHleelleeHHHHHHHHHLL--LEEEEELL
Query ------------XKVAVLVGgvgrrigxEKTEvxlcgkkLIEWVLEKYSP--FQTVFVCR   46
ident                   |          | |            |               
Sbjct vepltkeevgfpIAYSIVVH--------HKIE-------MLDRLLRAIYMpqNFYCIHVD  105
DSSP  lllllhhhhlllEEEEEEEL--------LLHH-------HHHHHHHHHLLllLEEEEEEL


DSSP  L---hHHHHHHHLLLL----LLEELLllLLLL------HHHHHHHHHHHHL-------lE
Query D---eKQAEKLSSRYE----AEFIWDlhKGVG------SIAGIHAALRHFG-------sC   86
ident                                                             
Sbjct RkaeeSFLAAVQGIAScfdnVFVASQ--LESVvyaswtRVKADLNCMKDLYrmnanwkyL  163
DSSP  LlllhHHHHHHHHHHHllllEEELLL--LLLLllllhhHHHHHHHHHHHHHhhllllleE


DSSP  EEEELLLLLLL-HHHHHHhhhhhHHHLllEEEE---------------------------
Query VVAAIDXPFVK-PEVLEHlykegEKAGcdALIP---------------------------  118
ident           |                                                 
Sbjct INLCGMDFPIKtNLEIVR-klkcSTGE--NNLEtekmppnkeerwkkryavvdgkltntg  220
DSSP  EEEELLLEELLlHHHHHH-hhhhLLLL--LLLLleellhhhlhhhheeeeeelleeeeee


DSSP  ----------ellLLLLLeEEEL---HHHHH---hhhhhHHLLL---LLLHHHH-HLLL-
Query ----------khdYPEPLlAYYA---ESAAD---eleraILQGI---RKILVPL-ERLN-  157
ident                                                             
Sbjct ivkappplktplfSGSAY-FVVTreyVGYVLeneniqklMEWAQdtySPDEFLWaTIQRi  279
DSSP  eelllllllllleELLLL-LEEEhhhHHHHHhlhhhhhhHHHHLlllLHHHLHHhHHLLl


DSSP  -----------eeeEEHHH---------------------------------------hl
Query -----------vvyYPVEK---------------------------------------lr  167
ident                                                             
Sbjct pevpgsfpssnkydLSDMNaiarfvkwqyfegdvsngapyppcsgvhvrsvcvfgagdls  339
DSSP  llllllllllhhhlLLLLLllleeellllllllhhhllllllllleeelleeellhhhhh


DSSP  llLLLL-hHHLLLLlhhHHHHhHHHHHHL----------
Query kfDKEL-iSFFNINtpdDLKRaEEICSKX----------  195
ident                                        
Sbjct wmLRQHhlFANKFD---MDVD-PFAIQCLdehlrrkale  374
DSSP  hhLLLLllEEELLL---LLLL-HHHHHHHhhhhhhhhhl


No 73: Query=mol1A Sbjct=2c0nA Z-score=6.4

back to top
DSSP  --LEEEEELLLLlllllllhhhleelleeHHHHHHHHHL--LLEEEEELLLhhhhhhhhl
Query --XKVAVLVGGVgrrigxektevxlcgkkLIEWVLEKYS--PFQTVFVCRDekqaeklss   56
ident           |                                  |   |          
Sbjct xrTLFFIPSXGS-----------------VRLPLIDFLVknDIEYVILSRR---------   34
DSSP  llEEEEEELLLL-----------------LLHHHHHHHHhlLLLEEEELLL---------


DSSP  llllleellllllLLHHHHHHHHHHHHL------LEEEEELLLLLLLhhHHHHhhHHHHH
Query ryeaefiwdlhkgVGSIAGIHAALRHFG------SCVVAAIDXPFVKpeVLEHlyKEGEK  110
ident                       ||  |              |                  
Sbjct -------------NHVAVQREIALDXFLexkdydTLAFLDEDVVPIE--IDFQkvEAKFN   79
DSSP  -------------LLHHHHHHHHHHHHHhlllllEEEEELLLEEEEE--LLHHhhHHHHH


DSSP  HLLLEEE-----------EELL-------------lLLLLEEEELHH-----hhHHHHhh
Query AGCDALI-----------PKHD-------------yPEPLLAYYAES-----aaDELEra  141
ident  | |                                                        
Sbjct EGYDVVCgyyylktlrgySVYRkdwekeifdgevngCGLGFTFIKREflekikrPAFL--  137
DSSP  HLLLEEEeelllllllllLEELllllllllleelleELLLEEEEEHHhhlllllLLLL--


DSSP  hhllLLLLHHHHH-LLLEEEEEHhhhlllllllhHHLLLLL-----hhhhHHHH------
Query ilqgIRKILVPLE-RLNVVYYPVeklrkfdkeliSFFNINT-----pddlKRAE------  189
ident     |              |                              |         
Sbjct ---aIGEDVYFFStHKPRTYALS---------slKAYHFIDerlalspdrKLILqndhva  185
DSSP  ---lLLHHHHHHHhHLLLEEEEE---------eeEEEEELLlleeellllLEEEllllll


DSSP  hhhhhl
Query eicskx  195
ident       
Sbjct rikhhh  191
DSSP  llllll


No 74: Query=mol1A Sbjct=2rj7A Z-score=6.0

back to top
DSSP  ------------------------------------------------------LEEEEE
Query ------------------------------------------------------XKVAVL    6
ident                                                           | 
Sbjct fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttIGLTVF   60
DSSP  lllllllllllllllllllllllllllllllleellllllhhhhhhhhhhllleEEEEEE


DSSP  LLllllllllLHHHleelleeHHHHHHHHHL-------lLEEEEELllhhHHHHHhLLLL
Query VGgvgrrigxEKTEvxlcgkkLIEWVLEKYS-------pFQTVFVCrdekQAEKLsSRYE   59
ident                           ||                      |      |  
Sbjct AI-------kKYVA-------FLKLFLETAEkhfmvghrVHYYVFT---dQPAAV-PRVT  102
DSSP  EL-------hHHHH-------HHHHHHHHHHhhllllleEEEEEEE---lLHHHL-LLLL


DSSP  ------LLEELLL------lllLLHHHHHHhhhHHHL-----LEEEEELLLLLlLHHHhh
Query ------AEFIWDL------hkgVGSIAGIHaalRHFG-----SCVVAAIDXPFvKPEVle  102
ident                             |               |    |  |    |  
Sbjct lgtgrqLSVLEVRaykrwqdvsMRRMEMIS-fcERRFlsevdYLVCVDVDMEF-RDHV--  158
DSSP  lllleeEEEEELLllllhhhhhHLHHHHHL-llLLLHhhhllEEEEELLLEEE-LLLL--


DSSP  hhhHHHHhhlllEEEEE-----------------------------lLLLLLLEEEELHH
Query hlyKEGEkagcdALIPK-----------------------------hDYPEPLLAYYAES  133
ident     |                                           |           
Sbjct --gVEIL---tpLFGTLhpgfygssreaftyerrpqsqayipkdegdFYYMGAFFGGSVQ  213
DSSP  --lHHHL---llEEEELllllllllhhhlllllllllllllllllllLLLLLLEEEEEHH


DSSP  H-HHHHHHHHHLLL--------------lLLHHHHHLLLE-EEEEHhhhllllllLHHHL
Query A-ADELERAILQGI--------------rKILVPLERLNV-VYYPVeklrkfdkeLISFF  177
ident                                   | |                       
Sbjct EvQRLTRACHQAMMvdqangieavwhdesHLNKYLLRHKPtKVLSP---------EYLWD  264
DSSP  HhHHHHHHHHHHHHhhhhllllllllhhhHHHHHHHHLLLlEEELH---------HHLLL


DSSP  ----------------LLLLhhHHHHhhhhhhhl
Query ----------------NINTpdDLKRaeeicskx  195
ident                                   
Sbjct qqllgwpavlrklrftAVPK--NHQA----vrnp  292
DSSP  hhhhlllllllllleeELLL--LHHH----hhll


No 75: Query=mol1A Sbjct=1s4nA Z-score=5.8

back to top
DSSP  -----------------LEEEEELLllllllllLHHHleelleeHHHHHHHHHL------
Query -----------------XKVAVLVGgvgrrigxEKTEvxlcgkkLIEWVLEKYS------   37
ident                       ||                                    
Sbjct kttmdyitpsfkagkpkACYVTLVR-------nKELK-------GLLSSIKYVEnkinkk   46
DSSP  llhhhhhhhhlllllllEEEEEELL-------hHHHH-------HHHHHHHHHHhhllll


DSSP  -LLEEEEELlLHHHhHHHHLLLL------LLEELLLLLL---------------------
Query -PFQTVFVCrDEKQaEKLSSRYE------AEFIWDLHKG---------------------   69
ident  |   ||   ||   |               |                            
Sbjct fPYPWVFLN-DEPFtEEFKEAVTkavsseVKFGILPKEHwsypewinqtkaaeiradaat  105
DSSP  lLLLEEEEE-LLLLlHHHHHHHHhhllllEEEEELLHHHllllllllhhhhhhhhhhhll


DSSP  --------------LLHHHhhhHHHHH-----HLLEEEEELLlLLLLhhhhhHHHHHHHH
Query --------------VGSIAgihAALRH-----FGSCVVAAIDxPFVKpevleHLYKEGEK  110
ident                          ||              |             |    
Sbjct kyiyggsesyrhmcRYQSG---FFWRHelleeYDWYWRVEPD-IKLYcdinyDVFKWMQE  161
DSSP  lllllllhhhhhhhHHHHH---LHHHLhhhllLLEEEELLLL-LEELlllllLHHHHHHH


DSSP  HLLLEEEE-ELLL--------------------------------------------LLL
Query AGCDALIP-KHDY--------------------------------------------PEP  125
ident                                                             
Sbjct NEKVYGFTvSIHEyevtiptlwqtsmdfikknpeyldennlmsflsndngktynlchFWS  221
DSSP  LLLLEEELlEEELlhhhlllhhhhhhhhhhhlhhhllllllhhhhlllllllllleeELL


DSSP  LEEEELHHHHHH--hHHHHHLLL-------------lLLHHHHHLL----LEEEEEHhhh
Query LLAYYAESAADE--lERAILQGI-------------rKILVPLERL----NVVYYPVekl  166
ident                                                      |      
Sbjct NFEIANLNLWRSpayREYFDTLDhqggffyerwgdapVHSIAAALFlpkdKIHYFSD---  278
DSSP  LLEEEEHHHHLLhhhHHHHHHHHhhlhhhhllllhhhHHHHHHHHHllhhHEEELLL---


DSSP  lllllllHHHLLL------------------------------------llhhhhhhhhh
Query rkfdkelISFFNI------------------------------------ntpddlkraee  190
ident                                                             
Sbjct ------iGYHHPPydncpldkevynsnncecdqgndftfqgyscgkeyydaqglvkpknw  332
DSSP  ------lLEEELLeeellllhhhhhhllllllhhhlllllllllhhhhhhhhlllllllh


DSSP  hhhhl
Query icskx  195
ident      
Sbjct kkfre  337
DSSP  hhhhl


No 76: Query=mol1A Sbjct=2agdA Z-score=5.6

back to top
DSSP  ----------------------------------------------------LEEEEELL
Query ----------------------------------------------------XKVAVLVG    8
ident                                                             
Sbjct slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkVAIIIPFR   60
DSSP  lllllllllllllllllllllllllhhhhhhhlllllllleellllllllleEEEEEEEL


DSSP  llllllllLHHHleelleeHHHHHHHHHLL--------LEEEEELLLHHhhhhhhlllll
Query gvgrrigxEKTEvxlcgkkLIEWVLEKYSP--------FQTVFVCRDEKqaeklssryea   60
ident            |            |    |                              
Sbjct --------NRQE-------HLKYWLYYLHPvlqrqqldYGIYVINQAGD-----------   94
DSSP  --------LLHH-------HHHHHHHHHHHhhhhllleEEEEEEEELLL-----------


DSSP  leellllllLLHHHHHHHHHHHH------lLEEEEELLLLlLLHHhhHHHHhhHHHHlll
Query efiwdlhkgVGSIAGIHAALRHF------gSCVVAAIDXPfVKPEvlEHLYkeGEKAgcd  114
ident                                 |    |                      
Sbjct -------tiFNRAKLLNVGFQEAlkdydytCFVFSDVDLI-PMND-hNAYR--CFSQ---  140
DSSP  -------llLLHHHHHHHHHHHHhhhllllEEEEELLLEE-ELLL-lLLLL--LLLL---


DSSP  EEEE----------ELLL-LLLLEEEELHHHH---HHHHHHHhllLLLL-HHHHHLL---
Query ALIP----------KHDY-PEPLLAYYAESAA---DELERAIlqgIRKI-LVPLERL---  156
ident                                                        ||   
Sbjct PRHIsvamdkfgfsLPYVqYFGGVSALSKQQFltiNGFPNNY-wgWGGEdDDIFNRLvfr  199
DSSP  LEELlleehhhlllLLLLlLLLLEEEEEHHHHhhlLLLLLLL-llLLLHhHHHHHHHhhl


DSSP  -LEEEEEhhHHLLLLlllhHHLLLLLH---------------------------------
Query -NVVYYPveKLRKFDkeliSFFNINTP---------------------------------  182
ident       |                                                     
Sbjct gMSISRP--NAVVGT----TRHIRHSRdkknepnpqrfdriahtketmlsdglnsltyqv  253
DSSP  lLLLLLL--LLLLLE----EEELLLLLlllllllllhhhhhllhhhhlllllhhhlllee


DSSP  -------hhhhhhhhhhhhl
Query -------ddlkraeeicskx  195
ident                     
Sbjct ldvqryplytqitvdigtps  273
DSSP  eeeeelllleeeeeelllll


No 77: Query=mol1A Sbjct=2wzfA Z-score=5.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lsklrmrffsalnhtseidlqvlfndlksiltldsiehlkegsvayaiiqellkqddaqn   60
DSSP  lhhhhhhhhhhllllllllhhhhhhhhlllllhhhhhhhllllhhhhhhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kiqsflhgaiknvihpgvikgltpdeinwnvakaypkyyeheefpdvtfggfkvrdsnef  120
DSSP  hhhhhhhhhhhhlhhhhhhhlllhhhhhhhhhhhllllllllllllleelleelllllle


DSSP  ----LEEEEElLLLLLlllLLHHhleelleEHHHHHHHHHL----LLEEEEELlLHHH--
Query ----XKVAVLvGGVGRrigXEKTevxlcgkKLIEWVLEKYS----PFQTVFVCrDEKQ--   50
ident                                     |                       
Sbjct kfktNIQTSI-WFSIK-pdLFMP-------SKQQEALKRRReqypGCEIRLIY-SSSLln  170
DSSP  eeelLEEEEE-LLLLL-llLLLL-------HHHHHHHHHHHhhllLLEEEEEE-LHHHll


DSSP  ---hhHHHLLLL---LLEELL--------lLLLL---------------LHHHHHHHhHH
Query ---aeKLSSRYE---AEFIWD--------lHKGV---------------GSIAGIHAaLR   81
ident                   |                               |         
Sbjct aeanrQMKAFARkqnISLIDIdsvktdsplYPLLkaelahlgkggnpaaASDLCRWI-PE  229
DSSP  hhhhhHHHHHHHhhlLEEEEHhhllllllhHHHHhhhhhlllllllhhhHHHHHLLL-LL


DSSP  HHLLEEEEELllllLLHHhhhhhhhhhHHHLLLEEEEELL----------------LLLL
Query HFGSCVVAAIdxpfVKPEvlehlykegEKAGCDALIPKHD----------------YPEP  125
ident  |       |                    |                             
Sbjct LFNEGFYVDI---dLPVDsskiveghqITGGVPIMLNMGSiisepiaphhrrqeavCMNT  286
DSSP  LLLLEEEELL---lLLLLhhhllllleEEELLLEEEEEEEeelllllllllleeeeEEEE


DSSP  LEEEEL-----hHHHHHHHHHHHLLL----------------------------------
Query LLAYYA-----eSAADELERAILQGI----------------------------------  146
ident     |          |   |                                        
Sbjct DIIAYSndkrtqKMMDTVARYLKNIYddpytalkdtplaqtaffnkcqeerksifdlrkg  346
DSSP  EEEEELlllhhhHHHHHHHHHHHHHHhlhhhhllllhhhhlhhhhhhhhhlllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  146
ident                                                             
Sbjct lqdafrsdsllqlydflgadkfkevfklkeaqskyinehisefsekdlllnlisdkpsei  406
DSSP  hhhhhhlllhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhllhhhhhhhhhlllllll


DSSP  --------------------------------LLLH-HHHHLL-----------------
Query --------------------------------RKIL-VPLERL-----------------  156
ident                                           |                 
Sbjct sqhtldfvkakamyidiakehysafykplveeISGPgAIYNALggagsfttthrrltgpm  466
DSSP  llllllhhhhhhhhhhhhhllhhhhhlhhhhlLLLHhHHHHHLlllhhheeellllllll


DSSP  ----------leEEEEHhhhlllllllhHHLL-------------------LLLHHhhhh
Query ----------nvVYYPVeklrkfdkeliSFFN-------------------INTPDdlkr  187
ident                                |                      |     
Sbjct lpttpprvlqvfCDAHD-------kgpfVSDNiarwqtnvrdlgvlnreglSWLPS----  515
DSSP  llllhhhhhhhhLLHHH-------hlllLLLLllllleehhhlllllllllLLLLL----


DSSP  hhhhhhhl
Query aeeicskx  195
ident         
Sbjct --------  515
DSSP  --------


No 78: Query=mol1A Sbjct=2wzgA Z-score=5.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snelsklrmrffsalnhtseidlhtlfdnlksnltlgsiehlqegsvtyaiiqellkgad   60
DSSP  lhhhhhhhhhhhhhllllllllhhhhhhhhhhhllhhhhhhhllllhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aqkkiesflkgaiknvihpgvikgltpneinwnvakaypeyyeheklpdvtfggfkvrds  120
DSSP  hhhhhhhhhhhhhhhlhhhhhhhlllhhhhhhhhhhhllllllllllllleelleellll


DSSP  -------LEEEEELlLLLLllLLLHHhleelleEHHHHHHHHHL----LLEEEEELL---
Query -------XKVAVLVgGVGRriGXEKTevxlcgkKLIEWVLEKYS----PFQTVFVCR---   46
ident                                        |                    
Sbjct nefkfktNVQTSIW-FSIK-pELFMP-------SKQQEALKRRReqypGCKIRLIYSssl  171
DSSP  lleeeelLEEEEEL-LLLL-lLLLLL-------HHHHHHHHHHHhhllLLEEEEEELhhh


DSSP  -lhhhhHHHHLLLL---LLEEL--------llLLLL---------------LHHHHHHHh
Query -dekqaEKLSSRYE---AEFIW--------dlHKGV---------------GSIAGIHAa   79
ident                     |                               |       
Sbjct lnpeanRQMKAFAKkqnISLIDidsvktdsplYPLIkaelanlgmggnpaaASDLCRWI-  230
DSSP  llhhhhHHHHHHHHhhlLEEEEhhhllllllhHHHHhhhhhlllllllhhhHHHHHLLL-


DSSP  HHHHLLEEEEELlllLLLHHhhhhhhhhhHHHLLLEEEEELL----------------LL
Query LRHFGSCVVAAIdxpFVKPEvlehlykegEKAGCDALIPKHD----------------YP  123
ident    |       |                    |                           
Sbjct PELFNEGFYVDI---DLPVDsskiveghqITGGVPIMLNMGSiisepiaphhrrqeavCM  287
DSSP  LLLLLLEEEELL---LLLLLhhhllllleEEELLLEEEEEEEeelllllllllleeeeEE


DSSP  LLLEEEEL-----HHHHHHHHHHHHLLL--------------------------------
Query EPLLAYYA-----ESAADELERAILQGI--------------------------------  146
ident       ||         |                                          
Sbjct NTDIIAYAndretQVMMDTVALHLKNIYddpytalkdtplaqtaffnrceeegknifelr  347
DSSP  EEEEEEELllhhhHHHHHHHHHHHHHHHhlhhhhllllhhhhlhhhhhhhhhlllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  146
ident                                                             
Sbjct kglqdafrsdsllelyvflgpakfkevfklketqikyiddhisefnehdlllhlisdnld  407
DSSP  hhhhhhhhlllhhhhhhhhlhhhhhhhllllhhhhhhhhhhhhhllhhhhhhhhhhllll


DSSP  ------------------------------lLLHHHHH----------------------
Query ------------------------------rKILVPLE----------------------  154
ident                                 |   |                       
Sbjct fgrakvmymdiakehysafykplveeisgpgAIYNALGgasnfttthrrstgpmlpttpp  467
DSSP  hhhhhhhhhhhhhllhhhhhlhhhhllllhhHHHHHLLhhhhleeellllllllllllhh


DSSP  --llleEEEEHhhhlllllllhHHLL-----------LLLHHhhhhhhhhhhhl
Query --rlnvVYYPVeklrkfdkeliSFFN-----------INTPDdlkraeeicskx  195
ident                          |              |             
Sbjct rvlqvfCDAHD-------kgpfVSDNiarwqtnvrelSWLPS------------  502
DSSP  hhhhhhLLHHH-------hlllLLLLllllleellllLLLLL------------


No 79: Query=mol1A Sbjct=1zi4A Z-score=5.5

back to top
DSSP  -------------------------------------------------------LEEEE
Query -------------------------------------------------------XKVAV    5
ident                                                            |
Sbjct efmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttIGLTV   60
DSSP  llllllllllllllllllllllllllllllllleellllllhhhhhhhhhlllleEEEEE


DSSP  ELLllllllllLHHHleelleeHHHHHHHHHL-------LLEEEEELLlhhHHHHHhLLL
Query LVGgvgrrigxEKTEvxlcgkkLIEWVLEKYS-------PFQTVFVCRdekQAEKLsSRY   58
ident                            ||                      |      | 
Sbjct FAI-------kKYVA-------FLKLFLETAEkhfmvghRVHYYVFTD---QPAAV-PRV  102
DSSP  EEL-------hHHHH-------HHHHHHHHHHhhlllllEEEEEEEEL---LHHHL-LLL


DSSP  L------LLEELLllllllhhhhhhhhhHHHL----LEEEEELLLLLllhHHHHHhhHHH
Query E------AEFIWDlhkgvgsiagihaalRHFG----SCVVAAIDXPFvkpEVLEHlyKEG  108
ident                             | |       |    |  |    |        
Sbjct TlgtgrqLSVLEV--------------eRRFLsevdYLVCVDVDMEF-rdHVGVE--ILT  145
DSSP  LlllleeEEEEEL--------------lHHHHhhllEEEEELLLEEE-llLLLHH--HLL


DSSP  HhhlllEEEEELL-----------------------------LLLLLEEEE----LHHHH
Query EkagcdALIPKHD-----------------------------YPEPLLAYY----AESAA  135
ident            |                              |                 
Sbjct P-----LFGTLHPgfygssreaftyerrpqsqayipkdegdfYYLGGFFGGsvqeVQRLT  200
DSSP  L-----EEEELLLllllllhhhllllllllllllllllllllLLLLLEEEEehhhHHHHH


DSSP  HHHHHHHHLL-----------llLLHHHHHLLLE-EEEEHH--------hhllllLLLHH
Query DELERAILQG-----------irKILVPLERLNV-VYYPVE--------klrkfdKELIS  175
ident      |                      | |         |                |  
Sbjct RACHQAMMVDqangieavwhdesHLNKYLLRHKPtKVLSPEylwdqqllgwpavlRKLRF  260
DSSP  HHHHHHHHHHhhlllllllhhhhHHHHHHHHLLLlEEELHHhlllhhhhllllllLLLLE


DSSP  hLLLLlhhhhhhhhhhhhhl
Query fFNINtpddlkraeeicskx  195
ident                     
Sbjct -TAVP---------------  264
DSSP  -EELL---------------


No 80: Query=mol1A Sbjct=1fgxB Z-score=5.4

back to top
DSSP  ----------------------------------------------------LEEEEELL
Query ----------------------------------------------------XKVAVLVG    8
ident                                                             
Sbjct sltacpeespllvgpmliefnipvdlklieqqnpkvklggrytpmdcisphkVAIIIPFR   60
DSSP  lllllllllllllllllllllllllhhhhhhhlllllllleellllllllleEEEEEEEL


DSSP  llllllllLHHHleelleeHHHHHHHHHLL--------LEEEEELLLHHhhhhhhlllll
Query gvgrrigxEKTEvxlcgkkLIEWVLEKYSP--------FQTVFVCRDEKqaeklssryea   60
ident            |            |    |                              
Sbjct --------NRQE-------HLKYWLYYLHPilqrqqldYGIYVINQAGE-----------   94
DSSP  --------LLHH-------HHHHHHHHHHHhhhhhlleEEEEEEEELLL-----------


DSSP  leellllllLLHHHHHHHHHHHHL------LEEEEELLLlLLLHHhhHHHHhhHHHH---
Query efiwdlhkgVGSIAGIHAALRHFG------SCVVAAIDXpFVKPEvlEHLYkeGEKA---  111
ident                                 |    |                      
Sbjct -------smFNRAKLLNVGFKEALkdydynCFVFSDVDL-IPMND-hNTYR--CFSQprh  143
DSSP  -------llLLHHHHHHHHHHHHHhhllllEEEEELLLE-EELLL-lLLLL--LLLLlee


DSSP  ----llleeeeELLL-LLLLEEEELHHHH---HHHHhhHHLL-LLLL-HHHHHLLL---E
Query ----gcdalipKHDY-PEPLLAYYAESAA---DELEraILQG-IRKI-LVPLERLN---V  158
ident                                                      ||     
Sbjct isvamdkfgfsLPYVqYFGGVSALSKQQFlsiNGFP--NNYWgWGGEdDDIYNRLAfrgM  201
DSSP  llleehhhlllLLLLlLLLLEEEEEHHHHhhlLLLL--LLLLlLLLHhHHHHHHHHhllL


DSSP  EEEEhhHHLLLLlllHHHLLLllhhhHHHHHHH---------------------------
Query VYYPveKLRKFDkelISFFNIntpddLKRAEEI---------------------------  191
ident                             |                               
Sbjct SVSR--PNAVIG---KCRMIR-----HSRDKKNepnpqrfdriahtketmlsdglnslty  251
DSSP  LLLL--LLLLLL---EEEELL-----LLLLLLLlllllllllhhhhhhhlllllhhhlll


DSSP  ------------------hhhl
Query ------------------cskx  195
ident                       
Sbjct mvlevqryplytkitvdigtps  273
DSSP  eeeeeeelllleeeeeelllll


No 81: Query=mol1A Sbjct=2nxvA Z-score=4.2

back to top
DSSP  ---------------lEEEEELLLlllllllLHHHleelleeHHHHHHHHHLL-----lE
Query ---------------xKVAVLVGGvgrrigxEKTEvxlcgkkLIEWVLEKYSP-----fQ   40
ident                    |                           ||           
Sbjct mkpvptyvqdkdestlMFSVCSLV-------RDQA-------KYDRLLESFERfgftpdK   46
DSSP  llllleeellllllllLEEEEEEE-------LLHH-------HHHHHHHHHHHllllllL


DSSP  EEEELLLhhhhhhhhlllllleellllllLLHHHHHHHHhhHHLLEEEEELLLLlLLHHH
Query TVFVCRDekqaeklssryeaefiwdlhkgVGSIAGIHAAlrHFGSCVVAAIDXPfVKPEV  100
ident   |   |                                            |        
Sbjct AEFLAAD------------nregnqfhgfSWHKQMLPRC--KGRYVIFCHEDVE-LVDRG   91
DSSP  EEEEEEE------------llllllllllLHHHHHHHHL--LLLEEEEEELLEE-LLLLL


DSSP  HHHHHHHHHHHL-----LLEEEEELL----------------------------------
Query LEHLYKEGEKAG-----CDALIPKHD----------------------------------  121
ident    |    |                                                   
Sbjct YDDLVAAIEALEeadpkWLVAGVAGSpwrplnhsvtaqalhisdvfgndrrrgnvpcrve  151
DSSP  HHHHHHHHHHHHhhlllEEEEELEEEellllllllllleeeeeelleeeeeelllleeee


DSSP  LLLLLEEEELHHHHhHHHHhhHLLL------lLLHHHHH--LLLEEEEEhhhhlllllll
Query YPEPLLAYYAESAAdELERaiLQGI------rKILVPLE--RLNVVYYPveklrkfdkel  173
ident                 |                     |                     
Sbjct SLDECFLLMRRLKP-VLNS--YDMQgfhyygaDLCLQAEflGGRAYAID----------f  198
DSSP  EELLLEEEEELLLL-LLLL--LLLLllllhhhHHHHHHHhlLLEEEELL----------l


DSSP  hHHLLLLLH-----------------------------hhhhhhhhhhhhl
Query iSFFNINTP-----------------------------ddlkraeeicskx  195
ident                                                    
Sbjct hLHHYGRAIadenfhrlrqemaqkyrrwfpgrilhcvtgrvalgggwyear  249
DSSP  lLEELLLLLllhhhhhhhhhhhhhhllllllleeeelleeeelllhhhhll


No 82: Query=mol1A Sbjct=2e28A Z-score=4.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mkrktkivstigpasesvdklvqlmeagmnvarlnfshgdheehgrrianireaakrtgr   60
DSSP  llllleeeeelllllllhhhhhhhhhhleeeeeeelllllhhhhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tvailldtkgpeirthnmengaielkegsklvismsevlgtpekisvtypsliddvsvga  120
DSSP  lleeeeelllllllllllllllllllllleeeeellllllllleeellllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct killddglislevnavdkqageivttvlnggvlknkkgvnvpgvkvnlpgitekdradil  180
DSSP  eeeelllleeeeeeeeelllleeeeelllllllllllleellllllllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct fgirqgidfiaasfvrrasdvleirelleahdalhiqiiakieneegvanideileaadg  240
DSSP  hhhhhllleeeelllllhhhhhhhhhhhhhlllllleeeeeellhhhhhlhhhhhhhlle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lmvargdlgveipaeevpliqkllikksnmlgkpvitatqmldsmqrnprptraeasdva  300
DSSP  eeeehhhhhhhllhhhhhhhhhhhhhhhhhhllleeeellllhhhhllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct naifdgtdavmlsgetaagqypveavktmhqialrteqalehrdilsqrtkesqttitda  360
DSSP  hhhhhllleeeelhhhhllllhhhhhhhhhhhhhhhhllllhhhhhhhhhllllllhhhh


DSSP  --------------LEEEEELLLllllllllhhhleelleehhHHHHHHhLLLEEEEELL
Query --------------XKVAVLVGGvgrrigxektevxlcgkkliEWVLEKySPFQTVFVCR   46
ident                                              |           |  
Sbjct igqsvahtalnldvAAIVTPTVS----------------gktpQMVAKYrPKAPIIAVTS  404
DSSP  hhhhhhhhhhhlllLEEEEELLL----------------lhhhHHHHHLlLLLLEEEEEL


DSSP  LHHHHHHHhLLLL-LLEELLLlLLLLHHHHHHHHHHHHL---------LEEEEE------
Query DEKQAEKLsSRYE-AEFIWDLhKGVGSIAGIHAALRHFG---------SCVVAA------   90
ident  |     |                         |                |  |      
Sbjct NEAVSRRL-ALVWgVYTKEAP-HVNTTDEMLDVAVDAAVrsglvkhgdLVVITAgvpvge  462
DSSP  LHHHHHHH-HHLLlEEEEELL-LLLLHHHHHHHHHHHHHhhlllllllEEEEEEllllll


DSSP  lLLLLllhhhhhhhhhhhhhhllleeeeellllllLEEEELHH-----------------
Query iDXPFvkpevlehlykegekagcdalipkhdypepLLAYYAES-----------------  133
ident                                    |      |                 
Sbjct tGSTN------------------------------LMKVHVISdllakgqgigrksafgk  492
DSSP  lLLLL------------------------------EEEEEELLleeeeleeellleelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  133
ident                                                             
Sbjct avvaktaeearqkmvdggilvtvstdadmmpaiekaaaiiteeggltshaavvglslgip  552
DSSP  eeelllhhhhhhhllllleeeellllhhhhhhhlllleeeelllllllhhhhhhhhhlll


DSSP  -----hhhhhhhhhhllllllhhhhHLLLeeeeehhhhlllllllhhhlllllhhhhhhh
Query -----aadelerailqgirkilvplERLNvvyypveklrkfdkelisffnintpddlkra  188
ident                                                             
Sbjct vivgvenattlfkdgqeitvdggfgAVYR-------------------------------  581
DSSP  eeellllhhhhlllllleeeellllEEEE-------------------------------


DSSP  hhhhhhl
Query eeicskx  195
ident        
Sbjct -ghasvl  587
DSSP  -llllll


No 83: Query=mol1A Sbjct=2j4kC Z-score=3.9

back to top
DSSP  LEEEEELlllllllllLHHHLEellEEHHHHHHHHHLL-----LEEEEELL---------
Query XKVAVLVggvgrrigxEKTEVXlcgKKLIEWVLEKYSP-----FQTVFVCR---------   46
ident                                            |    |           
Sbjct MNIILKI-------sgKFFDED--nVDNLIVLRQSIKEladngFRVGIVTGggstarryi   51
DSSP  LEEEEEE-------lhHHHLLL--hHHHHHHHHHHHHHhhhllLEEEEEELlhhhhhhhh


DSSP  --------------------LHHHHHHHHLLLL----------------------lLEEL
Query --------------------DEKQAEKLSSRYE----------------------aEFIW   64
ident                         |                                   
Sbjct klareigigeayldllgiwaSRLNAYLVMFSLQdlaymhvpqsleefiqdwshgkvVVTG  111
DSSP  hhhhhllllhhhhhhhhhhhHHHHHHHHHHLLLllllllllllhhhhhhhhlllllEEEL


DSSP  LLL-lLLLHHHHHHHHHHhHLLEEEEELL-------------------------------
Query DLH-kGVGSIAGIHAALRhFGSCVVAAID-------------------------------   92
ident                |     |                                      
Sbjct GFQpgQSTAAVAALVAEA-SSSKTLVVATnvdgvyekdpriyiphlttqdlrlldplaik  170
DSSP  LLLllLLHHHHHHHHHHH-LLLLEEEEEEllllllllllllllleeehhhhllllhhhhh


DSSP  -------------LLLL-LHHHHHHHhhhhhhhllleEEEELlllllleeeelhhhhhhh
Query -------------XPFV-KPEVLEHLykegekagcdaLIPKHdypepllayyaesaadel  138
ident                                       |                     
Sbjct iverskirvivmnYRKLnRIIDILKG------eevssIIEPV------------------  206
DSSP  hhhhllleeeeeeHHHHhHHHHHHHL------lllleEEELL------------------


DSSP  hhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query erailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                                          
Sbjct ---------------------------------------------------------  206
DSSP  ---------------------------------------------------------


No 84: Query=mol1A Sbjct=3fwzA Z-score=3.9

back to top
DSSP  -------LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHH
Query -------XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQA   51
ident                                         ||        |         
Sbjct snavdicNHALLVG-----------------ygRVGSLLGEKLLasDIPLVVIETSRTRV   43
DSSP  lllllllLLEEEEL-----------------llHHHHHHHHHHHhlLLLEEEEELLHHHH


DSSP  HHHHLlLLLLEELLlllllLHHHhhHHHHHHH-LLEE-EEELLlllllhhhhhhhhhhhh
Query EKLSSrYEAEFIWDlhkgvGSIAgiHAALRHF-GSCV-VAAIDxpfvkpevlehlykege  109
ident   |                                                         
Sbjct DELRE-RGVRAVLG-----NAAN-eEIXQLAHlECAKwLILTI------pngyeageiva   90
DSSP  HHHHH-LLLEEEEL-----LLLL-hHHHHHLLhHHLLeEEELL------llhhhhhhhhh


DSSP  hhlLLEEE--------------eelLLLLlleeeelhhhhhhhhhhhhllllllhhhhhl
Query kagCDALI--------------pkhDYPEpllayyaesaadelerailqgirkilvpler  155
ident                                                             
Sbjct sarAKNPDieiiarahyddevayitERGA-------------------------------  119
DSSP  hhhHHLLLleeeeeellhhhhhhhhHLLL-------------------------------


DSSP  lleeeeehhhhlllllllhHHLLlllhhhHHHHHHHHHH-----l
Query lnvvyypveklrkfdkeliSFFNintpddLKRAEEICSK-----x  195
ident                                |             
Sbjct ------------------nQVVX------GEREIARTXLelletp  140
DSSP  ------------------lEEEE------HHHHHHHHHHhhhhll


No 85: Query=mol1A Sbjct=1lssA Z-score=3.9

back to top
DSSP  LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHHHHHHLLL
Query XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQAEKLSSRY   58
ident                                     |      |    |     | |   
Sbjct MYIIIAG-----------------igRVGYTLAKSLSekGHDIVLIDIDKDICKKASAEI   43
DSSP  LEEEEEL-----------------llHHHHHHHHHHHhlLLEEEEEELLHHHHHHHHHHL


DSSP  LLLEELLlllllLHHHhhHHHHHHH-LLEE-EEELllllllhhhhhhhhhhhhhhlLLEE
Query EAEFIWDlhkgvGSIAgiHAALRHF-GSCV-VAAIdxpfvkpevlehlykegekagCDAL  116
ident  |  |                            |                          
Sbjct DALVING-----DCTK-iKTLEDAGiEDADmYIAV------tgkeevnlmssllakSYGI   91
DSSP  LLEEEEL-----LLLL-hHHHHHLLlLLLLeEEEL------lllhhhhhhhhhhhhHLLL


DSSP  E-------------eELLLLLLleeeelhhhhhhhhhhhhllllllhhhhhllleeeeeh
Query I-------------pKHDYPEPllayyaesaadelerailqgirkilvplerlnvvyypv  163
ident                                                             
Sbjct NktiariseieykdvFERLGVD--------------------------------------  113
DSSP  LleeeelllllhhhhHHHLLLL--------------------------------------


DSSP  hhhlllllllhhHLLLLLhhHHHHHHH-hhhhl
Query eklrkfdkelisFFNINTpdDLKRAEE-icskx  195
ident                                  
Sbjct ------------VVVSPE--LIAANYIeklier  132
DSSP  ------------EEELHH--HHHHHHHhhhhll


No 86: Query=mol1A Sbjct=1lixB Z-score=3.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar   60
DSSP  llllhhhhllllhhhhhhhllllllllllllleeeeellhhhllhhhhhhhhhlllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgivlvtantvdy  120
DSSP  eelllllhhhhhhhhhhhhhhhhlllllllllllleeeeellllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pniviyiddglislvvvtvenggvkgvnlplpglseqdvrdlrfgvehgvdivfasfvrk  180
DSSP  hhhlleelllleellllllllllllleelllllllhhhhhhhhhhhhhllleeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct asdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvf  240
DSSP  hhhhhhhhhhhlhhhllleeeeeellhhhhhhhhhhhhhlleeeeehhhhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct laqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetak  300
DSSP  hhhhhhhhhhhhhllleeeelllllhhhhlllllhhhhhhhhhhhhhllleeeelhhhhl


DSSP  ----------------------------------------------------------LE
Query ----------------------------------------------------------XK    2
ident                                                             
Sbjct gnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaAA  360
DSSP  lllhhhhhhhhhhhhhhhhhlllhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhllLE


DSSP  EEEELLlllllllllhhhleelleeHHHHHHHHhLLLEEEEELLLHHHHHHHHlLLLL-L
Query VAVLVGgvgrrigxektevxlcgkkLIEWVLEKySPFQTVFVCRDEKQAEKLSsRYEA-E   61
ident   ||                                     | |    |           
Sbjct IIVLTT----------------tgrSAQLLSWYrPRAAVIAVTRSAQAARQVH-LCRGvF  403
DSSP  EEEELL----------------llhHHHHHHLLlLLLEEEEEELLLLHHHHHH-HLLLeE


DSSP  EELLLL-----lllLHHHHHHHHHHHHL---------LEEEEE-----lLLLLllhhhhh
Query FIWDLH-----kgvGSIAGIHAALRHFG---------SCVVAA-----iDXPFvkpevle  102
ident                                         |                   
Sbjct PLLYREppeaiwadDVDRRVQFGIESGKlrgflrvgdLVIVVTgwrpgsGYTN-------  456
DSSP  EEELLLlllllhhhHHHHHHHHHHHHHHhhlllllllEEEEEEelllllLLEE-------


DSSP  hhhhhhhhhllleeeeellllllLEEEELHhhhhhhhhhhhllllllhhhhhllleeeee
Query hlykegekagcdalipkhdypepLLAYYAEsaadelerailqgirkilvplerlnvvyyp  162
ident                                                             
Sbjct -----------------------IMRVLSI------------------------------  463
DSSP  -----------------------EEEEEEL------------------------------


DSSP  hhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query veklrkfdkelisffnintpddlkraeeicskx  195
ident                                  
Sbjct ---------------------------------  463
DSSP  ---------------------------------


No 87: Query=mol1A Sbjct=1pklG Z-score=3.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh   60
DSSP  lhhhhhhhllllllllllllleeeeellhhhllhhhhhhhhhhleeeeeeelllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt  120
DSSP  hhhhhhhhhhhhhhlllleeeeelllllllllllllleeeelllleeeeellhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp  180
DSSP  lleeelllllhhhhllllleeeelllleeeeeeeelllleeeeeellleeeelllleell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie  240
DSSP  llllllllllhhhhhhhhhhhhhllleeeelllllhhhhhhhhhhhlhhhllleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle  300
DSSP  lhhhhhlhhhhhhhlleeeelhhhhhhhllhhhhhhhhhhhhhhhhhhllleeelllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney  360
DSSP  hhhllllllhhhhhhhhhhhhhllleeeelhhhhllllhhhhhhhhhhhhhhhhhhllhh


DSSP  ---------------------------------LEEEEELLlllllllllhhhleellee
Query ---------------------------------XKVAVLVGgvgrrigxektevxlcgkk   27
ident                                      ||                     
Sbjct vffnsikklqhipmsadeavcssavnsvyetkaKAMVVLSN----------------tgr  404
DSSP  hhhhhhhhhllllllhhhhhhhhhhhhhhhhllLLEEEELL----------------llh


DSSP  hHHHHHHHhLLLEEEEELLLHHHHHHHHlLLLL-LEELLLL----lLLLHHHHHHHHHHH
Query lIEWVLEKySPFQTVFVCRDEKQAEKLSsRYEA-EFIWDLH----kGVGSIAGIHAALRH   82
ident     |         | |         |       |             |      |    
Sbjct sARLVAKYrPNCPIVCVTTRLQTCRQLN-ITQGvESVFFDAdklghDEGKEHRVAAGVEF  463
DSSP  hHHHHHHLlLLLLEEEEELLHHHHHHHH-HLLLeEEEELLLlllllLLLLHHHHHHHHHH


DSSP  HL---------LEEEEELLlllllhhhhhhhhhhhhhhllleeeeellllllLEEEELHH
Query FG---------SCVVAAIDxpfvkpevlehlykegekagcdalipkhdypepLLAYYAES  133
ident             |||   |                                         
Sbjct AKskgyvqtgdYCVVIHAD-------------------------hkvkgyanQTRILLVE  498
DSSP  HHhllllllllEEEEELLL-------------------------llllllllLLEEEELL


DSSP  hhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhh
Query aadelerailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeics  193
ident                                                             
Sbjct ------------------------------------------------------------  498
DSSP  ------------------------------------------------------------


DSSP  hl
Query kx  195
ident   
Sbjct --  498
DSSP  --


No 88: Query=mol1A Sbjct=3d4oB Z-score=3.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gxltgkhvviiggdarqleiirklstfdakislvgfdqldgfigvtkxridevdwntvda   60
DSSP  lllllleeeeelllhhhhhhhhhhhhllleeeeelllllllllleeeelhhhllhhhlle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct illpisgtneagkvdtifsnesivlteexiektpnhcvvysgisntylnqcxkktnrtlv  120
DSSP  eellllllllllllllllllllllllhhhhhlllllleeeellllhhhhhhhhhhlleee


DSSP  ----------------------------------LEEEEELllllllllllhhhleelle
Query ----------------------------------XKVAVLVggvgrrigxektevxlcgk   26
ident                                     ||||                    
Sbjct klxerddiaiynsiptaegtixxaiqhtdftihgANVAVLG-----------------lg  163
DSSP  ehhhlhhhhhhhhhhhhhhhhhhhhhhlllllllLEEEEEL-----------------ll


DSSP  EHHHHHHHHHL--LLEEEEELLLHHHHHHHHlLLLLLEELLLlllllhhhhhhHHHHHHL
Query KLIEWVLEKYS--PFQTVFVCRDEKQAEKLSsRYEAEFIWDLhkgvgsiagihAALRHFG   84
ident      |  |            |              |                 |     
Sbjct RVGXSVARKFAalGAKVKVGARESDLLARIA-EXGXEPFHIS-----------KAAQELR  211
DSSP  HHHHHHHHHHHhlLLEEEEEELLHHHHHHHH-HLLLEEEEHH-----------HHHHHLL


DSSP  LE-EEEELllllllhhhhhhhhhhhhhhllleeeeellllllleeeelHHHH----hhhh
Query SC-VVAAIdxpfvkpevlehlykegekagcdalipkhdypepllayyaESAA----dele  139
ident    |                                              |         
Sbjct DVdVCINT-------------------------------ipalvvtanVLAExpshtfvi  240
DSSP  LLlEEEEL-------------------------------lllllllhhHHHHllllleee


DSSP  hhhhlllllLHHHHHLLLEeeeehhhhlllllllhhHLLLllhhHHHHHHH-HHHHL---
Query railqgirkILVPLERLNVvyypveklrkfdkelisFFNIntpdDLKRAEE-ICSKX---  195
ident               |                                             
Sbjct dlaskpggtDFRYAEKRGI--------------kalLVPG----LPGIVAPkTAGRIlad  282
DSSP  ellllllllLHHHHHHLLL--------------eeeELLL----HHHHHLHhHHHHHhhh


DSSP  ---------
Query ---------  195
ident          
Sbjct vlvkllaep  291
DSSP  hhhhhhhll


No 89: Query=mol1A Sbjct=2j4jF Z-score=3.5

back to top
DSSP  LEEEEELLLLlllllllHHHLeellEEHHHHHHHHHLL-----LEEEEELL---------
Query XKVAVLVGGVgrrigxeKTEVxlcgKKLIEWVLEKYSP-----FQTVFVCR---------   46
ident         |                                  |    |           
Sbjct MNIILKISGK-------FFDE--dnVDNLIVLRQSIKEladngFRVGIVTGggstarryi   51
DSSP  LEEEEEELLH-------HHHL--llHHHHHHHHHHHHHhhhllLEEEEEELlhhhhhhhh


DSSP  --------------------LHHHHHHHHLLLL----------------------lLEEL
Query --------------------DEKQAEKLSSRYE----------------------aEFIW   64
ident                         |                                   
Sbjct klareigigeayldllgiwaSRLNAYLVMFSLQdlaymhvpqsleefiqdwshgkvVVTG  111
DSSP  hhhhhllllhhhhhhhhhhhHHHHHHHHHHHHHhhllllllllhhhhhhhhlllllEEEL


DSSP  LLL-lLLLHHHHHHHHHHhHLLEEEEELL-------------------------------
Query DLH-kGVGSIAGIHAALRhFGSCVVAAID-------------------------------   92
ident                |     |                                      
Sbjct GFQpgQSTAAVAALVAEA-SSSKTLVVATnvdgvyekdpriyadvkliphlttqdlrkil  170
DSSP  LLLllLLHHHHHHHHHHH-LLLLEEEEEElllleellllllllllleeleeehhhhhhhh


DSSP  ---------------------------------LLLL--LHHHHHHhhhhhhhhllleEE
Query ---------------------------------XPFV--KPEVLEHlykegekagcdaLI  117
ident                                            |               |
Sbjct egsqsvqagtyelldplaikiverskirvivmnYRKLnrIIDILKG-------eevssII  223
DSSP  lllllllllllllllhhhhhhhhhllleeeeeeHHHHhhHHHHHLL-------lllleEE


DSSP  EELlllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhl
Query PKHdypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkelisff  177
ident                                                             
Sbjct EPV---------------------------------------------------------  226
DSSP  ELL---------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhl
Query nintpddlkraeeicskx  195
ident                   
Sbjct ------------------  226
DSSP  ------------------


No 90: Query=mol1A Sbjct=3hbnA Z-score=3.5

back to top
DSSP  LEEEEELLlllllllLLHHhleelleEHHHHHHHHHLLL-EEEEELlLHHHhhHHHLLLL
Query XKVAVLVGgvgrrigXEKTevxlcgkKLIEWVLEKYSPF-QTVFVCrDEKQaeKLSSRYE   59
ident |||                         |   |          | |        |     
Sbjct XKVLFRSD----sssQIGF-------GHIKRDLVLAKQYsDVSFAC-LPLE-gSLIDEIP   47
DSSP  LEEEEEEL----lllLLLL-------HHHHHHHHHHLLLlEEEEEE-LLLL-lLLHHHLL


DSSP  LLEELLllLLLLHHHHHHHHHHhHLLEEEEELLlllllhhhhhhhhhhhhhhLLLE----
Query AEFIWDlhKGVGSIAGIHAALRhFGSCVVAAIDxpfvkpevlehlykegekaGCDA----  115
ident                 |                                           
Sbjct YPVYEL--SSESIYELINLIKE-EKFELLIIDH-------ygisvddeklikLETGvkil   97
DSSP  LLEEEL--LLLLHHHHHHHHHH-HLLLEEEEEL-------llllhhhhhhhhHHHLleee


DSSP  -eeeelLLLLLleeeelhhhhhhhhhhhhllllllhhhhhllleeeeEHHHHllLLLL--
Query -lipkhDYPEPllayyaesaadelerailqgirkilvplerlnvvyyPVEKLrkFDKE--  172
ident                                                   |         
Sbjct sfddeiKPHHC------------------dillnvnayakasdyeglVPFKC-eVRCGfs  138
DSSP  eellllLLLLL------------------leeeellllllhhhhlllLLLLL-eEEELhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  172
ident                                                             
Sbjct yalireefyqeakenrkkkydfficxggtdiknlslqiaselpktkiisiatsssnpnlk  198
DSSP  hllllhhhhhhlllllllleeeeeellllllllhhhhhhhhlllllleeeeellllllhh


DSSP  ---------------------lhhhlllllhhhHHHHHHHHHHL----------------
Query ---------------------lisffnintpddLKRAEEICSKX----------------  195
ident                                                             
Sbjct klqkfaklhnnirlfidheniaklxnesnkliiSASSLVNEALLlkanfkaicyvknqes  258
DSSP  hhhhhhhlllleeeeellllhhhhhhleeeeeeELLHHHHHHHHlllleeeelllhhhhh


DSSP  ------------------------
Query ------------------------  195
ident                         
Sbjct tatwlakkgyeveykylehhhhhh  282
DSSP  hhhhhhhllleeelhhhlhhhlll


No 91: Query=mol1A Sbjct=3fvvA Z-score=3.5

back to top
DSSP  ---LEEEEeLLLLlllllllHHHL------------------------------------
Query ---XKVAVlVGGVgrrigxeKTEV------------------------------------   21
ident                                                             
Sbjct ttrRLALF-DLDH-------TLLPldsdyqwadflartgragdpaearrrnddlmerynr   52
DSSP  lllEEEEE-LLLL-------LLLLllhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------eellEEHHHHHHHHHL--LLEEEE
Query ------------------------------------xlcgKKLIEWVLEKYS--PFQTVF   43
ident                                               |             
Sbjct geltaeqaaefmlgllaahspvelaawheefmrdvirpslTVQAVDVVRGHLaaGDLCAL  112
DSSP  llllhhhhhhhhhhhhhlllhhhhhhhhhhhhhhllhhhlLHHHHHHHHHHHhlLLEEEE


DSSP  ELLL-HHHHHHHHLLLLL-LEELLL-------------LLLLLHHHHHHHHHHHHL----
Query VCRD-EKQAEKLSSRYEA-EFIWDL-------------HKGVGSIAGIHAALRHFG----   84
ident |                    |                                      
Sbjct VTATnSFVTAPIARAFGVqHLIATDpeyrdgrytgrieGTPSFREGKVVRVNQWLAgmgl  172
DSSP  EELLlHHHHHHHHHHLLLlEEEELEeeeelleeeeeeeLLLLLLHHHHHHHHHHHHhlll


DSSP  -----leEEEELLlllllhhhhhhhhhhhhhhllleeeeellllllLEEEelhhhhhhhh
Query -----scVVAAIDxpfvkpevlehlykegekagcdalipkhdypepLLAYyaesaadele  139
ident             |                                 | |           
Sbjct algdfaeSYFYSD--------------------------svndvplLEAV----------  196
DSSP  lhhhlleEEEEEL--------------------------lhhhhhhHHHL----------


DSSP  hhhhllllllhhhhhllleeeeehhhhlllLLLLhHHLLLllhhhhhhhhhhhhhl
Query railqgirkilvplerlnvvyypveklrkfDKELiSFFNIntpddlkraeeicskx  195
ident                                                         
Sbjct --------------trpiaanpspglreiaQARG-WQVID--------------lf  223
DSSP  --------------leeeeelllhhhhhhhHHHL-LEEEL--------------ll


No 92: Query=mol1A Sbjct=3h6oA Z-score=3.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qtqqlhaamadtflehmcrldidsppitarntgiictigpasrsvetlkemiksgmnvar   60
DSSP  llllhhhhllllhhhhhhhllllllllllllleeeeelllllllhhhhhhhhhhllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtgitlcdenilwl  120
DSSP  eelllllhhhhhhhhhhhhhhhhlllllllllllleeeeellllleelllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct dyknickvvevgskiyvddglislqvkqkgadflvtevengggskkgvnlpgaavdlpav  180
DSSP  llllhhhhllllleeeelllleeeeeeeelllleeeeeeelllllleeelllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sekdiqdlkfgveqdvdmvfasfirkasdvhevrkvlgekgknikiiskienhegvrrfd  240
DSSP  lhhhhhhhhhhhhlllleeeelllllhhhhhhhhhhhllllllleeeeeellhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eileasdgimvargdlgieipaekvflaqkmmigrcnragkpvicatqmlesmikkprpt  300
DSSP  hhhhhlleeeeehhhhhhhllhhhhhhhhhhhhhhhhhhllleeeellllhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct raegsdvanavldgadcimlsgetakgdypleavrmqhliareaeaaiyhlqlfeelrrl  360
DSSP  hhhhhhhhhhhhhllleeeelhhhhllllhhhhhhhhhhhhhhhhhlllhhhhhhhhhll


DSSP  ------------------------LEEEEELLlllllllllhhhleelleehHHHHHHHh
Query ------------------------XKVAVLVGgvgrrigxektevxlcgkklIEWVLEKy   36
ident                             ||                         |    
Sbjct apitsdpteatavgaveasfkccsGAIIVLTK----------------sgrsAHQVARYr  404
DSSP  llllllhhhhhhhhhhhhhhhhllLLEEEELL----------------llhhHHHHHLLl


DSSP  LLLEEEEELLLHHHHHHHHlLLLL-LEELLLLL-----llLHHHHHHHHHHHHL------
Query SPFQTVFVCRDEKQAEKLSsRYEA-EFIWDLHK-----gvGSIAGIHAALRHFG------   84
ident        | |    |      |                          |           
Sbjct PRAPIIAVTRNPQTARQAH-LYRGiFPVLCKDPvqeawaeDVDLRVNFAMNVGKargffk  463
DSSP  LLLLEEEEELLHHHHHHHH-HLLLeEEEELLLLllllhhhHHHHHHHHHHHHHHhhllll


DSSP  ---LEEEEElllllllhhhhhhhhhhhhhhllleeeeellllllLEEEELHHhhhhhhhh
Query ---SCVVAAidxpfvkpevlehlykegekagcdalipkhdypepLLAYYAESaadelera  141
ident       |                                                     
Sbjct kgdVVIVLT-------------------------gwrpgsgftnTMRVVPVP--------  490
DSSP  lllEEEEEE-------------------------ellllllleeEEEEEELL--------


DSSP  hhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query ilqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                                       
Sbjct ------------------------------------------------------  490
DSSP  ------------------------------------------------------


No 93: Query=mol1A Sbjct=3h6oC Z-score=3.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qtqqlhaamadtflehmcrldidsppitarntgiictigpasrsvetlkemiksgmnvar   60
DSSP  llllhhhhllllhhhhhhlllllllllllllleeeeelllllllhhhhhhhhhhllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtdenilwldykni  120
DSSP  eelllllhhhhhhhhhhhhhhhhlllllllllllleeeeelllllllllllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ckvvevgskiyvddglislqengggvnlpgaavdlpavsekdiqdlkfgveqdvdmvfas  180
DSSP  hhhlllllleeelllleeelllllleellllllllllllhhhhhhhhhhhhlllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct firkasdvhevrkvlgekgknikiiskienhegvrrfdeileasdgimvargdlgieipa  240
DSSP  llllhhhhhhhhhhhllllllleeeeeellhhhhhlhhhhhhhlleeeeehhhhhhhllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ekvflaqkmmigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsg  300
DSSP  hhhhhhhhhhhhhhhhhllleeeellllhhhhllllllhhhhhhhhhhhhhllleeeelh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct etakgdypleavrmqhliareaeaaiyhlqlfeelrrlapitsdpteatavgaveasfkc  360
DSSP  hhhllllhhhhhhhhhhhhhhhhhhllhhhhhhhhhhlllllllhhhhhhhhhhhhhhhl


DSSP  --LEEEEELLlllllllllhhhleelleehHHHHHHHHLLLEEEEELLLHHHHHHHHlLL
Query --XKVAVLVGgvgrrigxektevxlcgkklIEWVLEKYSPFQTVFVCRDEKQAEKLSsRY   58
ident       ||                         |           | |    |      |
Sbjct csGAIIVLTK----------------sgrsAHQVARYRPRAPIIAVTRNPQTARQAH-LY  403
DSSP  llLLEEEELL----------------llhhHHHHHHLLLLLLEEEEELLHHHHHHHH-HL


DSSP  LL-LEELLLLL-----llLHHHHHHHHHHHHL---------LEEEEElllllllhhhhhh
Query EA-EFIWDLHK-----gvGSIAGIHAALRHFG---------SCVVAAidxpfvkpevleh  103
ident                           |                 |               
Sbjct RGiFPVLCKDPvqeawaeDVDLRVNFAMNVGKargffkkgdVVIVLT-------------  450
DSSP  LLeEEEELLLLllllhhhHHHHHHHHHHHHHHhhlllllllEEEEEE-------------


DSSP  hhhhhhhhllleeeeellllllLEEEELHHhhhhhhhhhhllllllhhhhhllleeeeeh
Query lykegekagcdalipkhdypepLLAYYAESaadelerailqgirkilvplerlnvvyypv  163
ident                                                             
Sbjct ------------gwrpgsgftnTMRVVPVP------------------------------  468
DSSP  ------------ellllllleeEEEEEELL------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhhhhhhhhl
Query eklrkfdkelisffnintpddlkraeeicskx  195
ident                                 
Sbjct --------------------------------  468
DSSP  --------------------------------


No 94: Query=mol1A Sbjct=1l5xB Z-score=3.4

back to top
DSSP  LEEEEELLLllllllllhhhleelleEHHHHHHHHHLL-LEEEEELLL------------
Query XKVAVLVGGvgrrigxektevxlcgkKLIEWVLEKYSP-FQTVFVCRD------------   47
ident ||  |                                       |               
Sbjct XKILVTNDD-------------gvhsPGLRLLYQFALSlGDVDVVAPEspksatglgitl   47
DSSP  LEEEEELLL-------------llllHHHHHHHHHHLLlLEEEEEEELllllllllllll


DSSP  ----hhhHHHHhlLLLLlEELLllLLLLhHHHHHHHHHHH--LLEEEEELL---------
Query ----ekqAEKLssRYEAeFIWDlhKGVGsIAGIHAALRHF--GSCVVAAID---------   92
ident           |        |     |         |          |             
Sbjct hkplrxyEVDL--CGFR-AIAT--SGTP-SDTVYLATFGLgrKYDIVLSGInlgdntslq  101
DSSP  llllleeEEEL--LLLE-EEEE--LLLL-LLHHHHHHHHHllLLLEEEEEEeelllllhh


DSSP  -------------------------------------------lllLLHHHHHHHHHHhh
Query -------------------------------------------xpfVKPEVLEHLYKEge  109
ident                                               |         |   
Sbjct vilssgtlgaafqaallgipalaysaylenwnellnnkeaveixgaVVSSTASYVLKN--  159
DSSP  hhlllhhhhhhhhhhhlllleeeeeelllllhhhhllhhhhhhhhhHHHHHHHHHHHH--


DSSP  hhllleeeEELLLLLlleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlll
Query kagcdaliPKHDYPEpllayyaesaadelerailqgirkilvplerlnvvyypveklrkf  169
ident                                                             
Sbjct -------gXPQGVDV---------------------------------------------  167
DSSP  -------lLLLLLLE---------------------------------------------


DSSP  llllhhHLLLllhhHHHHhhhhHHHL----------------------------------
Query dkelisFFNIntpdDLKRaeeiCSKX----------------------------------  195
ident                  |                                          
Sbjct ------ISVN----FPRR----LGRGvraklvkaaklryaqqvvervdprgvryywlygr  213
DSSP  ------EEEE----ELLL----LLLLlleeelllllllllllleeeellllleeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct dlapepetdvyvvlkeggiaitpltlnlnavdahrevdxdslnrxveyinaslsklaaal  273
DSSP  llllllllhhhhhhlllleeeeeellllllllllllllhhhhhhhhhhhhhhhhhhhhhh


DSSP  -----
Query -----  195
ident      
Sbjct ehhhh  278
DSSP  hhhll


No 95: Query=mol1A Sbjct=2a1uA Z-score=3.4

back to top
DSSP  -LEEEEELLLLllllllLHHHleelleeHHHHHHHHHL--LLEEEEELL---LHHHHHHH
Query -XKVAVLVGGVgrrigxEKTEvxlcgkkLIEWVLEKYS--PFQTVFVCR---DEKQAEKL   54
ident      |                                                | |  |
Sbjct fQSTLVIAEHA----ndSLAP-------ITLNTITAATrlGGEVSCLVAgtkCDKVAQDL   49
DSSP  lLEEEEELLLL----llLLLH-------HHHHHHHHHHllLLEEEEEEEellLHHHHHHH


DSSP  HLLLLL-LEELLLL-------lllLHHHhHHHHHHHHLLEEEEELLL-------------
Query SSRYEA-EFIWDLH-------kgvGSIAgIHAALRHFGSCVVAAIDX-------------   93
ident              |               | |    |      |                
Sbjct CKVAGIaKVLVAQHdvykgllpeeLTPL-ILATQKQFNYTHICAGASafgknllprvaak  108
DSSP  LLLLLLlEEEEEELhhhllllhhhHHHH-HHHHHHHHLLLEEEEELLhhhhhhhhhhhhh


DSSP  -------lLLLHHHHHH-------------hhHHHHhhllleeeeellllllleeeelhh
Query -------pFVKPEVLEH-------------lyKEGEkagcdalipkhdypepllayyaes  133
ident                                                             
Sbjct levapisdIIAIKSPDTfvrtiyagnalctvkCDEK----vkvfsvrgtsfdaaatsggs  164
DSSP  hlllleeeELEEEELLEeeeeelllleeeeeeELLL----leeeeelhhhllllllllll


DSSP  hhhhhhhhHHLLL------------------------------lllhhhhhllleeeeeh
Query aadeleraILQGI------------------------------rkilvplerlnvvyypv  163
ident                                                             
Sbjct assekassTSPVEisewldqkltksdrpeltgakvvvsggrglksgenfkllydladqlh  224
DSSP  leeeelllLLLLLleeeeeeeelllllllllllleeeeelhhhllllllhhhhhhhhhhl


DSSP  hhhlllllllhhhllllLHHH--hHHHH-----------------HHHHHL---------
Query eklrkfdkelisffninTPDD--lKRAE-----------------EICSKX---------  195
ident                                                             
Sbjct aavgasraavdagfvpnDMQVgqtGKIVapelyiavgisgaiqhlAGMKDSktivainkd  284
DSSP  leeeelhhhhhlllllhHHLLlllLLLLllleeeeelllllhhhhLLLLLLleeeeeell


DSSP  -------------------------------
Query -------------------------------  195
ident                                
Sbjct peapifqvadygivadlfkvvpemteilkkk  315
DSSP  lllhhhhllleeeellhhhhhhhhhhhhlll


No 96: Query=mol1A Sbjct=2ogxB Z-score=3.4

back to top
DSSP  ----------------------------------LEEEEELLLLLllllllhhHLEElle
Query ----------------------------------XKVAVLVGGVGrrigxektEVXLcgk   26
ident                                          ||                 
Sbjct nstaeleellxqrsltdpqlqaaaaaaadfrilpDATVIKIGGQS----vidrGRAA--v   54
DSSP  llhhhhhhhhhhlllllhhhhhhhhlllllllllLEEEEEELLLL----lhhhLHHH--h


DSSP  EHHHHHHHHHL-LLEEEEELL-----------------------------LHHHHHHHHL
Query KLIEWVLEKYS-PFQTVFVCR-----------------------------DEKQAEKLSS   56
ident                                                       |  |  
Sbjct YPLVDEIVAARkNHKLLIGTGagtrarhlysiaaglglpagvlaqlgssvADQNAAXLGQ  114
DSSP  HHHHHHHHHHLlLLEEEEEELllhhhhhhhhhhhhllllhhhhhhhhhhhHHHHHHHHHH


DSSP  LLL-----------------------lLEELLLLL---------------lLLHHHHHHH
Query RYE-----------------------aEFIWDLHK---------------gVGSIAGIHA   78
ident                                                             
Sbjct LLAkhgipvvggaglsavplslaevnaVVFSGXPPyklwxrpaaegvippyRTDAGCFLL  174
DSSP  HHHhhlllllllllllhhhhhllllleEEEELLLLlhhhllllllllllllLHHHHHHHH


DSSP  HHHhHLLEEEEELLlllllhhhhhhhhhhhhhhllleeeeELLLLllleeeelhhhhhhh
Query ALRhFGSCVVAAIDxpfvkpevlehlykegekagcdalipKHDYPepllayyaesaadel  138
ident |   ||                                                      
Sbjct AEQ-FGCKQXIFVK--------dedglytanpktskdatfIPRIS--------vdexkak  217
DSSP  HHH-HLLLEEEEEE--------lllleellllllllllleELEEE--------hhhhhhl


DSSP  hhhhhllLLLLHHHHHL-------lleeeeehhhhllllllLHHHlllllhhhhhhhhhh
Query erailqgIRKILVPLER-------lnvvyypveklrkfdkeLISFfnintpddlkraeei  191
ident            |  |                                             
Sbjct glhdsilEFPVLDLLQSaqhvrevqvvnglvpgnltralagEHVG-------------ti  264
DSSP  lllllllLHHHHHHHHHllllleeeeeelllllhhhhhhllLLLL-------------ee


DSSP  hhhl
Query cskx  195
ident     
Sbjct itas  268
DSSP  eell


No 97: Query=mol1A Sbjct=2c1zA Z-score=3.4

back to top
DSSP  --LEEEEELLLLlllllLLHHhleelleEHHHHHHHHHLL---LEEEEELlLHHHHHHHH
Query --XKVAVLVGGVgrrigXEKTevxlcgkKLIEWVLEKYSP---FQTVFVCrDEKQAEKLS   55
ident     ||||                     |   |             |            
Sbjct tnPHVAVLAFPF-----STHA------aPLLAVVRRLAAAaphAVFSFFS-TSQSNASIF   48
DSSP  llLEEEEELLLL-----LLLH------hHHHHHHHHHHHHlllLEEEEEE-EHHHHHHHL


DSSP  LL----llLLEELLL-------------------llllLHHHHHHHHHHHH----LLEE-
Query SR----yeAEFIWDL-------------------hkgvGSIAGIHAALRHF----GSCV-   87
ident                                                             
Sbjct HDhtmqcnIKSYDISdgvpegyvfagrpqedielftraAPESFRQGMVMAVaetgRPVSc  108
DSSP  LLllllllEEEEEELllllllllllllllhhhhhhhhhHHHHHHHHHHHHHhhhlLLLLe


DSSP  EEELLlllllhhhhhhhhhhhhhhlLLEEEeellllllleeeelhhhhhhhhhhhhllll
Query VAAIDxpfvkpevlehlykegekagCDALIpkhdypepllayyaesaadelerailqgir  147
ident   |                                                         
Sbjct LVADA-----------fiwfaadmaAEMGV------------------------------  127
DSSP  EEEEL-----------llllhhhhhHHHLL------------------------------


DSSP  llhhhhhllleeeeehhhhlllllllhhhlLLLLHHHHH---------------------
Query kilvplerlnvvyypveklrkfdkelisffNINTPDDLK---------------------  186
ident                                   |  |                      
Sbjct -------------------------awlpfWTAGPNSLSthvyideirekigvsgiqgre  162
DSSP  -------------------------eeeeeELLLHHHHHhhhlhhhhhhhhlllllllll


DSSP  -----------------------------------------------hhhhHHHH-----
Query -----------------------------------------------raeeICSK-----  194
ident                                                             
Sbjct dellnfipgmskvrfrdlqegivfgnlnslfsrmlhrmgqvlpkatavfinSFEElddsl  222
DSSP  llllllllllllllhhhllllllllllllhhhhhhhhhhhhhhhllleeelLLHHhlhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct tndlksklktylnigpfnlitgclqwlkerkptsvvyisfgtvttpppaevvalsealea  282
DSSP  hhhhhhhllleeelllhhhlllhhhhhllllllleeeeellllllllhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct srvpfiwslrdkarvhlpegflektrgygmvvpwapqaevlaheavgafvthcgwnslwe  342
DSSP  hllleeeellhhhhhhllllhhhhhllleeeellllhhhhhlllleeeeeelllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct svaggvplicrpffgdqrlngrmvedvleigvrieggvftksglmscfdqilsqekgkkl  402
DSSP  hhhhllleeellllllhhhhhhhhhhlllleeelhhhlllhhhhhhhhhhhhhlhhhhhh


DSSP  ------------------------------------l
Query ------------------------------------x  195
ident                                      
Sbjct renlralretadravgpkgsstenfitlvdlvskpkd  439
DSSP  hhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhllll


No 98: Query=mol1A Sbjct=1lluA Z-score=3.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl   60
DSSP  lllleeeeeelllllllleeeeeelllllllleeeeeeeeellhhhhhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys  120
DSSP  llllllleeeeeeeellllllllllleeeelleeelllllhhhhlllhhhlllleellll


DSSP  --------------------------------------------------LEEEEELlll
Query --------------------------------------------------XKVAVLVggv   10
ident                                                     ||      
Sbjct vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgQWVAISG---  177
DSSP  llllllleeeellllleellllllhhhhhhhhlhhhhhhhhhhhhlllllLEEEEEL---


DSSP  lllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHHHHHHLlLLLL-EELLLL
Query grrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQAEKLSSrYEAE-FIWDLH   67
ident                  |                    |    |       |        
Sbjct --------------igGLGHVAVQYARamGLHVAAIDIDDAKLELARK-LGASlTVNARQ  222
DSSP  --------------llHHHHHHHHHHHhlLLEEEEEELLHHHHHHHHH-LLLLeEEELLL


DSSP  LlllhhHHHHHHHHHHLLE-EEEELllllllhhhhhhhhhhhhhhllleeeeelllllLL
Query KgvgsiAGIHAALRHFGSC-VVAAIdxpfvkpevlehlykegekagcdalipkhdypePL  126
ident           |  |  |    |                                      
Sbjct E-----DPVEAIQRDIGGAhGVLVT--------------------------avsnsafGQ  251
DSSP  L-----LHHHHHHHHHLLEeEEEEL--------------------------lllhhhhHH


DSSP  EE-eELHHhhhhhhhhhhllllLLHHHHhlLLEEeeehhhhlllllllhHHLLLllhhhh
Query LA-yYAESaadelerailqgirKILVPLerLNVVyypveklrkfdkeliSFFNIntpddl  185
ident                                                             
Sbjct AIgmARRG-gtialvglppgdfPTPIFD-vVLKG------------lhiAGSIV------  291
DSSP  HHllEEEE-eeeeelllllleeEEEHHH-hHHLL------------leeEELLL------


DSSP  hhHHHHHHHL------------------------------------------
Query krAEEICSKX------------------------------------------  195
ident                                                     
Sbjct --GTRADLQEaldfageglvkatihpgklddinqildqmragqiegrivlem  341
DSSP  --LLHHHHHHhhhhhhllllllleeeelhhhhhhhhhhhhlllllleeeeel


No 99: Query=mol1A Sbjct=1id1A Z-score=3.4

back to top
DSSP  ---LEEEEELLlllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHH-HHHHH
Query ---XKVAVLVGgvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEK-QAEKL   54
ident        |                      |                            |
Sbjct hrkDHFIVCGH-----------------sILAINTILQLNqrGQNVTVISNLPEdDIKQL   43
DSSP  lllLLEEEELL-----------------lHHHHHHHHHHHhlLLLEEEEELLLHhHHHHH


DSSP  HLLLL--LLEELLlllllLHHHhhHHHHHHH-LLEE-EEELllllllhhhhhhhhhhhhh
Query SSRYE--AEFIWDlhkgvGSIAgiHAALRHF-GSCV-VAAIdxpfvkpevlehlykegek  110
ident   |    |  |        |              |    |                    
Sbjct EQRLGdnADVIPG-----DSND-sSVLKKAGiDRCRaILAL------sdndadnafvvls   91
DSSP  HHHHLllLEEEEL-----LLLL-hHHHHHHLlLLLLeEEEL------lllhhhhhhhhhh


DSSP  hlLLEEE--------------eeLLLLLlleeeelhhhhhhhhhhhhllllllhhhhhll
Query agCDALI--------------pkHDYPEpllayyaesaadelerailqgirkilvplerl  156
ident                                                             
Sbjct akDMSSDvktvlavsdsknlnkiKMVHP--------------------------------  119
DSSP  hhHHLLLlleeeelllhhhhhhhHLLLL--------------------------------


DSSP  leeeeehhhhlllllllhhHLLLllhhhHHHHHHHHHHL------------------
Query nvvyypveklrkfdkelisFFNIntpddLKRAEEICSKX------------------  195
ident                                                          
Sbjct ------------------dIILS-----PQLFGSEILARvlngeeinndmlvsmlln  153
DSSP  ------------------lEEEL-----HHHHHHHHHHHhhllllllhhhhhhllll


No 100: Query=mol1A Sbjct=2j5tD Z-score=3.3

back to top
DSSP  --LEEEEELLLlllllllLHHHL--eellEEHHHHHHHHHLLL-----EEEEELL-----
Query --XKVAVLVGGvgrrigxEKTEV--xlcgKKLIEWVLEKYSPF-----QTVFVCR-----   46
ident       |  |                      |                 | |       
Sbjct dsQTLVVKLGT-------SVLTGgsrrlnRAHIVELVRQCAQLhaaghRIVIVTSgaiaa   53
DSSP  llLEEEEEELH-------HHHHLllllllHHHHHHHHHHHHHHhhlllEEEEEELlhhhh


DSSP  --------------------lhhhhHHHHLLLL---------------------------
Query --------------------dekqaEKLSSRYE---------------------------   59
ident                            |    |                           
Sbjct grehlgypelpatiaskqllaavgqSRLIQLWEqlfsiygihvgqmlltradmedrerfl  113
DSSP  hhhhhllllllllhhhhhhhhhhhhHHHHHHHHhhhhhlllleeeeeelhhhhllhhhhh


DSSP  --------------lLEELLL--------LLLLLHHHHHHHHHHhHLLEEEEELL-----
Query --------------aEFIWDL--------HKGVGSIAGIHAALRhFGSCVVAAID-----   92
ident                  |             |        ||    |             
Sbjct nardtlralldnnvvPVINENdavataeiKVGDNDNLSALAAIL-AGADKLLLLTdqkgl  172
DSSP  hhhhhhhhhhhllleEEEEELllllllllLLLLHHHHHHHHHHH-HLLLEEEEEElllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct ytadprsnpqaelikdvygiddalraiagdsvsglgtggmstklqaadvacragidtiia  232
DSSP  llllllllllllllleellllhhhhhhhhhhlllllllllhhhhhhhhhhhhllleeeee


DSSP  -LLLLL--HHHHHH---hhhhHHHHLLLeeeeellllllleeeelhhhHHHHHHhhHLLL
Query -XPFVK--PEVLEH---lykeGEKAGCDalipkhdypepllayyaesaADELERaiLQGI  146
ident           | |           |                                   
Sbjct aGSKPGviGDVMEGisvgtlfHAQATPL----------------enrkRWIFGA--PPAG  274
DSSP  eLLLLLhhHHHHLLlllleeeLLLLLLL----------------lhhhHHHHHL--LLLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  146
ident                                                             
Sbjct eitvdegataailergssllpkgiksvtgnfsrgeviricnlegrdiahgvsrynsdalr  334
DSSP  eeeelhhhhhhhhhllllllhhheeeeellllllleeeeeelllleeeeeeelllhhhhh


DSSP  -------------------lllhhhhHLLLeeeeehhhhlllllllhhhlllllhhhhhh
Query -------------------rkilvplERLNvvyypveklrkfdkelisffnintpddlkr  187
ident                                                             
Sbjct riaghhsqeidailgyeygpvavhrdDMIT------------------------------  364
DSSP  hhllllhhhhhhhhlllllllleeeeEEEE------------------------------


DSSP  hhhhhhhl
Query aeeicskx  195
ident         
Sbjct -----ree  367
DSSP  -----lll


No 101: Query=mol1A Sbjct=2jjxA Z-score=3.3

back to top
DSSP  ---LEEEEELLLlllllllLHHHL---eellEEHHHHHHHHHLL-----LEEEEELL---
Query ---XKVAVLVGGvgrrigxEKTEV---xlcgKKLIEWVLEKYSP-----FQTVFVCR---   46
ident      |     |                    |  |                  |     
Sbjct rpyKRVLIKLSG-------GALADqtgnsfnSKRLEHIANEILSivdlgIEVSIVIGggn   53
DSSP  lllLEEEEEELH-------HHLLLlllllllHHHHHHHHHHHHHhhlllLEEEEEELlll


DSSP  --------------------lHHHHHHHHLLLL---------------------------
Query --------------------dEKQAEKLSSRYE---------------------------   59
ident                             |                               
Sbjct ifrghlaeewgidrveadnigTLGTIINSLMLRgvltsktnkevrvmtsipfnavaepyi  113
DSSP  lllhhhhhhllllhhhhhhhhHHHHHHHHHHHHhhhhhhlllleeeeelllllllleell


DSSP  ------------lLEEL-LLLL--LLLHHHHHHHHHHhHLLEEEEELL------------
Query ------------aEFIW-DLHK--GVGSIAGIHAALRhFGSCVVAAID------------   92
ident                                   |     |                   
Sbjct rlravhhldngyiVIFGgGNGQpfVTTDYPSVQRAIE-MNSDAILVAKqgvdgvftsdpk  172
DSSP  hhhhhhhhhllleEEEElLLLLllLLLHHHHHHHHHH-HLLLEEEEEEllllllllllll


DSSP  -------------------------------------------LLLLL--HHHHHHhhhh
Query -------------------------------------------XPFVK--PEVLEHlyke  107
ident                                                             
Sbjct hnksakmyrklnyndvvrqniqvmdqaalllardynlpahvfnFDEPGvmRRICLG----  228
DSSP  llllllllleeehhhhhhlllllllhhhhhhhhhhllleeeeeLLLLLhhHHHHLL----


DSSP  hhhhllleEEEELLLlllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhl
Query gekagcdaLIPKHDYpepllayyaesaadelerailqgirkilvplerlnvvyypveklr  167
ident         ||                                                  
Sbjct ---ehvgtLINDDAS---------------------------------------------  240
DSSP  ---lllleEEELLLL---------------------------------------------


DSSP  llllllhhhlllllhhhhhhhhhhhhhl
Query kfdkelisffnintpddlkraeeicskx  195
ident                             
Sbjct ------------------------llvh  244
DSSP  ------------------------llll


No 102: Query=mol1A Sbjct=2w6pB Z-score=3.3

back to top
DSSP  --LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHHHHl
Query --XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEKLSs   56
ident    |                              |         || |         |  
Sbjct mlDKIVIAN-----------------rgEIALRILRACKelGIKTVAVH-SSAD-RDLKh   41
DSSP  llLEEEELL-----------------lhHHHHHHHHHHHhhLLEEEEEE-EHHH-LLLHh


DSSP  lLLLL-EELL-----llllLLHHHHHHHHHHHHllEEEEELLlllllhhhhhhhhhhhhh
Query rYEAE-FIWD-----lhkgVGSIAGIHAALRHFgsCVVAAIDxpfvkpevlehlykegek  110
ident    |                   | | ||                               
Sbjct vLLADeTVCIgpapsvksyLNIPAIISAAEITG-aVAIHPGY-------gflsenanfae   93
DSSP  hHHLLeEEEEelllhhhllLLHHHHHHHHHHLL-lLEEELLL-------llllllhhhhh


DSSP  hlLLEE-----eEELLLL-----llleeeelhhhhhhhhhhhhllllllhhhhhllleee
Query agCDAL-----iPKHDYP-----epllayyaesaadelerailqgirkilvplerlnvvy  160
ident                                                             
Sbjct qvERSGfifigpKAETIRlmgdkvsaiaamkkagvpcvpgsdgpdmvymekylenprhve  153
DSSP  hhHHLLleelllLHHHHHhhhlhhhhhhhhhhhllllllllllllllllllllllleeee


DSSP  eehhhHLLL----------------------------------------------llLLH
Query ypvekLRKF----------------------------------------------dkELI  174
ident                                                             
Sbjct iqvlaDGQGnaiylaerdcsmqrrhqkvveeapapgitpelrryigercakacvdigYRG  213
DSSP  eeeeeELLLleeeeeeeeeeeeelleeeeeeellllllhhhhhhhhhhhhhhhhhllLEE


DSSP  HH------------------LLLLlhhhhhHHHHHHHHL---------------------
Query SF------------------FNINtpddlkRAEEICSKX---------------------  195
ident                                                             
Sbjct AGtfeflfengefyfiemntRIQV------EHPVTEMITgvdlikeqlriaagqplsikq  267
DSSP  EEeeeeeeelleeeeeeeelLLLL------LHHHHHHHHlllhhhhhhhhhllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct eevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmi  327
DSSP  hhllllleeeeeeeellllllllllleelleeelllllleeeeelllllleellllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct gklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklg  387
DSSP  eeeeeeellhhhhhhhhhhhhhhleeelllllhhhhhhhhhlhhhhhllllllhhhhhhl


No 103: Query=mol1A Sbjct=1dv2A Z-score=3.3

back to top
DSSP  -----LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHH
Query -----XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEK   53
ident       |                              |         || |         
Sbjct gshmlDKIVIAN-----------------rgEIALRILRACKelGIKTVAVH-SSAD-RD   41
DSSP  lllllLEEEELL-----------------lhHHHHHHHHHHHhhLLEEEEEE-ELLL-LL


DSSP  HHllLLLL-EELL-----llllLLHHHHHHHHHHHHllEEEEELLlllllhhhhhhhhhh
Query LSsrYEAE-FIWD-----lhkgVGSIAGIHAALRHFgsCVVAAIDxpfvkpevlehlyke  107
ident |     |                   | | ||                            
Sbjct LKhvLLADeTVCIgpapsvksyLNIPAIISAAEITG-aVAIHPGY---------------   85
DSSP  LHhhHHLLeEEEEelllhhhllLLHHHHHHHHHHHL-lLEEELLL---------------


DSSP  hhhhllleeeeellLLLL-leEEELhhhhhhhhhhhhllllllhhhhhllleeEEEH---
Query gekagcdalipkhdYPEP-llAYYAesaadelerailqgirkilvplerlnvvYYPV---  163
ident                                                             
Sbjct --------gflsenANFAeqvERSG----------------------fifigpKAETirl  115
DSSP  --------llllllHHHHhhhHHLL----------------------leelllLHHHhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  163
ident                                                             
Sbjct mgdkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvv  175
DSSP  hhlhhhhhhhhhhhlllllllllllllllhhhhhhhhhhhllleeeeelllllllleeee


DSSP  ------------------------------------------hhHLLLLL----------
Query ------------------------------------------ekLRKFDK----------  171
ident                                                             
Sbjct rgdaelaqsismtraeakaafsndmvymekylenprhveiqvlaDGQGNAiylaerdcsm  235
DSSP  llhhhhhhhhhhhhhhhhhhllllleeeeellllleeeeeeeeeELLLLEeeeeeeeeee


DSSP  -----------------------------------lLHHHL------------------L
Query -----------------------------------eLISFF------------------N  178
ident                                                             
Sbjct qrrhqkvveeapapgitpelrryigercakacvdigYRGAGtfeflfengefyfikmntR  295
DSSP  eelleeeeeeellllllhhhhhhhhhhhhhhhhhhlLEEEEeeeeeeelleeeeeeeelL


DSSP  LLLhhhhhHHHHHHHHL-------------------------------------------
Query INTpddlkRAEEICSKX-------------------------------------------  195
ident |                                                           
Sbjct IQV-----EHPVTEMITgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntf  350
DSSP  LLL-----LHHHHHHHHlllhhhhhhhhhllllllllhhhllllleeeeeeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct lpspgkitrfhapggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalq  410
DSSP  lllleelleeelllllleeeeelllllleelllllleeeeeeeeellhhhhhhhhhhhhh


DSSP  ----------------------------------------
Query ----------------------------------------  195
ident                                         
Sbjct eliidgiktnvdlqirimndenfqhggtnihylekklglq  450
DSSP  hleeelllllhhhhhhhhllhhhhhllllllhhhhhllll


No 104: Query=mol1A Sbjct=2nz2A Z-score=3.3

back to top
DSSP  -LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLL---hhhHHHH
Query -XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRD---ekqAEKL   54
ident    |                             |                       |  
Sbjct kGSVVLAY----------------sggLDTSCILVWLKeqGYDVIAYLANigqkedFEEA   44
DSSP  lEEEEEEL----------------lllHHHHHHHHHHHhlLEEEEEEEEEllllllHHHH


DSSP  HLLLL----LLEELLLLL------------------------------lLLHHHHHHHHH
Query SSRYE----AEFIWDLHK------------------------------gVGSIAGIHAAL   80
ident                                                           | 
Sbjct RKKALklgaKKVFIEDVSrefveefiwpaiqssalyedryllgtslarpCIARKQVEIAQ  104
DSSP  HHHHHhhllLEEEEEELHhhhhhhlhhhhhhlllllllllllllllhhhHHHHHHHHHHH


DSSP  HhHLLEEEEELLlllllhhhhhhhhhhhhhhllleeeeelllLLLLeeeelhhhhhhhhh
Query RhFGSCVVAAIDxpfvkpevlehlykegekagcdalipkhdyPEPLlayyaesaadeler  140
ident |  |   |                                                    
Sbjct R-EGAKYVSHGA-----------------------tgkgndqVRFE--------------  126
DSSP  H-HLLLEEELLL-----------------------lllllhhHHHH--------------


DSSP  hhhllllLLHHhhhllleeeeehhhhlllllllhHHLLlllhhhhhhHHHHHHH------
Query ailqgirKILVplerlnvvyypveklrkfdkeliSFFNintpddlkrAEEICSK------  194
ident                                                             
Sbjct ---lscySLAP----------------qikviapWRMP------efyNRFKRNDlmeyak  161
DSSP  ---hhhhHHLL----------------lleeelhHHLH------hhhLLLLLHHhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct qhgipipvtpknpwsmdenlmhisyeagilenpknqappglytktqdpakapntpdilei  221
DSSP  hlllllllllllllleeelllleeellhhhhlllllllhhhlllllllllllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct efkkgvpvkvtnvkdgtthqtslelfmylnevagkhgvgridivenrfigmksrgiyetp  281
DSSP  eeelleeeeeeellllleellhhhhhhhhhhhhhhhllleeeeeeellllleeeeeeelh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct agtilyhahldieaftmdrevrkikqglglkfaelvytgfwhspecefvrhciaksqerv  341
DSSP  hhhhhhhhhhhhhhhhllhhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  194
ident                                                             
Sbjct egkvqvsvlkgqvyilgresplslyneelvsnvqgdyeptdatgfininslrlkeyhrlq  401
DSSP  leeeeeeeelleeeeeeeelllllllhhhhllllllllhhhhhhhhhhhhhhhhhhhhll


DSSP  -l
Query -x  195
ident   
Sbjct sd  403
DSSP  ll


No 105: Query=mol1A Sbjct=1rkuA Z-score=3.3

back to top
DSSP  --LEEEEELLL----LLLL-----------------------------------------
Query --XKVAVLVGG----VGRR-----------------------------------------   13
ident           |                                                 
Sbjct dmEIACLDLEGvlvpEIWIafaektgidalkattrdipdydvlmkqrlrildehglklgd   60
DSSP  llEEEEEELLLllllLHHHhhhhhhllhhhhllllllllhhhhhhhhhhhhhhllllhhh


DSSP  ----llllhHHLEelleehHHHHHHHHL-LLEEEEELLLHH-hHHHHHLL-LLLLEEL--
Query ----igxekTEVXlcgkklIEWVLEKYS-PFQTVFVCRDEK-qAEKLSSR-YEAEFIW--   64
ident                               || |            |             
Sbjct iqeviatlkPLEG------AVEFVDWLReRFQVVILSDTFYefSQPLMRQlGFPTLLChk  114
DSSP  hhhhhllllLLLL------HHHHHHHHHlLLEEEEEEEEEHhhHHHHHHHlLLLLEEEee


DSSP  -----------llLLLLlhHHHHHHhHHHHL----LEEEEE-------------------
Query -----------dlHKGVgsIAGIHAaLRHFG----SCVVAA-------------------   90
ident                              |         |                    
Sbjct leiddsdrvvgyqLRQK--DPKRQS-VIAFKslyyRVIAAGdsyndttmlseahagilfh  171
DSSP  eeellllleeeeeLLLL--LHHHHH-HHHHHhlllEEEEEElllllhhhhhhlleeeeel


DSSP  ---------------lllLLLL--HHHHHHHhhhhhhhllleeeeellllllleeeelhh
Query ---------------idxPFVK--PEVLEHLykegekagcdalipkhdypepllayyaes  133
ident                      |                                      
Sbjct apenvirefpqfpavhtyEDLKreFLKASSR-----------------------------  202
DSSP  llhhhhhhllllleellhHHHHhhHHHHLLL-----------------------------


DSSP  hhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhh
Query aadelerailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeics  193
ident                                                             
Sbjct ----------------------------------------------------------sl  204
DSSP  ----------------------------------------------------------ll


DSSP  hl
Query kx  195
ident   
Sbjct sl  206
DSSP  ll


No 106: Query=mol1A Sbjct=1aqfE Z-score=3.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva   60
DSSP  lllllhhhhllllhhhhhllllllllllllllleeeeeellllllhhhhhhhhlllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpepgaavdlpavsekd  120
DSSP  eeelllllhhhhhhhhhhhhhhhhlllllllllllleeeeellllllllllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct iqdlkfgveqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeile  180
DSSP  hhhhhhhhllllleeeelllllhhhhhhhhhhhllllllleeeeelllhhhhhlhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct asdgimvargdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraeg  240
DSSP  hlleeeeehhhhhhhlllllhhhhhhhhhhhhhhhllleeeelllllhhhllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sdvanavldgadcimlsgetakgdypleavrmqhliareaeaamfhrklfeelarssshs  300
DSSP  hhhhhhhhhllleeeelhhhhllllhhhhhhhhhhhhhhhhhlllhhhhhhhhhhhllll


DSSP  --------------------LEEEEELLLllllllllhhhleelleeHHHHHHHHHLLLE
Query --------------------XKVAVLVGGvgrrigxektevxlcgkkLIEWVLEKYSPFQ   40
ident                         ||                         |        
Sbjct tdlmeamamgsveasykclaAALIVLTES----------------grSAHQVARYRPRAP  344
DSSP  llhhhhhhhhhhhhhhhhllLEEEEELLL----------------lhHHHHHHLLLLLLL


DSSP  EEEELLLHHHHHHHHlLLLL-LEELLLLL-----llLHHHHHHHHHHHHL---------L
Query TVFVCRDEKQAEKLSsRYEA-EFIWDLHK-----gvGSIAGIHAALRHFG---------S   85
ident    | |    |      |                          |               
Sbjct IIAVTRNHQTARQAH-LYRGiFPVVCKDPvqeawaeDVDLRVNLAMNVGKargffkkgdV  403
DSSP  EEEEELLHHHHHHHL-LLLLeEEEELLLLllllhhhHHHHHHHHHHHHHHhhlllllllE


DSSP  EEEEE------lLLLLllhhhhhhhhhhhhhhllleeeeelllllllEEEELHHhhhhhh
Query CVVAA------iDXPFvkpevlehlykegekagcdalipkhdypeplLAYYAESaadele  139
ident   |                                                         
Sbjct VIVLTgwrpgsgFTNT-------------------------------MRVVPVP------  426
DSSP  EEEEElllllllLLLE-------------------------------EEEEELL------


DSSP  hhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query railqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                                         
Sbjct --------------------------------------------------------  426
DSSP  --------------------------------------------------------


No 107: Query=mol1A Sbjct=1lnqA Z-score=3.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt   60
DSSP  llllllllllllhhhhlllllllllllllllhhhhhhhhllllllllllllllhhhhhlh


DSSP  --------------------LEEEEELLlllllllllhhhleelleEHHHHHHHHHLLLE
Query --------------------XKVAVLVGgvgrrigxektevxlcgkKLIEWVLEKYSPFQ   40
ident                       |                             |       
Sbjct livlgigtfavaverlleflRHVVICGW-----------------sESTLECLRELRGSE  103
DSSP  hhhllllllllhhhhhllllLEEEEELL-----------------lHHHHHHHLLHHHLL


DSSP  EEEELLLHHHHHHHHlLLLLLEELLllllllhhHHHH--HHHHHH-LLEE-EEELlllll
Query TVFVCRDEKQAEKLSsRYEAEFIWDlhkgvgsiAGIH--AALRHF-GSCV-VAAIdxpfv   96
ident       ||    |   |  | |                             |        
Sbjct VFVLAEDENVRKKVL-RSGANFVHG--------DPTRvsDLEKANvRGARaVIVD-----  149
DSSP  EEEEELLHHHHHHHH-HLLLEEEEL--------LLLLhhHHHHLLlLLEEeEEEL-----


DSSP  lhhhhhhhhhhhhhhllLEEE-------------eellLLLLleeeelhhhhhhhhhhhh
Query kpevlehlykegekagcDALI-------------pkhdYPEPllayyaesaadelerail  143
ident                                                             
Sbjct -lesdsetihcilgirkIDESvriiaeaeryenieqlrMAGA------------------  190
DSSP  -lllhhhhhhhhhhhhlLLLLleeeeelllhhhhhhhhHLLL------------------


DSSP  llllllhhhhhllleeeeehhhhlllllllhhHLLLLLhHHHHH----------hhhhHH
Query qgirkilvplerlnvvyypveklrkfdkelisFFNINTpDDLKR----------aeeiCS  193
ident                                            |                
Sbjct -------------------------------dQVISPF-VISGRlmsrsiddgyeamfVQ  218
DSSP  -------------------------------lEEELHH-HHHHHhhhhlllllhhhhhHH


DSSP  HL----------------------------------------------------------
Query KX----------------------------------------------------------  195
ident                                                             
Sbjct DVlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdeliidpprdysfr  278
DSSP  HHllllllleeeeeelllllllllllhhhhlhhhhhlleeeeeelllleellllllllll


DSSP  -----------------------
Query -----------------------  195
ident                        
Sbjct agdiilgigkpeeierlknyisa  301
DSSP  llleeeeeelhhhhhhhhhllll


No 108: Query=mol1A Sbjct=3ek6A Z-score=3.2

back to top
DSSP  ---------LEEEEELLLlllllllLHHHLE---ellEEHHHHHHHHHLL-----LEEEE
Query ---------XKVAVLVGGvgrrigxEKTEVX---lcgKKLIEWVLEKYSP-----FQTVF   43
ident                  |       |            | |               |   
Sbjct snamselsyRRILLKLSG-------EALMGDgdygidPKVINRLAHEVIEaqqagAQVAL   53
DSSP  lllhhhlllLEEEEEELH-------HHHLLLllllllHHHHHHHHHHHHHhhhllLEEEE


DSSP  ELL-----------------------lHHHHHHHHLLLL---------------------
Query VCR-----------------------dEKQAEKLSSRYE---------------------   59
ident |                                                           
Sbjct VIGggnifrgaglaasgmdrvtgdhmgMLATVINALAMQdaleklgakvrvmsaikindv  113
DSSP  EELllllllllllllllllhhhhhhhhHHHHHHHHHHHHhhhhhlllleeeeelllllll


DSSP  -----------------lLEEL-LLLL--LLLHHHHHHHHHHhHLLEEEEELL-------
Query -----------------aEFIW-DLHK--GVGSIAGIHAALRhFGSCVVAAID-------   92
ident                                        |    |               
Sbjct cedfirrrairhlekgriAIFAaGTGNpfFTTDSGAALRAIE-IGADLLLKATkvdgvyd  172
DSSP  leellhhhhhhhhhllleEEEElLLLLllLLHHHHHHHHHHH-HLLLEEEEELlllllll


DSSP  ----------------------------------------------LLLL--LHHHHHHH
Query ----------------------------------------------XPFV--KPEVLEHL  104
ident                                                           | 
Sbjct kdpkkhsdavrydsltydevimqglevmdtaafalardsdlplrifGMSEpgVLLRILHG  232
DSSP  llhhhlllllllleelhhhhhhhllllllhhhhhhhhhlllleeeeLLLLllHHHHHHLL


DSSP  hhhhhhhllleEEEELlllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehh
Query ykegekagcdaLIPKHdypepllayyaesaadelerailqgirkilvplerlnvvyypve  164
ident            |                                                
Sbjct ------aqigtLVQGR--------------------------------------------  242
DSSP  ------lllleEELLL--------------------------------------------


DSSP  hhlllllllhhhlllllhhhhhhhhhhhhhl
Query klrkfdkelisffnintpddlkraeeicskx  195
ident                                
Sbjct ------------------------------s  243
DSSP  ------------------------------l


No 109: Query=mol1A Sbjct=3ioyA Z-score=3.2

back to top
DSSP  ------LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHHH
Query ------XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQAE   52
ident           |                                                 
Sbjct lkdfagRTAFVTG----------------ganGVGIGLVRQLLnqGCKVAIADIRQDSID   44
DSSP  llllllLEEEEEL----------------lllLHHHHHHHHHHhlLLEEEEEELLHHHHH


DSSP  HHHLLLL-------LLEELLlllllLHHH---hhHHHHHHH---LLEE-EEEL-------
Query KLSSRYE-------AEFIWDlhkgvGSIA---giHAALRHF---GSCV-VAAI-------   91
ident |     |                            ||       |               
Sbjct KALATLEaegsgpeVMGVQL-----DVASregfkMAADEVEarfGPVSiLCNNagvnlfq   99
DSSP  HHHHHHHhhllhhhEEEEEL-----LLLLhhhhhHHHHHHHhhlLLEEeEEELlllllll


DSSP  ------------------llllllhhhhHHHHHHHHHHLL--------------------
Query ------------------dxpfvkpevlEHLYKEGEKAGC--------------------  113
ident                                  |  |||                     
Sbjct pieessyddwdwllgvnlhgvvngvttfVPRMVERVKAGEqkgghvvntasmaaflaags  159
DSSP  lhhhllhhhhhhhhhhhlhhhhhhhhhhHHHHHHHHHLLLlllleeeeellhhhllllll


DSSP  ----leeeeelLLLLlleeeelhhhhhhhhhhhhllllllhhhhhllleeeeeHHHHLLl
Query ----dalipkhDYPEpllayyaesaadelerailqgirkilvplerlnvvyypVEKLRKf  169
ident                                                         | | 
Sbjct pgiynttkfavRGLS-----------------------------------eslHYSLLK-  183
DSSP  lhhhhhhhhhhHHHH-----------------------------------hhhHHHHHH-


DSSP  llllhHHLLLllhhHHHH--------------------------hhhHHHH---------
Query dkeliSFFNIntpdDLKR--------------------------aeeICSK---------  194
ident                                                             
Sbjct -yeigVSVLC----PGLVkagvhefgmepdvigarvieamkanrlhiFSHPdhkeelrev  238
DSSP  -hlleEEEEL----LLLLlllhhhllllhhhhhhhhhhhhhlllleeLLLLllhhhhhhh


DSSP  --------------------------------------l
Query --------------------------------------x  195
ident                                        
Sbjct fdeiiaeyqdypkdpgydqrvafekfradsfaearrqsr  277
DSSP  hhhhhhllllllllllhhhhhhhhhhhhhhhhhhhhhhl


No 110: Query=mol1A Sbjct=2phjA Z-score=3.2

back to top
DSSP  LEEEEELLLllllllllhhhleelleEHHHHHHHHHLL-LEEEEELLL------------
Query XKVAVLVGGvgrrigxektevxlcgkKLIEWVLEKYSP-FQTVFVCRD------------   47
ident                             |    |        | |  |            
Sbjct PTFLLVNDD-------------gyfsPGINALREALKSlGRVVVVAPDrnlsgvghsltf   47
DSSP  LEEEEELLL-------------llllHHHHHHHHHHLLlLEEEEEEELllllllllllll


DSSP  ---hhhhHHHHlllllLEELLllLLLLHHHHHHHHHHH---HLLE-EEEELL--------
Query ---ekqaEKLSsryeaEFIWDlhKGVGSIAGIHAALRH---FGSC-VVAAID--------   92
ident                  |              |   |          |            
Sbjct teplkmrKIDT-----DFYTV--IDGTPADCVHLGYRVileEKKPdLVLSGInegpnlge  100
DSSP  llleeeeEEEL-----LEEEE--LLLLHHHHHHHHHHLlllLLLLlEEEEEEelllllhh


DSSP  -------------------------------------lLLLL--HHHHHHhhhhhhhhll
Query -------------------------------------xPFVK--PEVLEHlykegekagc  113
ident                                                             
Sbjct ditysgtvsgamegrilgipsiafsafgrenimfeeiaKVCVdiVKKVLN----------  150
DSSP  hhhhlhhhhhhhhhhhlllleeeeeeellllllhhhhhHHHHhhHHHHHH----------


DSSP  leeEEELlLLLLleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllll
Query dalIPKHdYPEPllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkel  173
ident                                                             
Sbjct --eGIPE-DTYL------------------------------------------------  159
DSSP  --hLLLL-LEEE------------------------------------------------


DSSP  hhHLLLllhhhhhhHHHHHHHL--------------------------------------
Query isFFNIntpddlkrAEEICSKX--------------------------------------  195
ident     ||                                                      
Sbjct --NVNI--------PNLRYEEIkgikvtrqgkraykervfkyidpygkpfywiaaeefgw  209
DSSP  --EEEE--------ELLLHHHLleeeelllllllleeeeeeeellllleeeeeeeellll


DSSP  ---------------------------------------
Query ---------------------------------------  195
ident                                        
Sbjct haeegtdywavlngyvsvtplhldltnykvmksikyled  248
DSSP  llllllhhhhhhlleeeeeeeelllllhhhhhhhhhhhl


No 111: Query=mol1A Sbjct=1dv1B Z-score=3.2

back to top
DSSP  --LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHHHHl
Query --XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEKLSs   56
ident    |                              |         || |         |  
Sbjct mlDKIVIAN-----------------rgEIALRILRACKelGIKTVAVH-SSAD-RDLKh   41
DSSP  llLEEEELL-----------------lhHHHHHHHHHHHhhLLEEEEEE-EHHH-LLLHh


DSSP  lLLLL-EELLL-----lllLLHHHHHHHHHHHHllEEEEELLlllllhhhhhhhhhhhhh
Query rYEAE-FIWDL-----hkgVGSIAGIHAALRHFgsCVVAAIDxpfvkpevlehlykegek  110
ident    |                   | | ||                               
Sbjct vLLADeTVCIGpapsvksyLNIPAIISAAEITG-aVAIHPGY------------------   82
DSSP  hHHLLeEEEEEllllllllLLHHHHHHHHHHHL-lLEEELLL------------------


DSSP  hllleeeeellLLLLleeeelhhhhhhhhhhhhllllllhhhhhllleeEEEH-------
Query agcdalipkhdYPEPllayyaesaadelerailqgirkilvplerlnvvYYPV-------  163
ident                                                             
Sbjct -----gflsenANFA--------------------eqversgfifigpkAETIrlmgdkv  117
DSSP  -----llllllHHHH--------------------hhhhhllleellllHHHHhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  163
ident                                                             
Sbjct saiaamkkagvpcvpgsdgplgddmdknraiakrigypviikmrvvrgdaelaqsismtr  177
DSSP  hhhhhhhhhlllllllllllllllhhhhhhhhhhhllleeelleeellhhhhhhhhhhhh


DSSP  --------------hhhlLLLL--------------------------------------
Query --------------eklrKFDK--------------------------------------  171
ident                                                             
Sbjct aymekylenprhveiqvlADGQgnaiylaerdcsmqrrhqkvveeapapgitpelrryig  237
DSSP  lleeellllleeeeeeeeEELLlleeeeeeeeeeeeelleeeeeeellllllhhhhhhhh


DSSP  ----------llHHHL------------------LLLLhhhhhhHHHHHHHL--------
Query ----------elISFF------------------NINTpddlkrAEEICSKX--------  195
ident                                    |                        
Sbjct ercakacvdigyRGAGtfeflfengefyfiemntRIQV-----eHPVTEMITgvdlikeq  292
DSSP  hhhhhhhhhhllEEEEeeeeeeelleeeeeeeelLLLL-----lHHHHHHHHlllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct lriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiy  352
DSSP  hhhhllllllllhhhllllleeeeeeeellllllllllleelleeelllllleeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct agytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqh  412
DSSP  llleelllllleeeeeeeeellhhhhhhhhhhhhhhleeelllllhhhhhhhhllhhhhh


DSSP  ----------------
Query ----------------  195
ident                 
Sbjct ggtnihylekklglqe  428
DSSP  llllllhhhhhhllll


No 112: Query=mol1A Sbjct=1fs0G Z-score=3.2

back to top
DSSP  ---------------------------------------------------LEEEEELLL
Query ---------------------------------------------------XKVAVLVGG    9
ident                                                      |  ||  
Sbjct kitkamemvaaskmrksqdrmaasrpyaetmrkvighlahykhpyledrdvKRVGYLVVS   60
DSSP  lhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllhhhlllllLEEEEEEEL


DSSP  LLLlllllhhhleellEEHHHHHHHHHLLL-----EEEEELLlhhHHHHHHLLLlLLEEL
Query VGRrigxektevxlcgKKLIEWVLEKYSPF-----QTVFVCRdekQAEKLSSRYeAEFIW   64
ident   |               |    |           |               |        
Sbjct TDR------glcgglnINLFKKLLAEMKTWtdkgvQCDLAMIgskGVSFFNSVG-GNVVA  113
DSSP  LLL------lllllhhHHHHHHHHHHHHHHhhlllEEEEEEElhhHHHHHHHHL-LLEEE


DSSP  ------llllllLHHHHHHHHHHHH---LLEEEEELL---------lLLLLhhhhhhhhh
Query ------dlhkgvGSIAGIHAALRHF---GSCVVAAID---------xPFVKpevlehlyk  106
ident               |      |                         |            
Sbjct qvtgmgdnpslsELIGPVKVMLQAYdegRLDKLYIVSnkfintmsqvPTIS---------  164
DSSP  eelllllllllhHHHHHHHHHHHHHhllLLLLEEEEEeeeeelleeeEEEE---------


DSSP  hhhhhllleeeeelllllllEEEElhhhhhhhhhhhhllllllhhhhHLLLEEeeehhhh
Query egekagcdalipkhdypeplLAYYaesaadelerailqgirkilvplERLNVVyypvekl  166
ident                                                             
Sbjct --------------------QLLP------lpkhkswdylyepdpkaLLDTLL-----rr  193
DSSP  --------------------EEEL------llllllllleeellhhhHHHHHH-----hh


DSSP  lllllllhhhlLLLLhhHHHHHHHhhhhl
Query rkfdkelisffNINTpdDLKRAEEicskx  195
ident                      |       
Sbjct yvesqvyqgvvENLA--SEQAARM-vamk  219
DSSP  hhhhhhhhhhhHHHH--HHHHHHH-hhhl


No 113: Query=mol1A Sbjct=2voyI Z-score=3.2

back to top
DSSP  ---------LEEEEELLLlllllllLHHHleelleEHHHHHHHHHL--LLEEEEELLL-H
Query ---------XKVAVLVGGvgrrigxEKTEvxlcgkKLIEWVLEKYS--PFQTVFVCRD-E   48
ident            |     |        |                              |  
Sbjct dalevaekvTAVIFDKTG-----tlTKLK------ESAKPAVQELKrxGIKVGXITGDnW   49
DSSP  lhhhhhhhlLEEEEEHHH-----hhLLLL------LLHHHHHHHHHhlLLEEEEELLLlH


DSSP  HHHHHHHLLLLL-LEELlllLLLLhhHHHHHHHHHH--LLEEEEE---------------
Query KQAEKLSSRYEA-EFIWdlhKGVGsiAGIHAALRHF--GSCVVAA---------------   90
ident   ||  |        |                                            
Sbjct RSAEAISRELNLdLVIA---EVLP-hQKSEEVKKLQakEVVAFVGdgindapalaqadlg  105
DSSP  HHHHHHHHHHLLlEEEL---LLLH-hHHHHHHHHHLllLLEEEEElllllhhhhhhllee


DSSP  ------------lLLLL--LLHHhhhhhhhhhhhhllleeeeellllllleeeelhhhhh
Query ------------iDXPF--VKPEvlehlykegekagcdalipkhdypepllayyaesaad  136
ident              |                                              
Sbjct iavgsgdivlirdDLRDvvAAIQ-------------------------------------  128
DSSP  eeelllleeelllLLHHhhHHHL-------------------------------------


DSSP  hhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query elerailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                                            
Sbjct -----------------------------------------------------------  128
DSSP  -----------------------------------------------------------


No 114: Query=mol1A Sbjct=2g50D Z-score=3.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct afiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmn   60
DSSP  lllllllhhhhllllhhhhhhlllllllllllllleeeeelllllllhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct varmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgta  120
DSSP  eeeeelllllhhhhhhhhhhhhhhhhlllllllllllleeeeellllleellllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct evelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgp  180
DSSP  leeelllleeeeellhhhllllllleeelllllhhhhllllleeeelllleeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct dflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaad  240
DSSP  leeeeeeeeleeelllleeellllllllllllhhhhhhhhhhhhlllleeeelllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaq  300
DSSP  hhhhhhhhllllllleeeeeellhhhhhlhhhhhhhlleeeeehhhhhhhllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdy  360
DSSP  hhhhhhhhhhllleeeellllhhhhllllllhhhhhhhhhhhhhllleeeelhhhhllll


DSSP  -------------------------------------------------------LEEEE
Query -------------------------------------------------------XKVAV    5
ident                                                            |
Sbjct pleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaAALIV  420
DSSP  hhhhhhhhhhhhhhhhhlllhhhhhhhhhhhllllllhhhhhhhhhhhhhhhlllLLEEE


DSSP  ELLlllllllllhhhleelleehhhHHHHHHLL----LEEEEELLlhhhHHHHHLLLL--
Query LVGgvgrrigxektevxlcgkklieWVLEKYSP----FQTVFVCRdekqAEKLSSRYE--   59
ident |                                         | |               
Sbjct LTE--------------------sgRSAHQVARyrprAPIIAVTR----NHQTARQAHly  456
DSSP  ELL--------------------llHHHHHHHHllllLLEEEEEL----LHHHHHHHHhl


DSSP  --LLEELLLLLLL-----LHHHHHHHHHHHHL---------LEEEEE-------LLLLll
Query --AEFIWDLHKGV-----GSIAGIHAALRHFG---------SCVVAA-------IDXPfv   96
ident                           |                 |               
Sbjct rgIFPVVCKDPVQeawaeDVDLRVNLAMNVGKargffkkgdVVIVLTgwrpgsgFTNT--  514
DSSP  llEEEEELLLLLLllhhhHHHHHHHHHHHHHHhhlllllllEEEEEElllllllLLLE--


DSSP  lhhhhhhhhhhhhhhllleeeeelllllllEEEELHHhhhhhhhhhhllllllhhhhhll
Query kpevlehlykegekagcdalipkhdypeplLAYYAESaadelerailqgirkilvplerl  156
ident                                                             
Sbjct ------------------------------MRVVPVP-----------------------  521
DSSP  ------------------------------EEEEELL-----------------------


DSSP  leeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query nvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                        
Sbjct ---------------------------------------  521
DSSP  ---------------------------------------


No 115: Query=mol1A Sbjct=2j5tH Z-score=3.1

back to top
DSSP  --LEEEEELLLlllllllLHHHL--eellEEHHHHHHHHHLLL-----EEEEELL-----
Query --XKVAVLVGGvgrrigxEKTEV--xlcgKKLIEWVLEKYSPF-----QTVFVCR-----   46
ident       |  |                      |                 | |       
Sbjct dsQTLVVKLGT-------SVLTGgsrrlnRAHIVELVRQCAQLhaaghRIVIVTSgaiaa   53
DSSP  llLEEEEEELH-------HHHHLllllllHHHHHHHHHHHHHHhhlllEEEEEELlhhhh


DSSP  --------------------lhhhhHHHHLLLL---------------------------
Query --------------------dekqaEKLSSRYE---------------------------   59
ident                            |    |                           
Sbjct grehlgypelpatiaskqllaavgqSRLIQLWEqlfsiygihvgqmlltradmedrerfl  113
DSSP  hhhhlllllllllhhhhhhhhhhhhHHHHHHHHhhhhhlllleeeeeellhhhllhhhhh


DSSP  --------------lLEELLL--------LLLLLHHHHHHHHHHhHLLEEEEELL-----
Query --------------aEFIWDL--------HKGVGSIAGIHAALRhFGSCVVAAID-----   92
ident                  |             |        ||    |             
Sbjct nardtlralldnnvvPVINENdavataeiKVGDNDNLSALAAIL-AGADKLLLLTdqkgl  172
DSSP  hhhhhhhhhhhllleEEEEELlllllhhhLLLLHHHHHHHHHHH-HLLLEEEEEElllll


DSSP  ---------------------------------LLLLL--HHHHHHHhhhhhhhlllEEE
Query ---------------------------------XPFVK--PEVLEHLykegekagcdALI  117
ident                                           | |             | 
Sbjct yelikdvygidmstklqaadvacragidtiiaaGSKPGviGDVMEGI-------svgTLF  225
DSSP  llllleeellllhhhhhhhhhhhhllleeeeeeLLLLLhhHHHHLLL-------lllEEE


DSSP  EellllllleeeelhhhhhhhhhhhhllllllhhhHHLL---------------------
Query PkhdypepllayyaesaadelerailqgirkilvpLERL---------------------  156
ident                                                             
Sbjct H---------------------------------aQATPlenrkrwifgappageitvde  252
DSSP  E---------------------------------lLLLLllhhhhhhhlllllleeeelh


DSSP  ----------------------------------------------leeeeehhhhllll
Query ----------------------------------------------nvvyypveklrkfd  170
ident                                                             
Sbjct gataailergssllpkgiksvtgnfsrgeviricnlegrdiahgvsrynsdalrriaghh  312
DSSP  hhhhhhhlllllllhhheeeeellllllleeeeellllleeeeeeelllhhhhhhhllll


DSSP  lllhhhlllllhhhhhhhhhhhhhl
Query kelisffnintpddlkraeeicskx  195
ident                          
Sbjct sqeidailgyeygpvavhrddmitr  337
DSSP  llhhhhhhlllllllleeeeeeeel


No 116: Query=mol1A Sbjct=2vqdA Z-score=3.1

back to top
DSSP  --LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHHHHl
Query --XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEKLSs   56
ident    ||                             |         || |         |  
Sbjct mlEKVLIAN-----------------rgEIALRILRACKelGIKTVAVH-STAD-RELMh   41
DSSP  llLEEEELL-----------------lhHHHHHHHHHHHhlLLEEEEEE-EHHH-LLLHh


DSSP  lLLLL-EELL-----llllLLHHHHHHHHHHHHllEEEEELLlllllhhhhhhhhhhhhh
Query rYEAE-FIWD-----lhkgVGSIAGIHAALRHFgsCVVAAIDxpfvkpevlehlykegek  110
ident    |                   | | ||                               
Sbjct lSLADeSVCIgpapatqsyLQIPAIIAAAEVTG-aTAIHPGY-------gflaenadfae   93
DSSP  hHHLLeEEEEelllhhhllLLHHHHHHHHHHHL-lLEEELLL-------llllllhhhhh


DSSP  hlLLEE-----eEELLLL------------------------------------------
Query agCDAL-----iPKHDYP------------------------------------------  123
ident                                                             
Sbjct qiERSGftfvgpTAEVIRlmgdkvsakdamkragvptvpgsdgplpedeetalaiarevg  153
DSSP  hhHHLLleelllLHHHHHhhhlhhhhhhhhhhllllllllllllllllhhhhhhhhhhhl


DSSP  ---------------------llleeeelhhhhhhhhhhhhllllllhhhhhllleeeee
Query ---------------------epllayyaesaadelerailqgirkilvplerlnvvyyp  162
ident                                                             
Sbjct ypviikaagggggrgmrvvydeseliksakltrteagaafgnpmvylekfltnprhvevq  213
DSSP  lleeeeelllllllleeeellhhhhhhhhhhhhhhhhhhhlllleeeeellllleeeeee


DSSP  hhhHLLLLL----------------------------------------------lLHHH
Query vekLRKFDK----------------------------------------------eLISF  176
ident                                                             
Sbjct vlsDGQGNAihlgdrdcslqrrhqkvieeapapgidekarqevfarcvqacieigyRGAG  273
DSSP  eeeELLLLEeeeeeeellleelleeleeeellllllhhhhhhhhhhhhhhhhhhllEEEE


DSSP  ------------------LLLLlhhhhhHHHHHHHHL-----------------------
Query ------------------FNINtpddlkRAEEICSKX-----------------------  195
ident                                                             
Sbjct tfeflyengrfyfiemntRVQV------EHPVSEMVTgvdivkemlriasgeklsirqed  327
DSSP  eeeeeeelleeeeeeeelLLLL------LHHHHHHHHlllhhhhhhhhhllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vvirghalecrinaedpktfmpspgkvkhfhapggngvrvdshlysgysvppnydslvgk  387
DSSP  llllleeeeeeeellllllllllleeeleeelllllleeeeellllleeelllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vitygadrdealarmrnaldelivdgiktntelhkdlvrdaafckggvnihylekklgmd  447
DSSP  eeeeellhhhhhhhhhhhhhhleeelllllhhhhhhhlllhhhhhllllllhhhhhhlll


No 117: Query=mol1A Sbjct=2ij9B Z-score=3.1

back to top
DSSP  LEEEEELLLlllllllLHHHLEellEEHHHHHHHHHLLL----EEEEELL----------
Query XKVAVLVGGvgrrigxEKTEVXlcgKKLIEWVLEKYSPF----QTVFVCR----------   46
ident  ||    ||                   |              |   |            
Sbjct MKVVLSLGG-------SVLSNE---SEKIREFAKTIESVaqqnQVFVVVGggklareyik   50
DSSP  LEEEEEELL-------LLLLLL---HHHHHHHHHHHHHHhhhlEEEEEELlhhhhhhhhh


DSSP  ----------------LHHHHHHHHLLLL------------------------lLEELLL
Query ----------------DEKQAEKLSSRYE------------------------aEFIWDL   66
ident                                                             
Sbjct sarelgasetfcdyigIAATRLNAMLLISaipsaakkvpvdfmeaeelsklyrvVVMGGT  110
DSSP  hhhhllllhhhhhhhhHHHHHHHHHHHHHhlllllllllllhhhhhhhhlllleEEELLL


DSSP  LL-LLLHHHHHHHHHHhHLLEEEEELL---------------------------------
Query HK-GVGSIAGIHAALRhFGSCVVAAID---------------------------------   92
ident              |       |                                      
Sbjct FPgHTTDATAALLAEF-IKADVFINATnvdgvysadpksdtsavkydrlspqqlveivsr  169
DSSP  LLlLLLHHHHHHHHHH-LLLLEEEEEElllllllllllllllllllleelhhhhhhhlll


DSSP  ---------------------------LLLLL-HHHHHHHhhhhhhhlllEEEEelllll
Query ---------------------------XPFVK-PEVLEHLykegekagcdALIPkhdype  124
ident                                                     |       
Sbjct ssgtnvvidllaakiierskiktyvilGTPENiMKAVKGE-------avgTVIA------  216
DSSP  lllllllllhhhhhhhhhhllleeeeeLLHHHhHHHHLLL-------lllEEEL------


DSSP  lleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhh
Query pllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkelisffnintpdd  184
ident                                                             
Sbjct ------------------------------------------------------------  216
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhl
Query lkraeeicskx  195
ident            
Sbjct -----------  216
DSSP  -----------


No 118: Query=mol1A Sbjct=1f0kA Z-score=3.1

back to top
DSSP  LEEEEELLllllllllLHHHleelleeHHHHHHHHHLL-----LEEEEELlLHHH--HHH
Query XKVAVLVGgvgrrigxEKTEvxlcgkkLIEWVLEKYSP-----FQTVFVCrDEKQ--AEK   53
ident     |  |                        |           |            |  
Sbjct KRLMVMAG--------GTGG-------HVFPGLAVAHHlmaqgWQVRWLG-TADRmeADL   44
DSSP  LEEEEELL--------LLHH-------HHHHHHHHHHHhhlllLEEEEEE-LLLLlhHHH


DSSP  HHlLLLLLEELLLL----------------llllhhhhhHHHHHHHLLEEEEELL-----
Query LSsRYEAEFIWDLH----------------kgvgsiagiHAALRHFGSCVVAAID-----   92
ident        |                                |        ||         
Sbjct VP-KHGIEIDFIRIsglrgkgikaliaaplrifnawrqaRAIMKAYKPDVVLGMGgyvsg  103
DSSP  HH-HHLLEEEELLLlllllllhhhhhllhhhhhhhhhhhHHHHHHHLLLEEEELLlllhh


DSSP  --------------LLLL------------------------------------------
Query --------------XPFV------------------------------------------   96
ident                                                             
Sbjct pgglaawslgipvvLHEQngiagltnkwlakiatkvmqafpgafpnaevvgnpvrtdvla  163
DSSP  hhhhhhhhlllleeEEELlllllhhhhhhllllleeeellllllllleellllllhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct lplpqqrlagregpvrvlvvggsqgarilnqtmpqvaaklgdsvtiwhqsgkgsqqsveq  223
DSSP  lllhhhhhlllllleeeeeellllllhhhhhhhhhhhhhhhhheeeeeelllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct ayaeagqpqhkvtefiddmaaayawadvvvcrsgaltvseiaaaglpalfvpfqhkdrqq  283
DSSP  hhhhlllllleeelllllhhhhhhhlleeeelllhhhhhhhhhhllleeellllllllhh


DSSP  --------------------------------------------------------LHHH
Query --------------------------------------------------------KPEV  100
ident                                                             
Sbjct ywnalplekagaakiieqpqlsvdavantlagwsretlltmaeraraasipdaterVANE  343
DSSP  hhhhhhhhhllleeellhhhllhhhhhhhhhlllhhhhhhhhhhhhhlllllhhhhHHHH


DSSP  HHHHHHHHhhhllleeeeellllllleeeelhhhhhhhhhhhhllllllhhhhhllleee
Query LEHLYKEGekagcdalipkhdypepllayyaesaadelerailqgirkilvplerlnvvy  160
ident                                                             
Sbjct VSRVARAL----------------------------------------------------  351
DSSP  HHHHHLLL----------------------------------------------------


DSSP  eehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query ypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                    
Sbjct -----------------------------------  351
DSSP  -----------------------------------


No 119: Query=mol1A Sbjct=3c85A Z-score=3.1

back to top
DSSP  -------LEEEEELllllllllllhhhleelleEHHHHHHHHHL---LLEEEEELLLHHH
Query -------XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS---PFQTVFVCRDEKQ   50
ident          |  |                                            |  
Sbjct qlinpghAQVLILG-----------------xgRIGTGAYDELRaryGKISLGIEIREEA   43
DSSP  lllllllLLEEEEL-----------------llHHHHHHHHHHHhhhLLLEEEEELLHHH


DSSP  HHHHHLLlLLLEELLlllllLHHH-hhhhhhhhHLLE-EEEELllllllhhhhhhhhhhh
Query AEKLSSRyEAEFIWDlhkgvGSIA-gihaalrhFGSC-VVAAIdxpfvkpevlehlykeg  108
ident |    |      |                     |    |                    
Sbjct AQQHRSE-GRNVISG-----DATDpdfwerildTGHVkLVLLA-----xphhqgnqtale   92
DSSP  HHHHHHL-LLLEEEL-----LLLLhhhhhllllLLLLlEEEEL-----lllhhhhhhhhh


DSSP  hhhlLLEE-------------eeelLLLLLleeeelhhhhhhhhhhhhllllllhhhhhl
Query ekagCDAL-------------ipkhDYPEPllayyaesaadelerailqgirkilvpler  155
ident                                                             
Sbjct qlqrRNYKgqiaaiaeypdqlegllESGVD------------------------------  122
DSSP  hhhhLLLLleeeeeellhhhhhhhhHHLLL------------------------------


DSSP  lleeeeehhhhlllllllhHHLLLllhhhhHHHHHHHHHL-------------
Query lnvvyypveklrkfdkeliSFFNIntpddlKRAEEICSKX-------------  195
ident                      |||                             
Sbjct -------------------AAFNI------YSEAGSGFARhvckqlepqftsi  150
DSSP  -------------------EEEEH------HHHHHHHHHHhhhhhhlllllll


No 120: Query=mol1A Sbjct=1vl2A Z-score=3.1

back to top
DSSP  -LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLL---hhhhHHH
Query -XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRD---ekqaEKL   54
ident   ||                             |       |                  
Sbjct kEKVVLAY----------------sggLDTSVILKWLCekGFDVIAYVANvgqkddfVAI   44
DSSP  lLEEEEEL----------------lllHHHHHHHHHHHhlLLEEEEEEEEllllllhHHH


DSSP  HLLLL----LLEEL------------------------------lllllLLHHHHHHHHH
Query SSRYE----AEFIW------------------------------dlhkgVGSIAGIHAAL   80
ident                                                           | 
Sbjct KEKALktgaSKVYVedlrrefvtdyiftallgnamyegryllgtaiarpLIAKRQVEIAE  104
DSSP  HHHHHhhllLEEEEeelhhhhhhhlhhhhhllllllllllllhhhhhhhHHHHHHHHHHH


DSSP  HhHLLEEEEELLlllllhhhhhhhhhhhhhhllLEEEeellllllleeeelhhhhhhhhh
Query RhFGSCVVAAIDxpfvkpevlehlykegekagcDALIpkhdypepllayyaesaadeler  140
ident    |   ||                                                   
Sbjct K-EGAQYVAHGA-----tgkgndqvrfeltyaaLNPN-----------------------  135
DSSP  H-HLLLEEELLL-----lllllhhhhhhhhhhhHLLL-----------------------


DSSP  hhhllllllhhhhhllleeeeehhhhlllllllhHHLLlllhhhHHHHHHHH--------
Query ailqgirkilvplerlnvvyypveklrkfdkeliSFFNintpddLKRAEEIC--------  192
ident                                             |               
Sbjct ----------------------------lkvispWKDP----efLAKFKTDLinyamekg  163
DSSP  ----------------------------leeelhHHLH----hhHHHLLLHHhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  192
ident                                                             
Sbjct ipikvskkrpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfe  223
DSSP  llllllllllleeeelllleeeelhhhhlllllllhhhlllllllllllllleeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  192
ident                                                             
Sbjct ngipvkvvnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgat  283
DSSP  lleeeeeeellllleellhhhhhhhhhhhhhhlllleeeeeeellllleeeeeeelhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  192
ident                                                             
Sbjct ilwiahrdlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgk  343
DSSP  hhhhhhhhhhhhhllhhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhllllee


DSSP  ----------------------------------------------------hhl
Query ----------------------------------------------------skx  195
ident                                                        
Sbjct vtvsiykgnvmpvaryspyslynpggfdatdskgfinihalrlkvhqlvkkgyqr  398
DSSP  eeeeeelleeeeeeeellllllllllllhhhhhhhhhhhhhhhhhhhhhhlllll


No 121: Query=mol1A Sbjct=1rjwA Z-score=3.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg   60
DSSP  leeeelllllllleeeellllllllleeeeeeeeeeelhhhhhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy  120
DSSP  lleeeeeeeellllllllllleeeelleeelllllhhhhlllhhhlllleelllllllll


DSSP  ---------------------------------------------LEEEEELllllllll
Query ---------------------------------------------XKVAVLVggvgrrig   15
ident                                                ||           
Sbjct aeycraaadyvvkipdnlsfeeaapifcagvttykalkvtgakpgEWVAIYG--------  172
DSSP  lleeeeehhhleellllllhhhhhhhhlhhhhhhhhhhhhlllllLEEEEEL--------


DSSP  llhhhleelleEHHHHHHHHHL--LLEEEEELLlHHHHHHhhlLLLL-LEELLLLLlllh
Query xektevxlcgkKLIEWVLEKYS--PFQTVFVCRdEKQAEKlssRYEA-EFIWDLHKgvgs   72
ident             |               | |       |       |      |      
Sbjct ---------igGLGHVAVQYAKamGLNVVAVDIgDEKLEL-akELGAdLVVNPLKE----  218
DSSP  ---------llLLHHHHHHHHHhlLLEEEEELLlHHHHHH-hhHLLLlEEELLLLL----


DSSP  hHHHHHHHHHHLLE-EEEELLlllllhhhhhhhhhhhhhhlllEEEEellllllleeeel
Query iAGIHAALRHFGSC-VVAAIDxpfvkpevlehlykegekagcdALIPkhdypepllayya  131
ident            |                                                
Sbjct -DAAKFMKEKVGGVhAAVVTA--------vskpafqsaynsirRGGA-------------  256
DSSP  -LHHHHHHHHHLLEeEEEELL--------llhhhhhhhhhheeEEEE-------------


DSSP  hhhhhhhhhhhhllllllhHHHHLL--LEEEEehhhhlllllllhHHLLLllhhhhhhHH
Query esaadelerailqgirkilVPLERL--NVVYYpveklrkfdkeliSFFNIntpddlkrAE  189
ident                                                             
Sbjct --------cvlvglppeemPIPIFDtvLNGIK------------iIGSIV--------GT  288
DSSP  --------eeelllllleeEEEHHHhhHLLLE------------eEELLL--------LL


DSSP  HHHHHL---------------------------------------------
Query EICSKX---------------------------------------------  195
ident                                                    
Sbjct RKDLQEalqfaaegkvktiievqplekinevfdrmlkgqingrvvltledk  339
DSSP  HHHHHHhhhhhhllllllleeeeehhhhhhhhhhhhlllllleeeeellll


No 122: Query=mol1A Sbjct=1liuB Z-score=3.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar   60
DSSP  llllhhhhllllhhhhhllllllllllllllleeeeellhhhllhhhhhhhhhhleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgivelvkgsqvl  120
DSSP  eelllllhhhhhhhhhhhhhhhhlllllllllllleeeeellllllllllleelllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vtantvwvdypnivrvvpvggriyiddglislvvvtqvenggvlgsrkgvnlpgaqvdlp  180
DSSP  ellleellllllhhhhllllleeeelllleeeelleeeeeleelllllleelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct glseqdvrdlrfgvehgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkr  240
DSSP  lllhhhhhhhhhhhhlllleeeelllllhhhhhhhhhhhlhhhllleeeeeellhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct fdeilevsdgimvargdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkpr  300
DSSP  hhhhhhhlleeeeehhhhhhhllhhhhhhhhhhhhhhhhhhllleeeellllhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ptraetsdvanavldgadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfeelr  360
DSSP  llhhhhhhhhhhhhhllleeeelhhhhllllhhhhhhhhhhhhhhhhhhllhhhhhhhhh


DSSP  --------------------------LEEEEELLlllllllllhhhleelleehhHHHHH
Query --------------------------XKVAVLVGgvgrrigxektevxlcgkkliEWVLE   34
ident                               ||                            
Sbjct raaplsrdptevtaigaveaafkccaAAIIVLTT----------------tgrsaQLLSR  404
DSSP  hhllllllhhhhhhhhhhhhhhhhllLEEEEELL----------------llhhhHHHHH


DSSP  HhLLLEEEEELLLHHHHHHHhLLLL-LLEELLLL-----lllLHHHHHHHHHHHHL----
Query KySPFQTVFVCRDEKQAEKLsSRYE-AEFIWDLH-----kgvGSIAGIHAALRHFG----   84
ident          | |    |                                           
Sbjct YrPRAAVIAVTRSAQAARQV-HLCRgVFPLLYREppeaiwadDVDRRVQFGIESGKlrgf  463
DSSP  LlLLLEEEEEELLHHHHHHH-HHLLlEEEEELLLlllllhhhHHHHHHHHHHHHHHhhll


DSSP  -----LEEEEE------lLLLLllhhhhhhhhhhhhhhllleeeeelllllllEEEELHh
Query -----SCVVAA------iDXPFvkpevlehlykegekagcdalipkhdypeplLAYYAEs  133
ident         |                                                   
Sbjct lrvgdLVIVVTgwrpgsgYTNI-------------------------------MRVLSI-  491
DSSP  lllllEEEEEEellllllLEEE-------------------------------EEEEEL-


DSSP  hhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhh
Query aadelerailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeics  193
ident                                                             
Sbjct ------------------------------------------------------------  491
DSSP  ------------------------------------------------------------


DSSP  hl
Query kx  195
ident   
Sbjct --  491
DSSP  --


No 123: Query=mol1A Sbjct=3fdxA Z-score=3.1

back to top
DSSP  -LEEEEELLllllllLLLHhhleelleEHHHHHHHHHL---LLEEEEELLL--------h
Query -XKVAVLVGgvgrriGXEKtevxlcgkKLIEWVLEKYS---PFQTVFVCRD--------e   48
ident      |                       |    |           |             
Sbjct sNAILVPID---isdKEFT--------ERIISHVESEAridDAEVHFLTVIpsgxdelre   49
DSSP  lLEEEEELL---lllLLLL--------LLHHHHHHHHHhhhLLEEEEEEEElllhhhhhh


DSSP  HHHHHHHLLLL--------LLEELLllLLLLHHHHHHHHHHhhLLEE-EEELLlllllhh
Query KQAEKLSSRYE--------AEFIWDlhKGVGSIAGIHAALRhfGSCV-VAAIDxpfvkpe   99
ident      |               |      |         |         |           
Sbjct GSETQLKEIAKkfsipedrXHFHVA--EGSPKDKILALAKS--LPADlVIIAS-------   98
DSSP  HHHHHHHHHHLlllllhhhEEEEEE--ELLHHHHHHHHHHH--LLLLeEEEEL-------


DSSP  hhhhhhhhhhhhllleeeeellllllleeeelhhhhhhhhhhhhllllllhhhhhlllee
Query vlehlykegekagcdalipkhdypepllayyaesaadelerailqgirkilvplerlnvv  159
ident                                                             
Sbjct ------------------------------------------------------------   98
DSSP  ------------------------------------------------------------


DSSP  eeehhhhlllllllhhhlLLLLhhHHHHH-------------hhhhhhl
Query yypveklrkfdkelisffNINTpdDLKRA-------------eeicskx  195
ident                                                  
Sbjct ------------------HRPD--ITTYLlgsnaaavvrhaecsvlvvr  127
DSSP  ------------------LLLL--LLLLLllhhhhhhhhhllleeeeel


No 124: Query=mol1A Sbjct=2bneB Z-score=3.0

back to top
DSSP  -------LEEEEELLLLlllllllHHHL--eellEEHHHHHHHHHLL-----LEEEEELL
Query -------XKVAVLVGGVgrrigxeKTEV--xlcgKKLIEWVLEKYSP-----FQTVFVCR   46
ident                |                                     |   |  
Sbjct tnakpvyKRILLKLSGE-------ALQGtefgidASILDRMAQEIKElvelgIQVGVVIG   53
DSSP  lllllllLEEEEEELLH-------HHHLllllllHHHHHHHHHHHHHhhhllLEEEEEEL


DSSP  ---------------------------LHHHHHHHHLLL---------------------
Query ---------------------------DEKQAEKLSSRY---------------------   58
ident                                                             
Sbjct ggnlfrgaglakagmnrvvgdhmgmlaTVMNGLAMRDALhrayvnarlmsaiplngvcds  113
DSSP  llllllhhhhhhllllhhhhhhhhhhhHHHHHHHHHHHHhhlllleeeeellllllllee


DSSP  -------------llLEEL-LLLL--LLLHHHHHHHHHHhHLLEEEEELL-lllllhhhh
Query -------------eaEFIW-DLHK--GVGSIAGIHAALRhFGSCVVAAID-xpfvkpevl  101
ident                                |            ||              
Sbjct yswaeaisllrnnrvVILSaGTGNpfFTTDSAACLRGIE-IEANVVLKATkvdgvftadp  172
DSSP  llhhhhhhhhhllleEEEElLLLLllLLHHHHHHHHHHH-LLLLEEEEEEllllllllll


DSSP  hhhhhhhhhhllleeeeeLLLLLLleeeelhhhhhhhhhhhhlllLLLHhhHHLL----l
Query ehlykegekagcdalipkHDYPEPllayyaesaadelerailqgiRKILvpLERL----n  157
ident                                                             
Sbjct akdptatmyeqltysevlEKELKV------------------mdlAAFTlaRDHKlpirv  214
DSSP  lllllllllleeellhhhHLLLLL------------------llhHHHHhhHHLLlleee


DSSP  eeeeehhhhllllllLHHHLllllhhhhhhhhhhhhhl
Query vvyypveklrkfdkeLISFFnintpddlkraeeicskx  195
ident                                       
Sbjct fnmnkpgalrrvvmgEKEGT--------------lite  238
DSSP  eelllllhhhhhhhlLLLLE--------------eeel


No 125: Query=mol1A Sbjct=2a1fC Z-score=3.0

back to top
DSSP  -----LEEEEELLLlllllllLHHHLE---ellEEHHHHHHHHHLLL-----EEEEELL-
Query -----XKVAVLVGGvgrrigxEKTEVX---lcgKKLIEWVLEKYSPF-----QTVFVCR-   46
ident              |       |                                  |   
Sbjct sqpiyKRILLKLSG-------EALQGEdglgidPAILDRMAVEIKELvemgvEVSVVLGg   53
DSSP  lllllLEEEEEELH-------HHLLLLllllllHHHHHHHHHHHHHHhllllEEEEEELl


DSSP  ----------------------lHHHHHHHHLLLL-------------------------
Query ----------------------dEKQAEKLSSRYE-------------------------   59
ident                                                             
Sbjct gnlfrgaklakagmnrvvgdhmgMLATVMNGLAMRdslfradvnaklmsafqlngicdty  113
DSSP  llllllhhhhhllllhhhhhhhhHHHHHHHHHHHHhhhhhlllleeeeelllllllleel


DSSP  -------------lLEEL-LLLL--LLLHHHHHHHHHHhHLLEEEEELL-----------
Query -------------aEFIW-DLHK--GVGSIAGIHAALRhFGSCVVAAID-----------   92
ident                                            ||               
Sbjct nwseaikmlrekrvVIFSaGTGNpfFTTDSTACLRGIE-IEADVVLKATkvdgvydcakl  172
DSSP  lhhhhhhhhhllleEEEElLLLLllLLHHHHHHHHHHH-LLLLEEEEEElllllllllll


DSSP  ------------------------------------LLLLL--HHHHHHHhhhhhhhlll
Query ------------------------------------XPFVK--PEVLEHLykegekagcd  114
ident                                              |              
Sbjct yknlsyaevidkelkvmdlsaftlardhgmpirvfnMGKPGalRQVVTGT-------eeg  225
DSSP  lleeehhhhhhlllllllhhhhhhhhhhllleeeeeLLLLLhhHHHHLLL-------lll


DSSP  eEEEELlllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllh
Query aLIPKHdypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkeli  174
ident   |                                                         
Sbjct tTICEG------------------------------------------------------  231
DSSP  eEEELL------------------------------------------------------


DSSP  hhlllllhhhhhhhhhhhhhl
Query sffnintpddlkraeeicskx  195
ident                      
Sbjct ---------------hhhhhh  237
DSSP  ---------------llllll


No 126: Query=mol1A Sbjct=1lu9A Z-score=3.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct skkllfqfdtdatpsvfdvvvgydggadhitgygnvtpdnvgayvdgtiytrggkekqst   60
DSSP  llleeeeeellllllhhhhhhhhhlllleeeeelllllllhhhhhhhhhllllhhhhhhe


DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------X    1
ident                                                             
Sbjct aifvgggdmaagervfeavkkrffgpfrvscmldsngsnttaaagvalvvkaaggsvkgK  120
DSSP  eeeeelllhhhhhhhhhhhhhhllllllleeeellllhhhhhhhhhhhhhhhlllllllL


DSSP  EEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHHHHHHLLLL
Query KVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQAEKLSSRYE   59
ident |  ||                                     |   |    |        
Sbjct KAVVLA----------------gtgPVGMRSAALLAgeGAEVVLCGRKLDKAQAAADSVN  164
DSSP  EEEEEL----------------lllHHHHHHHHHHHhlLLEEEEEELLHHHHHHHHHHHH


DSSP  ------LLEELLllllLLHHHHHHHHHhhhLLEEEEELllllllhhhhhhhhhhhhhhll
Query ------AEFIWDlhkgVGSIAGIHAALrhfGSCVVAAIdxpfvkpevlehlykegekagc  113
ident                         |     |   |                         
Sbjct krfkvnVTAAET----ADDASRAEAVK---GAHFVFTA--gaiglellpqaawqnessie  215
DSSP  hhhlllLEEEEL----LLHHHHHHHLL---LLLEEEEL--lllllllllhhhhlllllll


DSSP  leeeeelllLLLLeeeelhhhhhhhhhhhhllllllhhhhhllleeeeeHHHHlllllll
Query dalipkhdyPEPLlayyaesaadelerailqgirkilvplerlnvvyypVEKLrkfdkel  173
ident          |                                                  
Sbjct ivadynaqpPLGI--------------------------ggidatdkgkEYGG------k  243
DSSP  eeeelllllLLLL--------------------------llllllleeeEELL------e


DSSP  hHHLLLllhhHHHHHHHHHHHL-------------------------
Query iSFFNIntpdDLKRAEEICSKX-------------------------  195
ident   |                                            
Sbjct rAFGAL---gIGGLKLKLHRACiaklfessegvfdaeeiyklakema  287
DSSP  eEELHH---hHHHHHHHHHHHHhhhhlllllleelhhhhhhhhhhhl


No 127: Query=mol1A Sbjct=1gn8A Z-score=3.0

back to top
DSSP  --LEEEEELLllllllllLHHHleelleEHHHHHHHHHLL--LEEEEELLL---------
Query --XKVAVLVGgvgrrigxEKTEvxlcgkKLIEWVLEKYSP--FQTVFVCRD---------   47
ident                                                             
Sbjct mqKRAIYPGT-------fDPIT------NGHIDIVTRATQmfDHVILAIAAspskkpmft   47
DSSP  llLEEEEEEL-------lLLLL------HHHHHHHHHHHLllLEEEEEEELlllllllll


DSSP  -hHHHHHHHLLLL----LLEELLLlllllhHHHHHHHHHHHllEEEEElllLLLLhhhhh
Query -eKQAEKLSSRYE----AEFIWDLhkgvgsIAGIHAALRHFgsCVVAAidxPFVKpevle  102
ident                   |                 |       |               
Sbjct leERVALAQQATAhlgnVEVVGFS------DLMANFARNQH-aTVLIR---GLRA-----   92
DSSP  hhHHHHHHHHHLLllllEEEEEEL------LLHHHHHHHLL-lLEEEE---ELLL-----


DSSP  hhhhhhhhhllleeeeellLLLLleeeelhHHHHhhhhhhhllllllhhhhhllleeeee
Query hlykegekagcdalipkhdYPEPllayyaeSAADelerailqgirkilvplerlnvvyyp  162
ident                                                             
Sbjct ------------vadfeyeMQLA---hmnrHLMP-------------------------e  112
DSSP  ------------lllhhhhHHHH---hhhhHHLL-------------------------l


DSSP  hhhhlllllllhhhlllLLHHH--------------hhhhhhhhhhl
Query veklrkfdkelisffniNTPDD--------------lkraeeicskx  195
ident                                                
Sbjct lesvflmpskewsfissSLVKEvarhqgdvthflpenvhqalmakla  159
DSSP  leeeeelllhhhllllhHHHHHhhhlllllhhhllhhhhhhhhhhhl


No 128: Query=mol1A Sbjct=3grpD Z-score=3.0

back to top
DSSP  -------LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELllhhHH
Query -------XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrdekQA   51
ident         |  |                        |                       
Sbjct smfkltgRKALVTG----------------atgGIGEAIARCFHaqGAIVGLHG---tRE   41
DSSP  lllllllLEEEELL----------------lllHHHHHHHHHHHhlLLEEEEEE---lLH


DSSP  HHHHLLLL-----LLEEL--llLLLLLhHHHHHHHHHHHLLE-EEEELL-----------
Query EKLSSRYE-----AEFIW--dlHKGVGsIAGIHAALRHFGSC-VVAAID-----------   92
ident  ||                               | |                       
Sbjct DKLKEIAAdlgkdVFVFSanlsDRKSI-KQLAEVAEREMEGIdILVNNAgidqdwddvla  100
DSSP  HHHHHHHHhhlllEEEEEllllLHHHH-HHHHHHHHHHHLLLlEEEELLlllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct vnltaastltrelihsmmrrrygriinitsiqtnycaakagligfskalaqeiasrnitv  160
DSSP  hhlhhhhhhhhhhhhhhhhhlleeeeeellllhhhhhhhhhhhhhhhhhhhhhhhhleee


DSSP  ---------------------lLLLLHHHHHHhhhhhhhhllleeeeellllllleeeel
Query ---------------------xPFVKPEVLEHlykegekagcdalipkhdypepllayya  131
ident                        |                                    
Sbjct nciapgfikmipmkrmgigeeiAFATVYLASD----------------------------  192
DSSP  eeeeelllllllllllllhhhhHHHHHHHHLH----------------------------


DSSP  hhhhhhhhhhhhllllllhhhhhllleeeeehHHHLlllLLLHhhlllllhhhhhhhhhH
Query esaadelerailqgirkilvplerlnvvyypvEKLRkfdKELIsffnintpddlkraeeI  191
ident                                   |                         
Sbjct ------------------------------eaAYLT---GQTL----------------H  203
DSSP  ------------------------------hhLLLL---LLEE----------------E


DSSP  HHH--l
Query CSK--x  195
ident       
Sbjct INGgma  209
DSSP  ELLlll


No 129: Query=mol1A Sbjct=1ni5A Z-score=3.0

back to top
DSSP  -------------LEEEEELLlllllllllhhhleelleEHHHHHHHHHLL-------LE
Query -------------XKVAVLVGgvgrrigxektevxlcgkKLIEWVLEKYSP-------FQ   40
ident                  |                           |              
Sbjct sxtltlnrqlltsRQILVAFS----------------ggLDSTVLLHQLVQwrtenpgVA   44
DSSP  lhhhhhhhhhlllLEEEEELL----------------llHHHHHHHHHHHHhhlllllLE


DSSP  EEEELLL-------hHHHHHHHLLLL---LLEELLLLL-------------lLLHHHHHH
Query TVFVCRD-------eKQAEKLSSRYE---AEFIWDLHK-------------gVGSIAGIH   77
ident                                                         |   
Sbjct LRAIHVHhglsanadAWVTHCENVCQqwqVPLVVERVQlaqeglgieaqarqARYQAFAR  104
DSSP  EEEEEELllllllhhHHHHHHHHHHHhllLLEEEELLLllllllllllhhhhHHHHHHHH


DSSP  HHHhhhLLEEEEELL-----lllllhhhhhhhhhhhhhhlllEEEEellllLLLEeeelh
Query AALrhfGSCVVAAID-----xpfvkpevlehlykegekagcdALIPkhdypEPLLayyae  132
ident   |      |                                           |      
Sbjct TLL---PGEVLVTAQhlddqcetfllalkrgsgpaglsaxaeVSEF---agTRLI-----  153
DSSP  LLL---LLEEEELLLlhhhhhhhhhhhhlllllllhhhllllEEEE---llEEEE-----


DSSP  hhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhHLLLllhhhhhhHHHH-
Query saadelerailqgirkilvplerlnvvyypveklrkfdkelisFFNIntpddlkrAEEI-  191
ident                                                             
Sbjct ------------------------------------------rPLLA-------rTRGEl  164
DSSP  ------------------------------------------lHHHL-------lLHHHh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  191
ident                                                             
Sbjct vqwarqydlrwiedesnqddsydrnflrlrvvpllqqrwphfaeatarsaalcaeqesll  224
DSSP  hhhhhhllllllllllhhhlllhhhhhhhlhhhhhhhhlllhhhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  191
ident                                                             
Sbjct delladdlahcqspqgtlqivpxlaxsdarraaiirrwlagqnapxpsrdalvriwqeva  284
DSSP  hhhhhhhhhhhlllllleelhhhllllhhhhhhhhhhhhhhlllllllhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  191
ident                                                             
Sbjct laredaspclrlgafeirryqsqlwwiksvtgqsenivpwqtwlqplelpaglgsvqlna  344
DSSP  lllhhhlleeeelleeeeellleeeeeelllllllleeellllllleelllllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  191
ident                                                             
Sbjct ggdirppradeavsvrfkapgllhivgrnggrklkkiwqelgvppwlrdttpllfygetl  404
DSSP  eeeelllllllleeeellllleelllllllleehhhhhhhhlllhhhllllleeeellee


DSSP  -------------------------hhhl
Query -------------------------cskx  195
ident                              
Sbjct iaaagvfvtqegvaegengvsfvwqktls  433
DSSP  eeellleelhhhllllllleeeeeellll


No 130: Query=mol1A Sbjct=1yqdA Z-score=3.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct speeehpvkafgwaardqsghlspfnfsrratgeedvrfkvlycgvchsdlhsikndwgf   60
DSSP  lhhhhlleeeeeeeelllllleeeeeeeelllllleeeeeeeeeeelhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct smyplvpgheivgevtevgskvkkvnvgdkvgvgclvgachscescandlenycpkmilt  120
DSSP  lllllllllleeeeeeeellllllllllleeeelleeelllllhhhhlllhhhlllleel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct yasiyhdgtityggysnhmvaneryiirfpdnmpldggapllcagitvysplkyfgldep  180
DSSP  llllllllllllllllleeeeehhhleellllllllllhhhhlhhhhhhhhhhhllllll


DSSP  -LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHHHHHHLL
Query -XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQAEKLSSR   57
ident                             |                         |     
Sbjct gKHIGIVG-----------------lgGLGHVAVKFAKafGSKVTVISTSPSKKEEALKN  223
DSSP  lLEEEEEL-----------------llHHHHHHHHHHHhlLLEEEEEELLHHHHHHHHHL


DSSP  LLL-LEELLLLLlllhhhhhhhhhHHHLLE-EEEELLlllllhhhhhhhhhhhhhhllle
Query YEA-EFIWDLHKgvgsiagihaalRHFGSC-VVAAIDxpfvkpevlehlykegekagcda  115
ident   |  |                     |                                
Sbjct FGAdSFLVSRDQ--------eqmqAAAGTLdGIIDTV-----------------------  252
DSSP  LLLlEEEELLLH--------hhhhHLLLLEeEEEELL-----------------------


DSSP  eeeellllllleeeELHHhhhhhhhhhhlllLLLHHHHHLLLEeeeehhhhlllllllhh
Query lipkhdypepllayYAESaadelerailqgiRKILVPLERLNVvyypveklrkfdkelis  175
ident                                                             
Sbjct --savhpllplfglLKSH-gklilvgapekpLELPAFSLIAGR-------------kiva  296
DSSP  --llllllhhhhhhEEEE-eeeeelllllllEEELHHHHHLLL-------------leee


DSSP  HLLLllhhhhhhHHHHHHHL----------------------------------------
Query FFNIntpddlkrAEEICSKX----------------------------------------  195
ident    |                                                        
Sbjct GSGI--------GGMKETQEmidfaakhnitadievistdylntamerlakndvryrfvi  348
DSSP  ELLL--------LLHHHHHHhhhhhhhlllllleeeelhhhhhhhhhhhhlllllleeee


DSSP  -----------
Query -----------  195
ident            
Sbjct dvgntlaatkp  359
DSSP  lhhhhlhhhll


No 131: Query=mol1A Sbjct=1i01C Z-score=3.0

back to top
DSSP  -----LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHHHH
Query -----XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQAEK   53
ident          |                            |               |  |  
Sbjct mnfegKIALVTG----------------asrGIGRAIAETLAarGAKVIGTATSENGAQA   44
DSSP  lllllLEEEELL----------------lllHHHHHHHHHHHhlLLEEEEEELLHHHHHH


DSSP  HHLLLL--LLEELlllllLLHHHHHHHHHHHHLLE-EEEEL-------------------
Query LSSRYE--AEFIWdlhkgVGSIAGIHAALRHFGSC-VVAAI-------------------   91
ident  |                             ||                           
Sbjct ISDYLGanGKGLM--lnvTSIESVLEKIRAEFGEVdILVNNdnllmrmkdeewndiietn  102
DSSP  HHHHHHhhEEEEE--lllLLHHHHHHHHHHHLLLLlEEEELlllhhhllhhhhhhhhhhh


DSSP  ------------------------LLLL--------------------------------
Query ------------------------DXPF--------------------------------   95
ident                                                             
Sbjct lssvfrlskavmrammkkrhgriiTIGSvvanyaaakagligfskslarevasrgitvnv  162
DSSP  lhhhhhhhhhhhhhhhhhlleeeeEELLlllllhhhhhhhhhhhhhhhhhhhhhleeeee


DSSP  ----------------------------------LLHHHHHHhhhhhhhhllleeeeell
Query ----------------------------------VKPEVLEHlykegekagcdalipkhd  121
ident                                                             
Sbjct vapgfietdmtraragilaqvpagrlggaqeianAVAFLASD------------------  204
DSSP  eeelllllllllllhhhhllllllllllhhhhhhHHHHHHLH------------------


DSSP  llllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehHHHLlllLLLHhhlllll
Query ypepllayyaesaadelerailqgirkilvplerlnvvyypvEKLRkfdKELIsffnint  181
ident                                                   |         
Sbjct ----------------------------------------eaAYIT---GETL-------  214
DSSP  ----------------------------------------hhLLLL---LLEE-------


DSSP  hhhhhhhhhHHHHL
Query pddlkraeeICSKX  195
ident               
Sbjct --------hVNGGM  220
DSSP  --------eELLLL


No 132: Query=mol1A Sbjct=3hmkB Z-score=3.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aqydisfadvekahlniqdsvhltpvltssilnqiagrnlffkcelfqktgsfkirgaln   60
DSSP  llllllhhhhhhhhhhhlllllllleellhhhhhhhlleeeeeehhhlhhhlllhhhhhh


DSSP  --------------LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEE
Query --------------XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFV   44
ident                 |                                          |
Sbjct airglipdtlegkpKAVVTHS-----------------sgNHGQALTYAAKleGIPAYIV  103
DSSP  hhhlllllllllllLLEEELL-----------------llHHHHHHHHHHHhhLLLEEEE


DSSP  LlLHHHhHHHHLLLL---LLEELLllLLLLhHHHHHHHHHHHL--LEEEEElLLLLllhh
Query CrDEKQaEKLSSRYE---AEFIWDlhKGVGsIAGIHAALRHFG--SCVVAAiDXPFvkpe   99
ident                   |                  | |                    
Sbjct V-PQTApNCKKLAIQaygASIVYS--EPSD-ESRENVAQRIIQetEGILVH-PNQE----  154
DSSP  E-LLLLlHHHHHLLLlllLEEEEL--LLLL-LHHHHHHHHHHHhhLLEELL-LLLL----


DSSP  hhhhhhhhhhhhllleeeeellllllleeeelhhhhhhhhhhhhllllllhhhhhlllee
Query vlehlykegekagcdalipkhdypepllayyaesaadelerailqgirkilvplerlnvv  159
ident                                                             
Sbjct ------------------------------------------------------------  154
DSSP  ------------------------------------------------------------


DSSP  eeehhhhlllllllHHHL------------------llllHHHHhHHHHHHHHL------
Query yypveklrkfdkelISFF------------------nintPDDLkRAEEICSKX------  195
ident                                         |                   
Sbjct --------------PAVIagqgtialevlnqvplvdalvvPVGG-GGMVAGIAItiktlk  199
DSSP  --------------HHHHhhhhhhhhhhhhhllllleeeeELLL-LHHHHHHHHhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct psvkvyaaepsnaddcyqsklkgeltpnlhppetiadgvkssiglntwpiirdlvddvft  259
DSSP  llleeeeeeehhhlhhhhhhhhllllllllllllllhhhllllllllhhhhhhhlleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vtedeikyatqlvwermkllieptagvglaavlsqhfqtvspevknicivlsggnvdlts  319
DSSP  elhhhhhhhhhhhhhhhlllllhhhhhhhhhhhlhhhhhlllllleeeeeelllllllll


DSSP  ---
Query ---  195
ident    
Sbjct lsw  322
DSSP  lll


No 133: Query=mol1A Sbjct=1ydwB Z-score=3.0

back to top
DSSP  -LEEEEELLlllllllllhhhleelleEHHHHHHHHHLL----LEEEEELLLHHHHHHHH
Query -XKVAVLVGgvgrrigxektevxlcgkKLIEWVLEKYSP----FQTVFVCRDEKQAEKLS   55
ident      |                          |                 |    |    
Sbjct qIRIGVXGC-----------------aDIARKVSRAIHLapnaTISGVASRSLEKAKAFA   43
DSSP  lEEEEEELL-----------------lLHHHHHHHHHHHllleEEEEEELLLHHHHHHHH


DSSP  LLLLL----lEELLllllllhhhHHHHhHHHHLlEEEEELL-------------------
Query SRYEA----eFIWDlhkgvgsiaGIHAaLRHFGsCVVAAID-------------------   92
ident                             |                               
Sbjct TANNYpestkIHGS---------YESL-LEDPEiDALYVPLptslhvewaikaaekgkhi   93
DSSP  HHLLLlllleEELL---------HHHH-HLLLLlLEEEELLlhhhhhhhhhhhhllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct llekpvaxnvtefdkivdaceangvqixdgtxwvhnprtallkeflsdserfgqlktvqs  153
DSSP  eelllllllhhhhhhhhhhhhhlllleeelllhhhlhhhhhhhhhhhllllllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct cfsfagdedflkndirvkpgldglgalgdagwyairatllannfelpktvtafpgavlne  213
DSSP  eeeeellhhhhhhlhhhllllllllhhhhlhhhhhhhhhhhllllllleeeelllleell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct agvilscgaslswedgrtatiycsflanltxeitaigtkgtlrvhdfiipyketeasftt  273
DSSP  llleeeeeeeeellllleeeeeeeleeeeeeeeeeeelleeeeelllllllllleeeeee


DSSP  ---------------------------llllLHHHHHhhhhhHHHHLlleeeeellllll
Query ---------------------------xpfvKPEVLEhlykeGEKAGcdalipkhdypep  125
ident                                               |             
Sbjct stkawfndlvtawvsppsehtvktelpqeacXVREFA-----IKNNG-------------  315
DSSP  eellllllllllllllleeeeeellllhhhhHHHHHL-----LLLLL-------------


DSSP  leeeelhhhhhhhhhhhhllllllhhhhhllleEEEEHHHHLLlllllhhhlllllhhhh
Query llayyaesaadelerailqgirkilvplerlnvVYYPVEKLRKfdkelisffnintpddl  185
ident                                                             
Sbjct ---------------------------------AKPDGYWPSI--srktqlvvdavkesv  340
DSSP  ---------------------------------LLLLLHHHHH--hhhhhhhhhhhhhhh


DSSP  hhhhhhhhhl
Query kraeeicskx  195
ident           
Sbjct dknyqqisls  350
DSSP  hllllleell


No 134: Query=mol1A Sbjct=1pkyC Z-score=3.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt   60
DSSP  lllleeeeelllllllhhhhhhhhhlllleeeeelllllhhhhhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aailldtkgpeirmvavtyegfttdlsvgntvlvddgligmevtaiegnkvickvlnngd  120
DSSP  leeeeeellllllllllllllhhhhllllleeeelllleeeeeeeeelleeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lgenkgvnlpgvsialpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahg  180
DSSP  lllllleelllllllllllllllhhhhhhhhhhllleeeelllllhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct genihiiskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirar  240
DSSP  lllleeeeeellhhhhhlhhhhhhhlleeeelhhhhhhhllhhhhhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kvvitatmmldsmiknprptraeagdvanaildgtdavmlsgesakgkypleavsimati  300
DSSP  leeeelllllhhhhllllllhhhhhhhhhhhhhllleeeelhhhhllllhhhhhhhhhhh


DSSP  ----------------------------------LEEEEELLlllllllllhhhleelle
Query ----------------------------------XKVAVLVGgvgrrigxektevxlcgk   26
ident                                       |                     
Sbjct certdrvmnsrleklriteavcrgavetaekldaPLIVVATQ----------------gg  344
DSSP  hhhhhlllllllllllhhhhhhhhhhhhhhhlllLEEEEELL----------------ll


DSSP  ehHHHHHHHHLLLEEEEELLLHHHHHHHHLlLLLLEELLLlLLLLHHHHHHHHHHHHL--
Query klIEWVLEKYSPFQTVFVCRDEKQAEKLSSrYEAEFIWDLhKGVGSIAGIHAALRHFG--   84
ident      |               || |  |                                
Sbjct ksARAVRKYFPDATILALTTNEKTAHQLVLsKGVVPQLVK-EITSTDDFYRLGKELALqs  403
DSSP  hhHHHHHLLLLLLEEEEEELLHHHHHHHHHlLLEEEEELL-LLLLHHHHHHHHHHHHHhh


DSSP  -------LEEEEElllllllhhhhhhhhhhhhhhllleeeeellllllLEEEELHhhhhh
Query -------SCVVAAidxpfvkpevlehlykegekagcdalipkhdypepLLAYYAEsaade  137
ident          |                                                  
Sbjct glahkgdVVVMVS-------------------------galvpsgttnTASVHVL-----  433
DSSP  lllllllEEEEEE-------------------------llllllllllEEEEEEL-----


DSSP  hhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query lerailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                                           
Sbjct ----------------------------------------------------------  433
DSSP  ----------------------------------------------------------


No 135: Query=mol1A Sbjct=2pr7A Z-score=3.0

back to top
DSSP  --LEEEEELlllllllllLHHHLEelLEEHhHHHHHHHLLL-----EEEEELLLHH--hh
Query --XKVAVLVggvgrrigxEKTEVXlcGKKLiEWVLEKYSPF-----QTVFVCRDEK--qa   51
ident       |                                        ||    |      
Sbjct gxRGLIVDY--------aGVLDGT--DEDQ-RRWRNLLAAAkkngvGTVILSNDPGglga   49
DSSP  llLEEEELL--------lLLLLLL--HHHH-HHHHHHHHHHhhlllEEEEEELLLLhhhh


DSSP  HHHHL--lLLLL--EELL--LLLLLLhHHHHHHHHHHHLL----EEEEE-----------
Query EKLSS--rYEAE--FIWD--LHKGVGsIAGIHAALRHFGS----CVVAA-----------   90
ident                     |       |   ||          ||              
Sbjct APIREletNGVVdkVLLSgeLGVEKPeEAAFQAAADAIDLpxrdCVLVDdsilnvrgave  109
DSSP  HHHHHhhhLLLLleEEEHhhHLLLLLlHHHHHHHHHHLLLlhhhEEEEEllhhhhhhhhh


DSSP  --------llLLLL--LHHHHHHhhhhhhhhllleeeeellllllleeeelhhhhhhhhh
Query --------idXPFV--KPEVLEHlykegekagcdalipkhdypepllayyaesaadeler  140
ident                     |                                       
Sbjct aglvgvyyqqFDRAvvEIVGLFG-------------------------------------  132
DSSP  hlleeeelllHHHHhhHHHHHHL-------------------------------------


DSSP  hhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query ailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                                        
Sbjct --------------------------------------------------legef  137
DSSP  --------------------------------------------------lllll


No 136: Query=mol1A Sbjct=3ic5A Z-score=3.0

back to top
DSSP  ----LEEEEELllllllllllhhhleelleEHHHHHHHHHLL---LEEEEELLLHHHHHH
Query ----XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYSP---FQTVFVCRDEKQAEK   53
ident         |                     |                      |      
Sbjct naxrWNICVVG-----------------agKIGQXIAALLKTssnYSVTVADHDLAALAV   43
DSSP  llllEEEEEEL-----------------llHHHHHHHHHHHHlllEEEEEEELLHHHHHH


DSSP  HHLlLLLLEELLlllllLHHH---hhHHHHhhhllEEEEELLlllllhhhhhhhhhhhhh
Query LSSrYEAEFIWDlhkgvGSIA---giHAALrhfgsCVVAAIDxpfvkpevlehlykegek  110
ident |                          |         |                      
Sbjct LNR-XGVATKQV-----DAKDeaglaKALG---gfDAVISAA------------------   76
DSSP  HHL-LLLEEEEL-----LLLLhhhhhHHLL---llLEEEELL------------------


DSSP  hllleeeeellllLLLE--eEELHhhhhhhhhhhhllllllhhhhhllleeeeehhhhll
Query agcdalipkhdypEPLL--aYYAEsaadelerailqgirkilvplerlnvvyypveklrk  168
ident                       |                                     
Sbjct --------pffltPIIAkaaKAAG------------------------------------   92
DSSP  --------lhhhhHHHHhhhHHLL------------------------------------


DSSP  lllllhhhllLLLHhHHHHHHhhhhhl
Query fdkelisffnINTPdDLKRAEeicskx  195
ident                            
Sbjct --ahyfdlteDVAA-TNAVRA-lveds  115
DSSP  --leeellllLHHH-HHHHHH-hhhll


No 137: Query=mol1A Sbjct=1httA Z-score=3.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct niqairgmndylpgetaiwqriegtlknvlgsygyseirlpiveqtplfkraigevtdvv   60
DSSP  llllllllllllhhhhhhhhhhhhhhhhhhhlllleellllleeehhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ekemytfedrngdsltlrpegtagcvragiehgllynqeqrlwyigpmfrherpqkgryr  120
DSSP  hhlleeeellllleeeellllhhhhhhhhhhhllllllleeeeeeeeeelllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qfhqlgcevfglqgpdidaelimltarwwralgisehvtlelnsigslearanyldeesr  180
DSSP  eeeeeeeeeellllhhhhhhhhhhhhhhhhhhllhhhleeeeeelllhhhhhhlllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ehfaglckllesagiaytvnqrlvrgldyynrtvfewvtnqgtvcaggrydglveqlggr  240
DSSP  hhhhhhhhhhhlllllleellllllllllllleeeeeelllleeeeeeelllhhhhllll


DSSP  ------------------------------lEEEEElLLLLlllllLHHHleelleEHHH
Query ------------------------------xKVAVLvGGVGrrigxEKTEvxlcgkKLIE   30
ident                                                             
Sbjct atpavgfamglerlvllvqavnpefkadpvvDIYLV-ASGA-----DTQS------AAMA  288
DSSP  llleeeeeeehhhhhhhhhhhllllllllllLEEEE-ELLL-----LHHH------HHHH


DSSP  HHHHHHL---LLEEEEELLLhhhhhhhhlllllleellllllLLHHHHHHHHHHhHLLEE
Query WVLEKYS---PFQTVFVCRDekqaeklssryeaefiwdlhkgVGSIAGIHAALRhFGSCV   87
ident                                                    |    |  |
Sbjct LAERLRDelpGVKLMTNHGG----------------------GNFKKQFARADK-WGARV  325
DSSP  HHHHHHHhllLLLEEELLLL----------------------LLHHHHHHHHHH-HLLLE


DSSP  EEELL----------------------lLLLLHHHHHHHHHhhhhhllleeeeellllll
Query VAAID----------------------xPFVKPEVLEHLYKegekagcdalipkhdypep  125
ident                                    |  |                     
Sbjct AVVLGesevangtavvkdlrsgeqtavaQDSVAAHLRTLLG-------------------  366
DSSP  EEEELhhhhhhleeeeeellllleeeeeHHHHHHHHHHHHL-------------------


DSSP  leeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhh
Query llayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkelisffnintpddl  185
ident                                                             
Sbjct ------------------------------------------------------------  366
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhl
Query kraeeicskx  195
ident           
Sbjct ----------  366
DSSP  ----------


No 138: Query=mol1A Sbjct=1zmoA Z-score=2.9

back to top
DSSP  LEEEEELllllllllllhhhleelleeHHHHHHHHHL--LLEEEEELLLH---HHHHHHH
Query XKVAVLVggvgrrigxektevxlcgkkLIEWVLEKYS--PFQTVFVCRDE---KQAEKLS   55
ident     |                            |         |                
Sbjct VIALVTH----------------arhfAGPAAVEALTqdGYTVVCHDASFadaAERQRFE   44
DSSP  LEEEELL----------------llllLHHHHHHHHHhlLLEEEELLHHHhlhHHHHHHH


DSSP  LLLL-LLEELLllllLLHHHHHHHHHHHHLLE-EEEELL---------------------
Query SRYE-AEFIWDlhkgVGSIAGIHAALRHFGSC-VVAAID---------------------   92
ident |                      | | |          |                     
Sbjct SENPgTIALAE----QKPERLVDATLQHGEAIdTIVSNDyiprpmnrlplegtseadirq  100
DSSP  HHLLlEEELLL----LLHHHHHHHHHHHLLLEeEEEELLlllllhhhlllllllhhhhhh


DSSP  -------lllllhhhhhhhHHHHH-----------------------hhllleeeeELLL
Query -------xpfvkpevlehlYKEGE-----------------------kagcdalipKHDY  122
ident                                                             
Sbjct mfealsifpilllqsaiapLRAAGgasvifitssvgkkplaynplygparaatvalVESA  160
DSSP  hhhhhlhhhhhhhhhhhhhHHHLLleeeeeellhhhlllllllllhhhhhhhhhhhHHHH


DSSP  LllleeeelhhhhhhhhhhhhllllllhhhhhllleEEEEhhhhlllllllhHHLLLllh
Query PepllayyaesaadelerailqgirkilvplerlnvVYYPveklrkfdkeliSFFNIntp  182
ident                                                             
Sbjct A----------------------------------kTLSR-------dgillYAIGP---  176
DSSP  H----------------------------------hHHHH-------hleeeEEEEE---


DSSP  hhhHHHH--hhHHHL---------------------------------------------
Query ddlKRAE--eiCSKX---------------------------------------------  195
ident                                                             
Sbjct ---NFFNnptyFPTSdwennpelrervdrdvplgrlgrpdemgalitflasrraapivgq  233
DSSP  ---LLLLllllLLHHhhhhlhhhhhhhhhhllllllllhhhhhhhhhhhhllllhhhlll


DSSP  ----------
Query ----------  195
ident           
Sbjct ffaftggylp  243
DSSP  eeeellllll


No 139: Query=mol1A Sbjct=1z9dA Z-score=2.9

back to top
DSSP  ----LEEEEELLllllllllLHHHLE---ellEEHHHHHHHHHLL-----LEEEEELL--
Query ----XKVAVLVGgvgrrigxEKTEVX---lcgKKLIEWVLEKYSP-----FQTVFVCR--   46
ident                     |                              |   |    
Sbjct epkyQRILIKLS-------gEALAGEkgvgidIPTVQAIAKEIAEvhvsgVQIALVIGgg   53
DSSP  llllLEEEEEEL-------hHHHLLLllllllHHHHHHHHHHHHHhhlllLEEEEEELll


DSSP  ---------------------lHHHHHHHHLLLL--------------------------
Query ---------------------dEKQAEKLSSRYE--------------------------   59
ident                                                             
Sbjct nlwrgepaadagxdrvqadytgXLGTVXNALVXAdslqhygvdtrvqtaipxqnvaepyi  113
DSSP  llllhhhhhhhlllhhhhhhhhHHHHHHHHHHHHhhhhllllleeeeelllllllleell


DSSP  ------------lLEEL-LLLL--LLLHHHHHHHHHHhHLLEEEEELL------------
Query ------------aEFIW-DLHK--GVGSIAGIHAALRhFGSCVVAAID------------   92
ident                                   |                         
Sbjct rgralrhleknriVVFGaGIGSpyFSTDTTAALRAAE-IEADAILXAKngvdgvynadpk  172
DSSP  hhhhhhhhhllleEEEElLLLLllLLHHHHHHHHHHH-LLLLEEEEEEllllllllllll


DSSP  -------------------------------------------LLLLL--HHHHHHhhhh
Query -------------------------------------------XPFVK--PEVLEHlyke  107
ident                                            |        |       
Sbjct kdanavkfdelthgevikrglkixdatastlsxdndidlvvfnXNEAGniQRVVFG----  228
DSSP  llllllllleeehhhhhllllllllhhhhhhhhhllleeeeeeLLLLLhhHHHHLL----


DSSP  hhhhllleEEEELlllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhl
Query gekagcdaLIPKHdypepllayyaesaadelerailqgirkilvplerlnvvyypveklr  167
ident                                                             
Sbjct ---ehigtTVSNK-----------------------------------------------  238
DSSP  ---lllleEEELL-----------------------------------------------


DSSP  llllllhhhlllllhhhhhhhhhhhhhl
Query kfdkelisffnintpddlkraeeicskx  195
ident                             
Sbjct ----------------------------  238
DSSP  ----------------------------


No 140: Query=mol1A Sbjct=3bg5B Z-score=2.9

back to top
DSSP  --LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHHHHl
Query --XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEKLSs   56
ident    |  |                                     ||              
Sbjct qiKKLLVAN-----------------rgEIAIRIFRAAAelDISTVAIY-SNED-KSSLh   41
DSSP  llLEEEELL-----------------lhHHHHHHHHHHHllLLEEEEEE-LLLL-LLLHh


DSSP  lLLLL-EELLLL------llLLHHHHHHHHHHhHLLEEEEELLlllllhhhhhhhhhhhh
Query rYEAE-FIWDLH------kgVGSIAGIHAALRhFGSCVVAAIDxpfvkpevlehlykege  109
ident  | |                      |  |                              
Sbjct rYKADeSYLVGSdlgpaesyLNIERIIDVAKQ-ANVDAIHPGY-------gflseneqfa   93
DSSP  hLLLLeEEELLLllllllhhHLHHHHHHHHHH-LLLLEEELLL-------llllllhhhh


DSSP  hhlLLEE-----eEELLLLllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehh
Query kagCDAL-----iPKHDYPepllayyaesaadelerailqgirkilvplerlnvvyypve  164
ident                                                             
Sbjct rrcAEEGikfigpHLEHLD-------mfgdkvkarttaikadlpvipidnpkhievqvig  146
DSSP  hhhHLLLleelllLHHHHH-------hhhlhhhhhhhhhlllllllllllllleeeeeee


DSSP  hHLLLLL--------------------------------------------lLHHHL---
Query kLRKFDK--------------------------------------------eLISFF---  177
ident                                                             
Sbjct dEHGNIVhlferdcsvqrrhqkvvevapsvglsptlrqricdaaiqlmenikYVNAGtve  206
DSSP  lLLLLEEeeeeeeeeeeelleeeeeeellllllhhhhhhhhhhhhhhhhhllLLEEEeee


DSSP  ---------------LLLLhhhhhHHHHHHHHL---------------------------
Query ---------------NINTpddlkRAEEICSKX---------------------------  195
ident                                                             
Sbjct flvsgdefffievnpRVQV-----EHTITEMVTgidivktqilvaagadlfgeeinmpqq  261
DSSP  elllllllleeeeelLLLL-----LLHHHHHHHlllhhhhhhhhhlllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct kdittlgyaiqcrittedplndfmpdtgtiiayrssggfgvrldagdgfqgaeispyyds  321
DSSP  llllllleeeeeeeelllllllllllleellleelllllleelllllllllleellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct llvklsthaisfkqaeekmvrslremrirgvktnipflinvmknkkftsgdyttkfieet  381
DSSP  eeeeeeeeellhhhhhhhhhhhhhhleellllllhhhhhhhhllhhhhhlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct pelfdiqpsldrgtktleyignvtingfpnvekrpkpdyelasiptvssskiasfsgtkq  441
DSSP  hhhhlllllllhhhhhhhhhhhhhhhllllllllllllllllllllllhhhhhhlllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct lldevgpkgvaewvkkqddvlltdttfrdahqsllatrvrtkdminiasktadvfkdgfs  501
DSSP  hhhhhlhhhhhhhhhhlllleeeellllhhhhhhllllllhhhhhhhhhhhhhhllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct lemwggatfdvaynflkenpwerlerlrkaipnvlfqmllrasnavgyknypdnvihkfv  561
DSSP  eeeeellhhhhhhhlllllhhhhhhhhhhhlllleeeeeeelllllllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct qesakagidvfrifdslnwvdqmkvaneavqeagkisegticytgdilnpersniytley  621
DSSP  hhhhhhllleeeeelllllhhhhhhhhhhhhhllleeeeeeelllllllllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct yvklakeleregfhilaikdmagllkpkaayeligelksavdlpihlhthdtsgngllty  681
DSSP  hhhhhhhhhhhllleeeeeellllllhhhhhhhhhhhhhhlllleeeeelhhhllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct kqaidagvdiidtavasmsgltsqpsanslyyalngfprhlrtdiegmeslshywstvrt  741
DSSP  hhhhhlllleeeellhhhllllllllhhhhhhhlllllllllllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct yysdfesdikspnteiyqhempggqysnlsqqakslglgerfdevkdmyrrvnflfgdiv  801
DSSP  llhhhllllllllllhhhhlllllhhhhhhhhhhhllllllhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct kvtpsskvvgdmalymvqndldeqsvitdgykldfpesvvsffkgeigqpvngfnkdlqa  861
DSSP  llllhhhhhhhhhhhhhhllllhhhhhhlhhhllllhhhhhhhhlllllllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vilkgqealtarpgeylepvdfekvrelleeeqqgpvteqdiisyvlypkvyeqyiqtrn  921
DSSP  hhhllllllllllllllllllhhhhhhhhhhhllllllhhhhhhhhhlhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct qygnlslldtptfffgmrngetveieidkgkrliikletisepdengnrtiyyamngqar  981
DSSP  hhllhhhllhhhhhhlllllleeeeeeelleeeeeeeeeellllllleeeeeeeelleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct riyikdenvhtnanvkpkadksnpshigaqmpgsvtevkvsvgetvkanqplliteamkm 1041
DSSP  eeeeelllllllllllllllllllleeelllleeeeeelllllleelllleeeeeellll


DSSP  ---------------------------------
Query ---------------------------------  195
ident                                  
Sbjct ettiqapfdgvikqvtvnngdtiatgdllieie 1074
DSSP  eeeeelllleeeeeelllllleelllleeeeel


No 141: Query=mol1A Sbjct=2bmuB Z-score=2.9

back to top
DSSP  -LEEEEELLLLlllllllHHHLeellEEHHHHHHHHHLL----LEEEEELL---------
Query -XKVAVLVGGVgrrigxeKTEVxlcgKKLIEWVLEKYSP----FQTVFVCR---------   46
ident  |      ||                   |                  |           
Sbjct aXRIVFDIGGS-------VLVPenpdIDFIKEIAYQLTKvsedHEVAVVVGggklarkyi   53
DSSP  lLEEEEEELHH-------HHLLllllHHHHHHHHHHHHHhhhhLEEEEEELlhhhhhhhh


DSSP  --------------------LHHHHHHHHLLLL----------------------lLEEL
Query --------------------DEKQAEKLSSRYE----------------------aEFIW   64
ident                         |  |                                
Sbjct evaekfnssetfkdfigiqiTRANAXLLIAALRekaypvvvedfweawkavqlkkiPVXG  113
DSSP  hhhhhllllhhhhhhhhhhhHHHHHHHHHHHHHhhllllllllhhhhhhhhhllllLEEL


DSSP  LLL-lLLLHHHHHHHHHHhHLLEEEEELLlllllhhhhhhhhhhhhhhllleeeeELLLL
Query DLH-kGVGSIAGIHAALRhFGSCVVAAIDxpfvkpevlehlykegekagcdalipKHDYP  123
ident   |            |           |                           |    
Sbjct GTHpgHTTDAVAALLAEF-LKADLLVVIT---------nvdgvytadpkkdptakKIKKX  163
DSSP  LLLllLLHHHHHHHHHHH-HLLLEEEEEL---------lllllllllllllllllLLLEE


DSSP  llleeeelhhhhhhhhhhhHLLL---------LLLH---hhhhllleeeeehhhhlllll
Query epllayyaesaadeleraiLQGI---------RKIL---vplerlnvvyypveklrkfdk  171
ident                                                             
Sbjct --------kpeelleivgkGIEKagsssvidpLAAKiiarsgiktivigkedakdlfrvi  215
DSSP  --------lhhhhhhhlllLLLLllllllllhHHHHhhhhhllleeeelhhhhllhhhhl


DSSP  lLHHHLllllhhhhhhhhhhhhhl
Query eLISFFnintpddlkraeeicskx  195
ident                         
Sbjct kGDHNG-------------ttiep  226
DSSP  lLLLLL-------------eeell


No 142: Query=mol1A Sbjct=2vpqB Z-score=2.9

back to top
DSSP  LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHHHHllL
Query XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEKLSsrY   58
ident  ||                                      |||     |          
Sbjct KKVLIAN-----------------rgEIAVRIIRACRdlGIQTVAIY-SEGD-KDALhtQ   41
DSSP  LEEEELL-----------------lhHHHHHHHHHHHhlLLEEEEEE-EHHH-LLLHhhH


DSSP  LLL-EELL-----llllLLHHHHHHHHHHhHLLEEEEELLlllllhhhhhhhhhhhhhhl
Query EAE-FIWD-----lhkgVGSIAGIHAALRhFGSCVVAAIDxpfvkpevlehlykegekag  112
ident  |                        |    |   |                        
Sbjct IADeAYCVgptlskdsyLNIPNILSIATS-TGCDGVHPGY-------gflaenadfaelc   93
DSSP  HLLeEEEEelllhhhllLLHHHHHHHHHH-LLLLEEELLL-------llllllhhhhhhh


DSSP  LLEE--------eeELLLL-----------------------------------------
Query CDAL--------ipKHDYP-----------------------------------------  123
ident                                                             
Sbjct EACQlkfigpsyqsIQKMGikdvakaemikanvpvvpgsdglmkdvseakkiakkigypv  153
DSSP  HHLLleellllhhhHHHHHlhhhhhhhhhhlllllllllllllllhhhhhhhhhhhllle


DSSP  ------------------llleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhh
Query ------------------epllayyaesaadelerailqgirkilvplerlnvvyypvek  165
ident                                                             
Sbjct iikataggggkgirvardekeletgfrmteqeaqtafgngglymekfienfrhieiqivg  213
DSSP  eeeelllllllleeeellhhhhhhhhhhhhhhhhhhhlllleeeeelllleeeeeeeeee


DSSP  HLLLLLL---------------------------------------------LHHHL---
Query LRKFDKE---------------------------------------------LISFF---  177
ident                                                             
Sbjct DSYGNVIhlgerdctiqrrmqklveeapspilddetrremgnaavraakavnYENAGtie  273
DSSP  LLLLLEEeeeeeeeeeeelleeeeeeellllllhhhhhhhhhhhhhhhhhllLLEEEeee


DSSP  -----------------LLLLhhhhhHHHHHHHHL-------------------------
Query -----------------NINTpddlkRAEEICSKX-------------------------  195
ident                   |                                         
Sbjct fiydlndnkfyfmemntRIQV-----EHPVTEMVTgidlvklqlqvamgdvlpykqedik  328
DSSP  eeeelllleeeeeeeelLLLL-----LHHHHHHHHlllhhhhhhhhhllllllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct ltghaiefrinaenpyknfmpspgkieqylapggygvriesacytnytippyydsmvakl  388
DSSP  llleeeeeeeeleehhhlleelllllleeelllllleeeeelllllllllllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct iiheptrdeaimagiralsefvvlgidttipfhikllnndifrsgkfntnfleqnsimnd  448
DSSP  eeeellhhhhhhhhhhhhhhleeelllllhhhhhhhhllhhhhhllllllhhhhllhhhl


No 143: Query=mol1A Sbjct=2ahrE Z-score=2.9

back to top
DSSP  ---LEEEEELllllllllllhhhleelleEHHHHHHHHHLL--LEEEEELLLHHHHHHHH
Query ---XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYSP--FQTVFVCRDEKQAEKLS   55
ident    ||                        |                              
Sbjct snaXKIGIIG-----------------vgKXASAIIKGLKQtpHELIISGSSLERSKEIA   43
DSSP  lllLEEEEEL-----------------llHHHHHHHHHHLLllLEEEEELLLHHHHHHHH


DSSP  LLLLLLEELLllllllhhhhHHHHHHHHllEEEEELLlllllhhhhhhhhhhhhhhllle
Query SRYEAEFIWDlhkgvgsiagIHAALRHFgsCVVAAIDxpfvkpevlehlykegekagcda  115
ident                                 |                           
Sbjct EQLALPYAXS----------HQDLIDQV--DLVILGI--kpqlfetvlkplhfkqpiisx   89
DSSP  HHHLLLLLLL----------HHHHHLLL--LEEEELL--lhhhhhhhhlllllllleeel


DSSP  eeeellLLLLleeeelhhhhhhhhhhhhllllLLHH---------------hhhllleeE
Query lipkhdYPEPllayyaesaadelerailqgirKILV---------------plerlnvvY  160
ident                                                             
Sbjct aagislQRLA---------------------tFVGQdlpllrixpnxnaqilqsstaltG  128
DSSP  lllllhHHHH---------------------hHHLLllleeeeellhhhhhlleeeeeeE


DSSP  EEHhhHLLLL-----------lllhhhllllLHHHHHHHHHHHHHL--------------
Query YPVekLRKFD-----------kelisffninTPDDLKRAEEICSKX--------------  195
ident                                                             
Sbjct NAL-vSQELQarvrdltdsfgstfdisekdfDTFTALAGSSPAYIYlfiealakagvkng  187
DSSP  LLL-lLHHHHhhhhhhhhlleeeeellhhhhHHHHHHLLLHHHHHHhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct ipkakaleivtqtvlasasnlktssqsphdfidaicspggttiaglxelerlgltatvss  247
DSSP  llhhhhhhhhhhhhhhhhhhhhhllllhhhhhhhhlllllhhhhhhhhhhhhlhhhhhhh


DSSP  ------------
Query ------------  195
ident             
Sbjct aidktidkaksl  259
DSSP  hhhhhhhhhhhl


No 144: Query=mol1A Sbjct=3bg5A Z-score=2.9

back to top
DSSP  --LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHHHHl
Query --XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEKLSs   56
ident    |  |                                     ||              
Sbjct qiKKLLVAN-----------------rgEIAIRIFRAAAelDISTVAIY-SNED-KSSLh   41
DSSP  llLEEEELL-----------------lhHHHHHHHHHHHhlLLEEEEEE-LLLL-LLLHh


DSSP  lLLLL-EELLLLLL------LLHHHHHHHHHHhHLLEEEEELLlllllhhhhhhhhhhhh
Query rYEAE-FIWDLHKG------VGSIAGIHAALRhFGSCVVAAIDxpfvkpevlehlykege  109
ident  | |                      |  |                              
Sbjct rYKADeSYLVGSDLgpaesyLNIERIIDVAKQ-ANVDAIHPGY-------gflseneqfa   93
DSSP  hHLLLeEEELLLLLlhhhhlLLHHHHHHHHHH-LLLLEEELLL-------llllllhhhh


DSSP  hhlLLEE-----eEELLLL-----------------------------------------
Query kagCDAL-----iPKHDYP-----------------------------------------  123
ident                                                             
Sbjct rrcAEEGikfigpHLEHLDmfgdkvkarttaikadlpvipgtdgpiksyelakefaeeag  153
DSSP  hhhHLLLleelllLHHHHHhhhlllhhhhhhhhllllllllllllllllllhhhlhhhll


DSSP  --------------llleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhHLLL
Query --------------epllayyaesaadelerailqgirkilvplerlnvvyypvekLRKF  169
ident                                                             
Sbjct fplmikatsrivreeseledafhrakseaeksfgnsevyieryidnpkhievqvigDEHG  213
DSSP  lleeeeellleellllhhhhllhhhllhhhhlllllleeeeellllleeeeeeeeeLLLL


DSSP  LL----------------------------------------------lLHHH-------
Query DK----------------------------------------------eLISF-------  176
ident                                                             
Sbjct NIvhlferdcsvqrrhqkvvevapsvglsptlrqricdaaiqlmenikyVNAGtveflvs  273
DSSP  LEeeeeeeeeeeelllleeeeeellllllhhhhhhhhhhhhhhhhhlllLEEEeeeeeee


DSSP  ----------lLLLLhhhhhHHHHHHHHL-------------------------------
Query ----------fNINTpddlkRAEEICSKX-------------------------------  195
ident                                                             
Sbjct gdefffievnpRVQV-----EHTITEMVTgidivktqilvaagadlfgeeinmpqqkdit  328
DSSP  lleeeeeeeelLLLL-----LHHHHHHHHlllhhhhhhhhhllllllllllllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct tlgyaiqcrittedplndfmpdtgtiiayrssggfgvrldagdgfqgaeispyydsllvk  388
DSSP  llleeeeeeelleehhhlleelllllleeelllllleeeeelllllllllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct lsthaisfkqaeekmvrslremrirgvktnipflinvmknkkftsgdyttkfieetpelf  448
DSSP  eeeeellhhhhhhhhhhhhhhleeelllllhhhhhhhhhlhhhhhllllllhhhhlhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct diqpsldrgtktleyignvtingfpnvekrpkpdyelasiptvssskiasfsgtkqllde  508
DSSP  lllllllhhhhhhhhhhhhhhhllllllllllllllllllllllhhhhhllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vgpkgvaewvkkqddvlltdttfrdahqsllatrvrtkdminiasktadvfkdgfslemw  568
DSSP  hhhhhhhhhhhhlllleeeellllhhhhhhllllllhhhhhhhhhhhhhhllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct ggatfdvaynflkenpwerlerlrkaipnvlfqmllrasnavgyknypdnvihkfvqesa  628
DSSP  ellhhhhhhhlllllhhhhhhhhhhhlllleeeeeeelllllllllllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct kagidvfrifdslnwvdqmkvaneavqeagkisegticytgdilnpersniytleyyvkl  688
DSSP  hlllleeeeelllllhhhhhhhhhhhhhllleeeeeeelllllllllllllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct akeleregfhilaikdmagllkpkaayeligelksavdlpihlhthdtsgnglltykqai  748
DSSP  hhhhhhlllleeeeeellllllhhhhhhhhhhhhhhlllleeeeellllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct dagvdiidtavasmsgltsqpsanslyyalngfprhlrtdiegmeslshywstvrtyysd  808
DSSP  hlllleeeellhhhllllllllhhhhhhhlllllllllllhhhhhhhhhhhhhhhhllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct fesdikspnteiyqhempggqysnlsqqakslglgerfdevkdmyrrvnflfgdivkvtp  868
DSSP  hllllllllllhhhhlllllhhhhhhhhhhllllhhhhhhhhhhhhhhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct sskvvgdmalymvqndldeqsvitdgykldfpesvvsffkgeigqpvngfnkdlqavilk  928
DSSP  hhhhhhhhhhhhhhllllllhhhhlhhhllllhhhhhhhllllllllllllhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct gqealtarpgeylepvdfekvrelleeeqqgpvteqdiisyvlypkvyeqyiqtrnqygn  988
DSSP  lllllllllllllllllhhhhhhhhhhhllllllhhhhhhhhhlhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct lslldtptfffgmrngetveieidkgkrliikletisepdengnrtiyyamngqarriyi 1048
DSSP  hhhllhhhhhhlllllleeeeeeelleeeeeeeeeellllllleeeeeeeelleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct kdenvhtnanvkpkadksnpshigaqmpgsvtevkvsvgetvkanqplliteamkmetti 1108
DSSP  elllllllllllllllllllleeelllleeeeeelllllleelllleeeeeelllleeee


DSSP  -----------------------------
Query -----------------------------  195
ident                              
Sbjct qapfdgvikqvtvnngdtiatgdllieie 1137
DSSP  elllleelleelllllleelllleeeell


No 145: Query=mol1A Sbjct=2zatA Z-score=2.9

back to top
DSSP  -----LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHHHH
Query -----XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQAEK   53
ident          |                                      |   |       
Sbjct kplenKVALVTA----------------stdGIGLAIARRLAqdGAHVVVSSRKQENVDR   44
DSSP  lllllLEEEELL----------------lllHHHHHHHHHHHhlLLEEEEEELLHHHHHH


DSSP  HHLLLL-----LLEEL-lllllLLHHHHHHHHHHHHLLE-EEEELL--------------
Query LSSRYE-----AEFIW-dlhkgVGSIAGIHAALRHFGSC-VVAAID--------------   92
ident                                |    |                       
Sbjct TVATLQgeglsVTGTVchvgkaEDRERLVAMAVNLHGGVdILVSNAavnpffgniidate  104
DSSP  HHHHHHhllllEEEEElllllhHHHHHHHHHHHHHHLLLlEEEELLllllllllhhhllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct evwdkilhvnvkatvlmtkavvpemekrgggsvlivssvgayhpfpnlgpynvsktallg  164
DSSP  hhhhhhhhhhlhhhhhhhhhhhhhhhhllleeeeeellhhhlllllllhhhhhhhhhhhh


DSSP  ---------------------------------------------------------llL
Query ---------------------------------------------------------xpF   95
ident                                                             
Sbjct ltknlavelaprnirvnclapgliktnfsqvlwmdkarkeymkeslrirrlgnpedcagI  224
DSSP  hhhhhhhhhhhhleeeeeeeellllllllhhhhllhhhhhhhhhhhlllllllhhhhhhH


DSSP  LLHhHHHHhhhhhhhhllleeeeellllllleeeelhhhhhhhhhhhhllllllhhhhhl
Query VKPeVLEHlykegekagcdalipkhdypepllayyaesaadelerailqgirkilvpler  155
ident |                                                           
Sbjct VSF-LCSE----------------------------------------------------  231
DSSP  HHH-HLLH----------------------------------------------------


DSSP  lleeeeehhhHLLLLLLLHhhlllllhhhhhhhhhHHHH-----l
Query lnvvyypvekLRKFDKELIsffnintpddlkraeeICSK-----x  195
ident                 |                            
Sbjct ---------dASYITGETV----------------VVGGgtasrl  251
DSSP  ---------hHLLLLLLEE----------------EELLllllll


No 146: Query=mol1A Sbjct=3h2zA Z-score=2.9

back to top
DSSP  LEEEEELllllllllllhhhleelleEHHH-HHHHHHL--LLEEEEELLLHHHHHHHHLL
Query XKVAVLVggvgrrigxektevxlcgkKLIE-WVLEKYS--PFQTVFVCRDEKQAEKLSSR   57
ident ||                                        |  |          |  |
Sbjct XKALHFG-----------------agNIGRgFIGKLLAdaGIQLTFADVNQVVLDALNAR   43
DSSP  LEEEEEL-----------------llHHHHhLHHHHHHhlLLEEEEEELLHHHHHHHHHH


DSSP  LL-----------------LLEELLLlllllhhhhhHHHHHHHLLE-EEEELL-------
Query YE-----------------AEFIWDLhkgvgsiagiHAALRHFGSC-VVAAID-------   92
ident                                                 |           
Sbjct HSyqvhvvgeteqvdtvsgVNAVSSI---------gDDVVDLIAQVdLVTTAVgpvvler   94
DSSP  LEeeeeeellleeeeeeelLEEEELL---------lLHHHHHHLLLlEEEELLlhhhhhh


DSSP  ---lllllhhhhhhhhHHHH-hhllleeeeellLLLLleeeelhhhhhhhhhhhhllllL
Query ---xpfvkpevlehlyKEGE-kagcdalipkhdYPEPllayyaesaadelerailqgirK  148
ident                  |                                          
Sbjct iapaiakglvkrkeqgNESPlniiacenxvrgtTQLK---------------------gH  133
DSSP  lhhhhhhhhhhhhhhlLLLLeeeeellllllhhHHHH---------------------hH


DSSP  LHHHHHL---lLEEE--------------------------eehhhHLLL----------
Query ILVPLER---lNVVY--------------------------ypvekLRKF----------  169
ident     |       |                                               
Sbjct VXNALPEdakaWVEEhvgfvdsavdrivppndplevtvetfsewivDKTQfkgalpnipg  193
DSSP  HHLLLLHhhhhHHHHheeeeleeeelllllllllleeeellleeeeEHHHllllllllll


DSSP  ---LLLLhhhlllllhhhhhhhhHHHHHL-------------------------------
Query ---DKELisffnintpddlkraeEICSKX-------------------------------  195
ident       |                                                     
Sbjct xelTDNL-----------xafveRKLFTLntghaitaylgklaghqtirdaildekirav  242
DSSP  eeeELLH-----------hhhhhHHHHLHhhhhhhhhhhhhhlllllhhhhhllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct vkgaxeesgavlikrygfdadkhaayiqkilgrfenpylkddvervgrqplrklsagdrl  302
DSSP  hhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhllllllllhhhhlllhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct ikpllgtleyslphknliqgiagaxhfrseddpqaqelaaliadkgpqaalaqisgldan  362
DSSP  hhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhhhhhhhhhhhhhhhlllll


DSSP  ---------------
Query ---------------  195
ident                
Sbjct sevvseavtaykaxq  377
DSSP  lhhhhhhhhhhhhll


No 147: Query=mol1A Sbjct=1e19A Z-score=2.9

back to top
DSSP  -LEEEEELlllllllllLHHHLE----------elleEHHHHHHHHHL--LLEEEEELL-
Query -XKVAVLVggvgrrigxEKTEVX----------lcgkKLIEWVLEKYS--PFQTVFVCR-   46
ident    |                                                  |     
Sbjct gKRVVIAL--------gGNALQQrgqkgsyeemmdnvRKTARQIAEIIarGYEVVITHGn   52
DSSP  lLEEEEEL--------lHHHLLLllllllhhhhhhhhHHHHHHHHHHHhlLLEEEEELLl


DSSP  --------------------------------LHHHHHHHHLLLL---------------
Query --------------------------------DEKQAEKLSSRYE---------------   59
ident                                                             
Sbjct gpqvgslllhmdagqatygipaqpmdvagamsQGWIGYMIQQALKnelrkrgmekkvvti  112
DSSP  hhhhhhhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHHHHHHHhhhhhlllllleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   59
ident                                                             
Sbjct itqtivdkndpafqnptkpvgpfydeetakrlarekgwivkedsgrgwrrvvpspdpkgh  172
DSSP  lleeeellllhhhlllleeeeeeelhhhhhhhhhhhlleeeellllleeeeelllleeee


DSSP  --------------LLEEL--LLLL--------------LLLHHHHHHHHHHhHLLEEEE
Query --------------AEFIW--DLHK--------------GVGSIAGIHAALRhFGSCVVA   89
ident                                             ||   |          
Sbjct veaetikklvergvIVIASggGGVPviledgeikgveavIDKDLAGEKLAEE-VNADIFM  231
DSSP  llhhhhhhhhhlllEEELLhhHLEEeeeelleeeellllLLHHHHHHHHHHH-LLLLEEE


DSSP  ELL---------------------------------------------------------
Query AID---------------------------------------------------------   92
ident                                                             
Sbjct ILTdvngaalyygtekeqwlrevkveelrkyyeeghfkagsmgpkvlaairfiewggera  291
DSSP  EEEllllleellllllleelleeehhhhhhhhhllllllllhhhhhhhhhhhhhhlllee


DSSP  ----LLLL--LHHHhhhhhhhhhhhllleEEEEllllllleeeelhhhhhhhhhhhhlll
Query ----XPFV--KPEVlehlykegekagcdaLIPKhdypepllayyaesaadelerailqgi  146
ident             |                                               
Sbjct iiahLEKAveALEG-----------ktgtQVLP---------------------------  313
DSSP  eeeeHHHHhhHHLL-----------llleEEEL---------------------------


DSSP  lllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query rkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                                  
Sbjct -------------------------------------------------  313
DSSP  -------------------------------------------------


No 148: Query=mol1A Sbjct=1od6A Z-score=2.9

back to top
DSSP  LEEEEELLLLlllllllhhhleelleEHHHHHHHHHLL--LEEEEELL-------LHHHH
Query XKVAVLVGGVgrrigxektevxlcgkKLIEWVLEKYSP--FQTVFVCR-------DEKQA   51
ident   |                            |    |                   |   
Sbjct MHVVYPGSFD-------------pltNGHLDVIQRASRlfEKVTVAVLenqylfsAEERL   47
DSSP  LEEEEEELLL-------------lllHHHHHHHHHHHHhlLEEEEEEElllllllHHHHH


DSSP  HHHHLLLL----LLEELLLlllllhHHHHHHHHHHHllEEEEElllLLLLhhhhhhhhhh
Query EKLSSRYE----AEFIWDLhkgvgsIAGIHAALRHFgsCVVAAidxPFVKpevlehlyke  107
ident              |                   |                          
Sbjct AIIREATAhlanVEAATFS------GLLVDFVRRVG-aQAIVK---GLRA----vsdyey   93
DSSP  HHHHHHLLllllEEEEEEL------LLHHHHHHHLL-lLEEEE---EELL----lllhhh


DSSP  hhhhlLLEEeeellllllleeeelhHHHHhhhhhhhllllllhhhhhllleeeeehhhhl
Query gekagCDALipkhdypepllayyaeSAADelerailqgirkilvplerlnvvyypveklr  167
ident                                                             
Sbjct elqmaHLNR----------------QLYP--------------------------gletl  111
DSSP  hhhhhHHHH----------------HHLL--------------------------lleee


DSSP  llllllhhhllLLLH----------------hhhhhhhhhhhhl
Query kfdkelisffnINTP----------------ddlkraeeicskx  195
ident              |                              
Sbjct filaatrysfvSSTMvkeiaryggdvsklvppatlralkaklgq  155
DSSP  eeellhhhlllLHHHhhhhhhllllllllllhhhhhhhhhhlll


No 149: Query=mol1A Sbjct=1ulzA Z-score=2.9

back to top
DSSP  --LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHHHHl
Query --XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEKLSs   56
ident    || |                                     ||     |        
Sbjct mvNKVLVAN-----------------rgEIAVRIIRACKelGIPTVAIY-NEVE-STARh   41
DSSP  llLLEEELL-----------------lhHHHHHHHHHHHhhLLLEEEEE-LHHH-LLLHh


DSSP  lLLLL-EELLLLL----lLLHHHHHHHHHHHHllEEEEELLlllllhhhhhhhhhhhhhh
Query rYEAE-FIWDLHK----gVGSIAGIHAALRHFgsCVVAAIDxpfvkpevlehlykegeka  111
ident    |                    |  ||                               
Sbjct vKLADeAYMIGTDpldtyLNKQRIINLALEVG-aDAIHPGY-------------------   81
DSSP  hHHLLeEEELLLLllhhhHLHHHHHHHHHHLL-lLEEELLL-------------------


DSSP  llleeeeellLLLL-leEEELhhhhhhhhhhhhllllllhhhhhllleeEEEH-------
Query gcdalipkhdYPEP-llAYYAesaadelerailqgirkilvplerlnvvYYPV-------  163
ident                                                     |       
Sbjct ----gflaenAEFAkmcEEAG----------------------itfigpHWKVielmgdk  115
DSSP  ----llllllHHHHhhhHHLL----------------------leelllLHHHhhhhhlh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  163
ident                                                             
Sbjct arskevmkkagvpvvpgsdgvlksleeakalareigypvllkataggggrgiricrneee  175
DSSP  hhhhhhhhhlllllllllllllllhhhhhhhhhhhllleeeeellllllllleeellhhh


DSSP  -------------------------------------hhHLLLLL---------------
Query -------------------------------------ekLRKFDK---------------  171
ident                                                             
Sbjct lvknyeqasreaekafgrgdlllekfienpkhieyqvlgDKHGNVihlgerdcsiqrrnq  235
DSSP  hhhhhhhhhhhhhhlllllleeeeellllleeeeeeeeeLLLLLEeeeeeeeeeeeelle


DSSP  -------------------------------lLHHH------------------lLLLLh
Query -------------------------------eLISF------------------fNINTp  182
ident                                                         |   
Sbjct klveiapsliltpekreyygnivtkaakeigyYNAGtmefiadqegnlyfiemntRIQV-  294
DSSP  eeeeeellllllhhhhhhhhhhhhhhhhhlllLEEEeeeeeellllleeeeeeelLLLL-


DSSP  hhhhHHHHHHHHL-----------------------------------------------
Query ddlkRAEEICSKX-----------------------------------------------  195
ident                                                             
Sbjct ----EHPVSEMVTgidivkwqikiaagepltikqedvkfngyaiecrinaedpkknfaps  350
DSSP  ----LHHHHHHHHlllhhhhhhhhhllllllllhhhllllleeeeeeeeleehhhlleel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct trvieryyvpggfgirvehaaargfevtpyydsmiaklitwaptwdeavermraaletye  410
DSSP  lllllleelllllleeeeelllllllllllllleeeeeeeeellhhhhhhhhhhhhhlle


DSSP  -----------------------------------------
Query -----------------------------------------  195
ident                                          
Sbjct itgvkttipllinimkekdfkagkfttkyleehpevfeyee  451
DSSP  ellllllhhhhhhhhhlhhhhhlllllllllllhhhhllll


No 150: Query=mol1A Sbjct=2ah5A Z-score=2.9

back to top
DSSP  ----LEEEEELlllllllllLHHHL-----------------------------------
Query ----XKVAVLVggvgrrigxEKTEV-----------------------------------   21
ident                                                             
Sbjct xtsiTAIFFDL--------dGTLVDssigihnaftytfkelgvpspdaktirgfxgpple   52
DSSP  llllLEEEELL--------lLLLEElhhhhhhhhhhhhhhhllllllhhhhhhlllllhh


DSSP  -----------------------------eelleehhhhhHHHHL-LLEEEEELL-LHHH
Query -----------------------------xlcgkkliewvLEKYS-PFQTVFVCR-DEKQ   50
ident                                         ||  |           |   
Sbjct ssfatclskdqiseavqiyrsyykakgiyeaqlfpqiidlLEELSsSYPLYITTTkDTST  112
DSSP  hhhhllllhhhhhhhhhhhhhhhhhlhhhlleelllhhhhHHHHHlLLLEEEEEEeEHHH


DSSP  HHHHHL---LLLL--LEELLLLLLLLHHHHHHHHHHHHLL---eEEEELLlllllhhhhh
Query AEKLSS---RYEA--EFIWDLHKGVGSIAGIHAALRHFGS---cVVAAIDxpfvkpevle  102
ident |                             || ||              |          
Sbjct AQDXAKnleIHHFfdGIYGSSPEAPHKADVIHQALQTHQLapeqAIIIGD----------  162
DSSP  HHHHHHhllLHHHllEEEEELLLLLLHHHHHHHHHHHLLLlhhhEEEEEL----------


DSSP  hhhhhhhhhllleeeeelllllLLEEeelhhhhhhhhhhhhllllllhhhhhllleeeee
Query hlykegekagcdalipkhdypePLLAyyaesaadelerailqgirkilvplerlnvvyyp  162
ident                                                             
Sbjct -----------tkfdxlgaretGIQK----------------------------------  177
DSSP  -----------lhhhhhhhhhhLLEE----------------------------------


DSSP  hhhhlllllllhhhllLLLHHH----------hhhhhhhhhhl
Query veklrkfdkelisffnINTPDD----------lkraeeicskx  195
ident                      |                     
Sbjct ----------laitwgFGEQADllnyqpdyiahkplevlayfq  210
DSSP  ----------eeelllLLLHHHhhllllleeellllhhhhhll


No 151: Query=mol1A Sbjct=2dvmA Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct irekalefhknnfpgngkievipkvslesreeltlaytpgvaepckeiardpgkvyeyts   60
DSSP  lhhhhhhhlllllllllleeeeellllllhhhhhhhlllllhhhhhhhhhlhhhhhhhll


DSSP  --LEEEEELLLLL--lLLLL---LHHHleelleeHHHHHHHHHLL---LEEEEELLLhhh
Query --XKVAVLVGGVG--rRIGX---EKTEvxlcgkkLIEWVLEKYSP---FQTVFVCRDekq   50
ident     |||   |                         |                       
Sbjct kgNLVAVVSDGSRilgLGNIgplAGLP-------VMEGKALLFKRfggVDAFPIMIK---  110
DSSP  hhHEEEEEELLLLlllLLLLlhhHHHH-------HHHHHHHHHHHhhlLEEEEEELL---


DSSP  hhhhhlllllleelllllLLLHHHHHHHHHhhhLLEEEEELL------------------
Query aeklssryeaefiwdlhkGVGSIAGIHAALrhfGSCVVAAID------------------   92
ident                             |            |                  
Sbjct --------------eqepNKFIDIVKAIAP---TFGGINLEDiaspkcfyilerlreeld  153
DSSP  --------------lllhHHHHHHHHHLHH---HLLEEEELLllllhhhhhhhhhhhhll


DSSP  -----LLLL---------------------------------------------------
Query -----XPFV---------------------------------------------------   96
ident                                                             
Sbjct ipvfhDDQQgtaavvlagllnalkvvgkkiseitlalfgagaagfatlrilteagvkpen  213
DSSP  lleeeHHHHhhhhhhhhhhhhhhhhhlllllllleeeelllhhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct vrvvelvngkpriltsdldleklfpyrgwllkktngenieggpqealkdadvlisftrpg  273
DSSP  eeeeeeelleeeellllllhhhhllllhhhhlllllllllllhhhhhlllleeeelllll


DSSP  ---------------------------------------------------------LHH
Query ---------------------------------------------------------KPE   99
ident                                                           | 
Sbjct pgvikpqwiekmnedaivfplanpvpeilpeeakkagarivatgrsdypnqinnllgFPG  333
DSSP  lllllhhhhllllllleeeelllllllllhhhhhhhllleellllllllllllhhhlHHH


DSSP  HHHHHHHHHHhhlllEEEEELlllllleeeelhhhhhhhhhhhhllllllhhhhhlllee
Query VLEHLYKEGEkagcdALIPKHdypepllayyaesaadelerailqgirkilvplerlnvv  159
ident                  |                                          
Sbjct IFRGALDVRA-----RTITDS---------------------------------------  349
DSSP  HHHHHHHLLL-----LLLLHH---------------------------------------


DSSP  eeEHHHHLLLLL------------------------------------------------
Query yyPVEKLRKFDK------------------------------------------------  171
ident         |                                                   
Sbjct --MIIAAAKAIAsiveepseeniipsplnpivyarearavaeeamkegvartkvkgewve  407
DSSP  --HHHHHHHHHHhllllllllllllllllhhhhhhhhhhhhhhhhhhllllllllhhhhh


DSSP  -------llhhhlllllhhhhhhhhhhhhhl
Query -------elisffnintpddlkraeeicskx  195
ident                                
Sbjct ehtirliefyenviapinkkrreyskaitra  438
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhlllllll


No 152: Query=mol1A Sbjct=2a9fA Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lknqlgqlaleqaktfggklevqpkvdiktkhdlsiaytpgvasvssaiakdktlaydlt   60
DSSP  llllllllllhhhhhhllleeeeellllllhhhhhhhlllllhhhhhhhhhlhhhhhhhl


DSSP  ---LEEEEELLLLlllllllHHHL--eelleehHHHHHHHHLLL------EEEEELLLHh
Query ---XKVAVLVGGVgrrigxeKTEV--xlcgkklIEWVLEKYSPF------QTVFVCRDEk   49
ident      |||   |                           |   |             |  
Sbjct tkkNTVAVISDGT-------AVLGlgdigpeaaMPVMEGKAALFkafagvDAIPIVLDT-  112
DSSP  hhhLEEEEEELLL-------LLLLlllllhhhhHHHHHHHHHHHhhhlllEEEEEELLL-


DSSP  hhhhhhlllllleelllllLLLHHHhHHHHHhhHLLEEEEELL-----------------
Query qaeklssryeaefiwdlhkGVGSIAgIHAALrhFGSCVVAAID-----------------   92
ident                             |             |                 
Sbjct ----------------kdtEEIISI-VKALA--PTFGGINLEDisaprcfeieqrlikec  153
DSSP  ----------------llhHHHHHH-HHHHH--HHLLEEEELLllllhhhhhhhhhhhhl


DSSP  ------LLLL--------------------------------------------------
Query ------XPFV--------------------------------------------------   96
ident                                                             
Sbjct hipvfhDDQHgtaivvlaaifnslkllkksldevsivvngggsaglsitrkllaagatkv  213
DSSP  llleeeHHHHhhhhhhhhhhhhhhhllllllllleeeeelllhhhhhhhhhhhhhlllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct tvvdkfgiineqeaaqlapdiakvtnrefksgtledalegadifigvsapgvlkaewisk  273
DSSP  eeeelleellllllllllllhhhhhllllllllllhhhhlllleeellllllllhhhhhl


DSSP  ----------------------------------------------LHHHHHHHHHHHHh
Query ----------------------------------------------KPEVLEHLYKEGEk  110
ident                                                |            
Sbjct maarpvifamanpipeiypdealeagayivgtgrsdfpnqinnvlaFPGIFRGALDARA-  332
DSSP  llllleeeelllllllllhhhhhllllleeeellllllllllhhhlHHHHHHHHHHHLL-


DSSP  hlllEEEEELlllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeEHHHHLLLL
Query agcdALIPKHdypepllayyaesaadelerailqgirkilvplerlnvvyyPVEKLRKFD  170
ident       |                                                  |  
Sbjct ----KTITVE-----------------------------------------MQIAAAKGI  347
DSSP  ----LLLLHH-----------------------------------------HHHHHHHHH


DSSP  L-----------llhhhlllllhhhhhhhhhhhhhl
Query K-----------elisffnintpddlkraeeicskx  195
ident                                     
Sbjct Aslvpddalsttniipdafkegvaeivaksvrsvvl  383
DSSP  Hhllllllllllllllllllhhhhhhhlllllllll


No 153: Query=mol1A Sbjct=2vyvD Z-score=2.9

back to top
DSSP  -LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEE-EEELLlhHHHHHHHL
Query -XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQT-VFVCRdeKQAEKLSS   56
ident   ||                            ||                     |    
Sbjct mVKVGING-----------------fgRIGRLVLRVCMekGVRVvAVNDP-fIDPEYMVY   42
DSSP  lLEEEEEL-----------------llHHHHHHHHHHHhhLLEEeEEELL-lLLHHHHHH


DSSP  LLL------------------------lLEELllllLLLHHHHhhHHHHHHLlEEEEELL
Query RYE------------------------aEFIWdlhkGVGSIAGihAALRHFGsCVVAAID   92
ident                                                        |    
Sbjct MFKydsthgrykgtvehkngrlvvdnleINVF---qXKEPKEI--PWSSVGN-PYVVEAT   96
DSSP  HHHllllllllllleeeelleeeelleeEEEE---lLLLHHHL--LHHHHLL-LEEEELL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct gvylsieaasghissgarrvivtapspdapmlvmgvnekdynpgsmtvvsnasxttncla  156
DSSP  lllllhhhhlhhhhllllleeelllllllllllllllhhhllllllleeelllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct plakviherfgiveglmttvhaytatqktvdgpskkdwrggrgahqniipsstgaakavg  216
DSSP  hhhhhhhhhhleeeeeeeeeeelllllllllllllllhhhhllllllleeelllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct kvipelngkltgmafrvptpnvsvvdltcrlaqpasytaikeavkaaakgpmagilayte  276
DSSP  hhlhhhllleeeeeeeellllleeeeeeeeelllllhhhhhhhhhhhhhlllllleeeel


DSSP  -----------------------------------------lLLLLHHHHHHHHHHHhhh
Query -----------------------------------------xPFVKPEVLEHLYKEGeka  111
ident                                                  |          
Sbjct dqvvstdfngdshssifdakagialndnfvklvswydneygySHRVVDLLRYMFSRE---  333
DSSP  llllhhhhlllllleeeehhhleeeelleeeeeeeelllhhhHHHHHHHHHHHHHLL---


DSSP  llleeeeellllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllll
Query gcdalipkhdypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdk  171
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  llhhhlllllhhhhhhhhhhhhhl
Query elisffnintpddlkraeeicskx  195
ident                         
Sbjct -----------------------k  334
DSSP  -----------------------l


No 154: Query=mol1A Sbjct=1te2A Z-score=2.9

back to top
DSSP  --LEEEEELLLL----LLLLL---------------------------------------
Query --XKVAVLVGGV----GRRIG---------------------------------------   15
ident      |                                                      
Sbjct rqILAAIFDXDGllidSEPLWdraeldvxaslgvdisrrnelpdtlglridxvvdlwyar   60
DSSP  llLLEEEELLLLllllLHHHHhhhhhhhhhhllllhhhhhhllllllllhhhhhhhhhhh


DSSP  -------------------llhhhleelleEHHHHHHHHHLL-LEEEEELL---LHHHHH
Query -------------------xektevxlcgkKLIEWVLEKYSP-FQTVFVCR---DEKQAE   52
ident                                               |             
Sbjct qpwngpsrqevverviaraislveetrpllPGVREAVALCKEqGLLVGLASaspLHXLEK  120
DSSP  lllllllhhhhhhhhhhhhhhhhhhhllllLLHHHHHHHHHHlLLEEEEEElllHHHHHH


DSSP  HHHLL--LLLL-EELLLLLL---llhHHHHHHHHH-HHLL--EEEEELL-----------
Query KLSSR--YEAE-FIWDLHKG---vgsIAGIHAALR-HFGS--CVVAAID-----------   92
ident  |                |                         ||  |           
Sbjct VLTXFdlRDSFdALASAEKLpyskphPQVYLDCAAkLGVDplTCVALEDsvngxiaskaa  180
DSSP  HHHHLllHHHLlEEEELLLLllllllLHHHHHHHHhHLLLhhHEEEEELlhhhhhhhhhl


DSSP  ---------------------------LLLLLHHHHHHhhhhhhhhllleeeeellllll
Query ---------------------------XPFVKPEVLEHlykegekagcdalipkhdypep  125
ident                                    |                        
Sbjct rxrsivvpapeaqndprfvlanvklssLTELTAKDLLG----------------------  218
DSSP  lleeeelllllllllhhhhhlleelllHHHLLHHHHHL----------------------


DSSP  leeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhh
Query llayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkelisffnintpddl  185
ident                                                             
Sbjct ------------------------------------------------------------  218
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhl
Query kraeeicskx  195
ident           
Sbjct ----------  218
DSSP  ----------


No 155: Query=mol1A Sbjct=1vl6B Z-score=2.9

back to top
DSSP  ----------------------------------------------------------LE
Query ----------------------------------------------------------XK    2
ident                                                             
Sbjct hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwNT   60
DSSP  lllhhhhhhhhlllleeelllllllhhhhhhhllllhhhhhhhhhhlhhhhhhhlhhhHE


DSSP  EEEELLLLL-lLLLLLHHHLeelleeHHHHHHHHHLL------LEEEEELLLhhhhhhhh
Query VAVLVGGVG-rRIGXEKTEVxlcgkkLIEWVLEKYSP------FQTVFVCRDekqaekls   55
ident |||   |      |                   |               |          
Sbjct VAVVSDGSAvlGLGNIGPYG------ALPVXEGKAFLfkafadIDAFPICLS--------  106
DSSP  EEEEELLLLllLLLLLLHHH------HHHHHHHHHHHhhhhhlLEEEEEELL--------


DSSP  lllllleelllllLLLHHHhHHHHHhhHLLEEEEELL-----------------------
Query sryeaefiwdlhkGVGSIAgIHAALrhFGSCVVAAID-----------------------   92
ident                                     |                       
Sbjct ---------eseeEKIISI-VKSLE--PSFGGINLEDigapkcfrilqrlseexnipvfh  154
DSSP  ---------lllhHHHHHH-HHHLH--HHLLEEEELLllllhhhhhhhhhhhhlllleee


DSSP  LLLL--------------------------------------------------------
Query XPFV--------------------------------------------------------   96
ident                                                             
Sbjct DDQQgtavvvsaaflnalkltekvvvngigaagynivkflldlgvknvvavdrkgilnen  214
DSSP  HHHHhhhhhhhhhhhhhhhhhllleeelllhhhhhhhhhhhhhllllleeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct dpetclneyhleiaritnperlsgdletalegadffigvsrkpewvifalanpvpelare  274
DSSP  lhhhlllhhhhhhhhhlllllllllhhhhhllllleeelllllllleeelllllllllll


DSSP  ----------------------LHHHHHHHHHHHHhhllleEEEELlllllleeeelhhh
Query ----------------------KPEVLEHLYKEGEkagcdaLIPKHdypepllayyaesa  134
ident                        |                  | |               
Sbjct agafivatgrsdhpnqvnnllaFPGIXKGAVEKRS------KITKN--------------  314
DSSP  llllleelllllllllllhhhlHHHHHHHHHHHLL------LLLHH--------------


DSSP  hhhhhhhhhllllllhhhhhllleeeeEHHHHLLLLL-------llhhhlllllhhhhhh
Query adelerailqgirkilvplerlnvvyyPVEKLRKFDK-------elisffnintpddlkr  187
ident                                                             
Sbjct ---------------------------XLLSAVEAIArscepeperiipeafdxkvhlnv  347
DSSP  ---------------------------HHHHHHHHHHllllllllllllllllhhhhhhh


DSSP  hhhhhhhl
Query aeeicskx  195
ident         
Sbjct ytavkgsa  355
DSSP  hhhhhhll


No 156: Query=mol1A Sbjct=1u0lA Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpdetgsgvie   60
DSSP  lleeeeeeeeelleeeeeellllleeeeeelhhhllllllllllleeeeelllllleeee


DSSP  -----------------LEEEEELLLLLlllllLHHHleelleEHHHHHHHHHL--LLEE
Query -----------------XKVAVLVGGVGrrigxEKTEvxlcgkKLIEWVLEKYS--PFQT   41
ident                    |   |         |           |   |         |
Sbjct nvlhrknlltkphvanvDQVILVVTVKM----pETST------YIIDKFLVLAEknELET  110
DSSP  eellllleelllleellLEEEEEELLLL----lLLLH------HHHHHHHHHHHhlLLEE


DSSP  EEELLL--------hhhhHHHHLLL--LLLEELL--LLLLllhhhhhHHHHHHHL--LEE
Query VFVCRD--------ekqaEKLSSRY--EAEFIWD--LHKGvgsiagiHAALRHFG--SCV   87
ident | |                 |   |                                   
Sbjct VMVINKmdlydeddlrkvRELEEIYsgLYPIVKTsaKTGM-----giEELKEYLKgkIST  165
DSSP  EEEELLhhhllhhhhhhhHHHHHHHllLLLEEELllLLLL-----lhHHHHHHHLllEEE


DSSP  EEELLlllllhhhhhhhhhhhhhhllLEEEEellllllleeeelhhhhhhhhhhhhllll
Query VAAIDxpfvkpevlehlykegekagcDALIPkhdypepllayyaesaadelerailqgir  147
ident  |                                                          
Sbjct MAGLS--------gvgkssllnainpGLKLR-----------------------------  188
DSSP  EELLL--------lllhhhhhhhhllLLLLL-----------------------------


DSSP  llhhhhhllleeeeehHHHL----------------------------------------
Query kilvplerlnvvyypvEKLR----------------------------------------  167
ident                                                             
Sbjct ---------------tTTTAqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdk  233
DSSP  ---------------lLLLLleeellllleeellllllllllllllhhhhhhhlllllll


DSSP  ---------------llllllhhhlllllhhhhhhHHHHHHHL--
Query ---------------kfdkelisffnintpddlkrAEEICSKX--  195
ident                                              
Sbjct qcffsdcnhvdepecgvkeavengeiaesryenyvKMFYELLGrr  278
DSSP  lllllllllllllllhhhhhhhhllllhhhhhhhhHHHHHHHLll


No 157: Query=mol1A Sbjct=3ccfB Z-score=2.9

back to top
DSSP  ---------------------LEEEEELllllllllllhhhleelleehhhHHHHHHL--
Query ---------------------XKVAVLVggvgrrigxektevxlcgkklieWVLEKYS--   37
ident                           |                           ||    
Sbjct khsfvwqygedllqllnpqpgEFILDLG-------------------cgtgQLTEKIAqs   41
DSSP  lllllllllhhhhhhhlllllLEEEEEL-------------------llllHHHHHHHhl


DSSP  LLEEEEELLLHHHHHHHHLLL-LLLEELLlllllLHHHHhhhhhHHHLLE-EEEELL---
Query PFQTVFVCRDEKQAEKLSSRY-EAEFIWDlhkgvGSIAGihaalRHFGSC-VVAAID---   92
ident               ||    |    |                  |       |       
Sbjct GAEVLGTDNAATXIEKARQNYpHLHFDVA-----DARNF-----RVDKPLdAVFSNAxlh   91
DSSP  LLEEEEEELLHHHHHHHHHHLlLLLEEEL-----LLLLL-----LLLLLEeEEEEELlhh


DSSP  ----lllllhhhhhhhHHHH------------------------------hhhllleeee
Query ----xpfvkpevlehlYKEG------------------------------ekagcdalip  118
ident                    |                                        
Sbjct wvkepeaaiasihqalKSGGrfvaefggkgnikyilealynaletlgihnpqalnpwyfp  151
DSSP  hlllhhhhhhhhhhheEEEEeeeeeeelllllhhhhhhhhhhhhhlllllhhhhllllll


DSSP  eLLLLllleeeelhhhhhhhhhhhhllllllhhhhhlLLEEEEEH---------------
Query kHDYPepllayyaesaadelerailqgirkilvplerLNVVYYPV---------------  163
ident                                                             
Sbjct sIGEY---------------------------vnileKQGFDVTYaalfnrpttlaegef  184
DSSP  lHHHH---------------------------hhhhhHHLEEEEEeeeeeeeeelllhhh


DSSP  --------------------------hhhlllllllhhhlllllHHHHhhhhhhhhhl
Query --------------------------eklrkfdkelisffnintPDDLkraeeicskx  195
ident                                              |            
Sbjct gxanwiqxfasaflvgltpdqqvqlirkveatlqdklyhqeswtADYRririvsikaq  242
DSSP  hhhhhhhhhlhhhlllllhhhhhhhhhhhhhhhhhhheelleeeEEEEeeeeeeeell


No 158: Query=mol1A Sbjct=2hoqA Z-score=2.9

back to top
DSSP  --LEEEEELllllllllllhHHLE------------------------------------
Query --XKVAVLVggvgrrigxekTEVX------------------------------------   22
ident                                                             
Sbjct mvKVIFFDL------ddtlvDTSKlaeiarknaienmirhglpvdfetayselielikey   54
DSSP  llLEEEELL------lllllLHHHhhhhhhhhhhhhhhhllllllhhhhhhhhhhhhhhh


DSSP  -----------------------------------elleeHHHHHHHHHLL-----LEEE
Query -----------------------------------lcgkkLIEWVLEKYSP-----FQTV   42
ident                                                             
Sbjct gsnfpyhfdyllrrldlpynpkwisagviayhntkfaylrEVPGARKVLIRlkelgYELG  114
DSSP  llllllhhhhhhhhllllllhhhhhhhhhhhhhhhhhhllLLLLHHHHHHHhhhhlLEEE


DSSP  EELLL-HHHHHHHHLL---LLLL--EELL-LLLLLLH-HHHHHHHHHHHL----LEEEEE
Query FVCRD-EKQAEKLSSR---YEAE--FIWD-LHKGVGS-IAGIHAALRHFG----SCVVAA   90
ident                |          |                 ||  |           
Sbjct IITDGnPVKQWEKILRlelDDFFehVIISdFEGVKKPhPKIFKKALKAFNvkpeEALMVG  174
DSSP  EEELLlHHHHHHHHHHlllHHHLleEEEHhHHLLLLLlHHHHHHHHHHHLllhhHEEEEE


DSSP  ---------------------------------------lllLLLLHHHHHHHhhHHHHH
Query ---------------------------------------idxPFVKPEVLEHLykEGEKA  111
ident                                                |||        | 
Sbjct drlysdiygakrvgmktvwfrygkhsereleyrkyadyeidnLESLLEVLARE-sSSNKK  233
DSSP  llllllhhhhhhllleeeeellllllhhhhllhhhlleeellLLHHHHHHHHL-lLLLLL


DSSP  Llleeeeellllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllll
Query Gcdalipkhdypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdk  171
ident                                                             
Sbjct V-----------------------------------------------------------  234
DSSP  L-----------------------------------------------------------


DSSP  llhhhlllllhhhhhhhhhhhhhl
Query elisffnintpddlkraeeicskx  195
ident                         
Sbjct ---------------------hpp  237
DSSP  ---------------------lll


No 159: Query=mol1A Sbjct=2yv5A Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mgkkelkrglvvdreaqmigvylfedgktyrgiprgkvlkktkiyagdyvwgevvdpntf   60
DSSP  lllllleeeeeeeeelleeeeeellllleeeeeelllllllllllllleeeeeeeellee


DSSP  --------------------LEEEEELlLLLLllllLHHHleelleEHHHHHHHHHL--L
Query --------------------XKVAVLVgGVGRrigxEKTEvxlcgkKLIEWVLEKYS--P   38
ident                       |             |          |    |  |    
Sbjct aieeveerknllirpkvanvDRVIIVE-TLKM---pEFNN------YLLDNMLVVYEyfK  110
DSSP  eeeeellllleeelleeellLEEEEEE-LLLL---lLLLH------HHHHHHHHHHHhlL


DSSP  LEEEEELLL--------hhhhHHHHLLL---LLLEELL--lLLLLlhhhhhHHHHHHH--
Query FQTVFVCRD--------ekqaEKLSSRY---EAEFIWD--lHKGVgsiagiHAALRHF--   83
ident    | |               |   | |                                
Sbjct VEPVIVFNKidllneeekkelERWISIYrdaGYDVLKVsakTGEG-----iDELVDYLeg  165
DSSP  LEEEEEELLhhhllhhhhhhhHHHHHHHhhlLLEEEELlllLLLL-----hHHHHHHLll


DSSP  LLEEEEELLlllllhhhhhhhhhhhhhhlllEEEEELLLlllleeeelhhhhhhhhhhhh
Query GSCVVAAIDxpfvkpevlehlykegekagcdALIPKHDYpepllayyaesaadelerail  143
ident   |  |                                                      
Sbjct FICILAGPS---------gvgkssilsrltgEELRTQEV---------------------  195
DSSP  LEEEEELLL---------lllhhhhhhhhhlLLLLLLLL---------------------


DSSP  llllllhhhhhllleeeeehHHHL------------------------------------
Query qgirkilvplerlnvvyypvEKLR------------------------------------  167
ident                                                             
Sbjct --------------------TTTGvrlipfgkgsfvgdtpgfskveatmfvkprevrnyf  235
DSSP  --------------------LLLLeeeeeellleeeelllllllllhhhlllhhhhhhhl


DSSP  -------------------llllllhhhlllllhhhhhhhhhhHHHL-----------
Query -------------------kfdkelisffnintpddlkraeeiCSKX-----------  195
ident                                                           
Sbjct reflryqckypdcthtnepgcavkeavkngeisceryksylkiIKVYleeikelcred  293
DSSP  hhhhhhhhhllllllllllllhhhhhhhlllllhhhhhhhhhhLLLLlllhhhhllll


No 160: Query=mol1A Sbjct=1uufA Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ikavgaysakqplepmditrrepgpndvkieiaycgvchsdlhqvrsewagtvypcvpgh   60
DSSP  leeeelllllllleeeellllllllleeeeeeeeeellhhhhhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eivgrvvavgdqvekyapgdlvgvgcivdsckhceecedglenycdhmtgtynsptpdep  120
DSSP  leeeeeeeellllllllllleeeelleeelllllhhhhlllhhhlllleellllllllll


DSSP  -----------------------------------------------------LEEEEEL
Query -----------------------------------------------------XKVAVLV    7
ident                                                       || |  
Sbjct ghtlggysqqivvheryvlrirhpqeqlaavapllcagittysplrhwqagpgKKVGVVG  180
DSSP  llllllllleeeeehhhleellllhhhhhhhhhhhlhhhhhhhhhhhllllllLEEEEEL


DSSP  llllllllllhhhleelleEHHHHHHHHHL--LLEEEEELLLHHHHHHHHlLLLL-LEEL
Query ggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCRDEKQAEKLSsRYEA-EFIW   64
ident                     |               |     |   |       | |   
Sbjct -----------------igGLGHMGIKLAHamGAHVVAFTTSEAKREAAK-ALGAdEVVN  222
DSSP  -----------------llHHHHHHHHHHHhlLLEEEEEELLHHHHHHHH-HHLLlEEEE


DSSP  LLLllllhhhhhhHHHHHHLLE-EEEELLlllllhhhhhhhhhhhhhhllleeeeellll
Query DLHkgvgsiagihAALRHFGSC-VVAAIDxpfvkpevlehlykegekagcdalipkhdyp  123
ident                  |  |                                       
Sbjct SRN--------adEMAAHLKSFdFILNTV---------------aaphnlddfttllkrd  259
DSSP  LLL--------hhHHHLLLLLEeEEEELL---------------lllllhhhhhlleeee


DSSP  LLLEeeelhhhhhhhhhhhhlllllLHHHHhlLLEEeeehhhhlllllllhhHLLLllhh
Query EPLLayyaesaadelerailqgirkILVPLerLNVVyypveklrkfdkelisFFNIntpd  183
ident                            |                           |    
Sbjct GTMT-----------------lvgaPEVFN-lIMKR------------raiaGSMI----  285
DSSP  EEEE-----------------elllLLHHH-hHLLL------------leeeELLL----


DSSP  hhhHHHHHHHHL---------------------------------------------
Query dlkRAEEICSKX---------------------------------------------  195
ident                                                          
Sbjct ---GGIPETQEMldfcaehgivadiemiradqineayermlrgdvkyrfvidnrtlt  339
DSSP  ---LLHHHHHHHhhhhhhhllllleeeelhhhhhhhhhhhhlllllleeeeehhhhl


No 161: Query=mol1A Sbjct=1dehA Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp   60
DSSP  lllllleeeeeeeellllllleeeeeeelllllleeeeeeeeeellhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr  120
DSSP  lleellleeeeeeeeellllllllllleeeelllllllllhhhhllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy  180
DSSP  llllllllleeelleeellllllllllleeeeehhheeelllllllllhhhhhlhhhhhh


DSSP  ------------LEEEEELllllllllllhhhleelleEHHHHHHHHHL---LLEEEEEL
Query ------------XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS---PFQTVFVC   45
ident                ||                                         | 
Sbjct gsavnvakvtpgSTCAVFG-----------------lgGVGLSAVMGCKaagAARIIAVD  223
DSSP  hhhhllllllllLEEEEEL-----------------llHHHHHHHHHHHhhlLLEEEEEL


DSSP  llhhHHHHHHLLLL----LLEELL-LLLLllhhHHHHHHHHHH-LLEE-EEELLlllllh
Query rdekQAEKLSSRYE----AEFIWD-LHKGvgsiAGIHAALRHF-GSCV-VAAIDxpfvkp   98
ident                    | |     |                |               
Sbjct ----INKDKFAKAKelgaTECINPqDYKK----PIQEVLKEMTdGGVDfSFEVI------  269
DSSP  ----LLHHHHHHHHhhllLEEELHhHLLL----LHHHHHHHHLlLLLLeEEELL------


DSSP  hhhhhhhhhhhhhllleeeeelllllLLEE-eELHH-hhhhhhhhhhlllLLLHhhHHLL
Query evlehlykegekagcdalipkhdypePLLA-yYAES-aadelerailqgiRKILvpLERL  156
ident                                   |                        |
Sbjct --------------------grldtmMASLlcCHEAcgtsvivgvppasqNLSI--NPML  307
DSSP  --------------------llhhhhHHHHhlLLLLlleeeellllllllLEEE--LLHH


DSSP  LEEeeehhhhlllllllhHHLLLllhhhhhHHHH-hHHHL--------------------
Query NVVyypveklrkfdkeliSFFNIntpddlkRAEE-iCSKX--------------------  195
ident                                                             
Sbjct LLT-----------grtwKGAVY------gGFKSkeGIPKlvadfmakkfsldalithvl  350
DSSP  HHL-----------lleeEELLH------hHLLHhhHHHHhhhhhhllllllllleeeee


DSSP  ------------------------
Query ------------------------  195
ident                         
Sbjct pfekinegfdllhsgksirtvltf  374
DSSP  ehhhhhhhhhhhhhlllleeeeel


No 162: Query=mol1A Sbjct=1jg1A Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ekelyekwmrtvemlkaegiirskeveraflkyprylsvedkykkyahideplpipagqt   60
DSSP  lhhhhhhhhhhhhhhhhllllllhhhhhhhhhllhhhhllhhhhhhlllllleellllle


DSSP  -------------------LEEEEELllllllllllhhhleelleehhhHHHHHHL---L
Query -------------------XKVAVLVggvgrrigxektevxlcgkklieWVLEKYS---P   38
ident                                                  |     |    
Sbjct vsaphmvaimleianlkpgMNILEVG-------------------tgsgWNAALISeivK  101
DSSP  ellhhhhhhhhhhhlllllLLEEEEL-------------------llllHHHHHHHhhhL


DSSP  LEEEEELLLHHHHHHHHLLLL------LLEELLllllllhhHHHHHHhHHHLLE-EEEEL
Query FQTVFVCRDEKQAEKLSSRYE------AEFIWDlhkgvgsiAGIHAAlRHFGSC-VVAAI   91
ident        |     |      |         |           |            |    
Sbjct TDVYTIERIPELVEFAKRNLEragvknVHVILG--------DGSKGF-PPKAPYdVIIVT  152
DSSP  LLEEEEELLHHHHHHHHHHHHhlllllEEEEEL--------LHHHLL-HHHLLEeEEEEL


DSSP  L-lllllhhhhhhhHHHHhhhllleeeeellllLLLEeeelhhhhhhhhhhhhllllllh
Query D-xpfvkpevlehlYKEGekagcdalipkhdypEPLLayyaesaadelerailqgirkil  150
ident                  |                                          
Sbjct AgapkipeplieqlKIGG---------------KLII-----------pvgsyhlwqell  186
DSSP  LllllllhhhhhleEEEE---------------EEEE-----------eelllllleeee


DSSP  hhhhlLLEEEEEHhhhlllllLLHHhLLLLlhhhhhhhhhhhhhl
Query vplerLNVVYYPVeklrkfdkELISfFNINtpddlkraeeicskx  195
ident                                              
Sbjct evrktKDGIKIKN--------HGGV-AFVP-------ligeygwk  215
DSSP  eeeeeLLEEEEEE--------EEEE-LLLL-------llllllll


No 163: Query=mol1A Sbjct=1ys6B Z-score=2.9

back to top
DSSP  -LEEEEELLlllllllllhhhleelleEHHHHHHHHHL--LLEEEEELllhhhhhhhhll
Query -XKVAVLVGgvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrdekqaeklssr   57
ident    | |                                   |                  
Sbjct sPRVLVVDD----------------dsDVLASLERGLRlsGFEVATAV------------   32
DSSP  lLEEEEELL----------------lhHHHHHHHHHHHhlLLEEEEEL------------


DSSP  lllleellllllllHHHHHHHHHHHHLLEEEEELL-------------------------
Query yeaefiwdlhkgvgSIAGIHAALRHFGSCVVAAID-------------------------   92
ident                 |                                           
Sbjct --------------DGAEALRSATENRPDAIVLDInmpvldgvsvvtalramdndvpvcv   78
DSSP  --------------LHHHHHHHHHHHLLLEEEEELllllllhhhhhhhhhhlllllleee


DSSP  --------------------------llLLLHHHHHHHHHHHHHHllleeeeelllllll
Query --------------------------xpFVKPEVLEHLYKEGEKAgcdalipkhdypepl  126
ident                                      |                      
Sbjct lsarssvddrvagleagaddylvkpfvlAELVARVKALLRRRGST--------------a  124
DSSP  eeelllhhhhhhhhhhllleeeeelllhHHHHHHHHHHHHLLLLL--------------l


DSSP  eeeelhhhhhhhhhhhhllllllhhhhhLLLEEE------------------eEHHH---
Query layyaesaadelerailqgirkilvpleRLNVVY------------------yPVEK---  165
ident                              |                         |    
Sbjct tsssetitvgplevdipgrrarvngvdvDLTKREfdllavlaehktavlsraqLLELvwg  184
DSSP  lllllleeelleeeelllleeeelleelLLLHHHhhhhhhhhhlllllllhhhHHHHlll


DSSP  HLLLLLL-------------lhhhlllllhhhhhhhhhhhhhl
Query LRKFDKE-------------lisffnintpddlkraeeicskx  195
ident                                            
Sbjct YDFAADTnvvdvfigylrrkleagggprllhtvrgvgfvlrmq  227
DSSP  LLLLLLLlhhhhhhhhhhhhhhllllllleeeellleeeelll


No 164: Query=mol1A Sbjct=1p0cA Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct ctagkditckaavawephkplsletitvappkahevrikilasgicgsdssvlkeiipsk   60
DSSP  lllllleeeeeeeellllllleeeeeeelllllleeeeeeeeeellhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct fpvilgheavgvvesigagvtcvkpgdkviplfvpqcgscrackssnsnfcekndmgakt  120
DSSP  lleelllleeeeeeeellllllllllleeeelllllllllhhhhllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct glmadmtsrftcrgkpiynlmgtstfteytvvadiavakidpkaplescligcgfatgyg  180
DSSP  llllllllleeelleeellllllllllleeeeellleeeelllllhhhhhhhlhhhhhhh


DSSP  -----------LEEEEELllllllllllhhhleelleEHHHHHHHHHL---LLEEEEELl
Query -----------XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS---PFQTVFVCr   46
ident               ||                                         |  
Sbjct aavntakvtpgSTCAVFG-----------------lgGVGFSAIVGCKaagASRIIGVG-  222
DSSP  hhhllllllllLEEEEEL-----------------llHHHHHHHHHHHhllLLEEEEEL-


DSSP  lhhHHHHHHLLLL----LLEELL-LLLLllhhHHHHHHHHHH-LLEE-EEELLlllllhh
Query dekQAEKLSSRYE----AEFIWD-LHKGvgsiAGIHAALRHF-GSCV-VAAIDxpfvkpe   99
ident                   |                        |                
Sbjct ---THKDKFPKAIelgaTECLNPkDYDK----PIYEVICEKTnGGVDyAVECA-------  268
DSSP  ---LLHHHHHHHHhhllLEEELHhHLLL----LHHHHHHHHLlLLLLeEEELL-------


DSSP  hhhhhhhhhhhhllleeeeelllllLLEE-eELHH--hhhhhhhhhhlllLLLHHHHhlL
Query vlehlykegekagcdalipkhdypePLLA-yYAES--aadelerailqgiRKILVPLerL  156
ident                                                         |  |
Sbjct -------------------grietmMNALqsTYCGsgvtvvlglaspnerLPLDPLL--L  307
DSSP  -------------------llhhhhHHHHhlLLLLlleeeelllllllllEEELLHH--H


DSSP  LEEeeehhhhlllllllhHHLLLllhhhhhhhhhHHHHL---------------------
Query NVVyypveklrkfdkeliSFFNIntpddlkraeeICSKX---------------------  195
ident                                                             
Sbjct LTG------------rslKGSVF---------ggFKGEEvsrlvddymkkkinvnflvst  346
DSSP  HLL------------leeEELLH---------hhLLHHHhhhhhhhhhlllllhhhheee


DSSP  --------------------------
Query --------------------------  195
ident                           
Sbjct kltldqinkafellssgqgvrsimiy  372
DSSP  eelhhhhhhhhhhhhllllleeeeel


No 165: Query=mol1A Sbjct=2ielA Z-score=2.9

back to top
DSSP  LEEEEELLllllllllLHHHLeelleEHHHHHHHHHL----LLEEEEELLL---------
Query XKVAVLVGgvgrrigxEKTEVxlcgkKLIEWVLEKYS----PFQTVFVCRD---------   47
ident     |                           |            |              
Sbjct ARYLVVAH--------RTAKS-----PELAAKLKELLaqdpEARFVLLVPAvpppgwvyn   47
DSSP  LEEEEELL--------LLLLL-----HHHHHHHHHHHhhllLLEEEEEEEEellllllll


DSSP  ------HHHHHHHHLLLL------LLEELLlllLLLHHHHHHHHH-HHHLLE-EEEELLl
Query ------EKQAEKLSSRYE------AEFIWDlhkGVGSIAGIHAAL-RHFGSC-VVAAIDx   93
ident       |  |       |       |              |   |  | |          
Sbjct evrrraEEEAAAAKRALEaqgipvEEAKAG---DISPLLAIEEELlAHPGAYqGIVLST-  103
DSSP  hhhhhhHHHHHHHHHHHHllllllLEEEEE---ELLHHHHHHHHHhHLLLLLlEEEEEE-


DSSP  llllhhhhhhhhhhhhhhllleeeeelllLLLL--EEEElhhhhhhhhhhhhllllllhh
Query pfvkpevlehlykegekagcdalipkhdyPEPL--LAYYaesaadelerailqgirkilv  151
ident                                                             
Sbjct ---------------lppglsrwlrldvhTQAErfGLPV---------------------  127
DSSP  ---------------llllllhhhhllhhHHHHhhLLLE---------------------


DSSP  hhhllleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query plerlnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                             
Sbjct ---------------------------------------ihvia  132
DSSP  ---------------------------------------eeeel


No 166: Query=mol1A Sbjct=3do8A Z-score=2.9

back to top
DSSP  lEEEEELLllllllllLHHHleelleEHHHHHHHHHLLL---EEEEELLL----------
Query xKVAVLVGgvgrrigxEKTEvxlcgkKLIEWVLEKYSPF---QTVFVCRD----------   47
ident  |||            |                                           
Sbjct mKVALGGT-------fEPLH------EGHKKLIDVAIKLggrDITIGVTSdrmararirs   47
DSSP  lLEEEEEL-------lLLLL------HHHHHHHHHHHHHhllLEEEEEELhhhhhhhlll


DSSP  ----HHHHHHHHLLL------LLLEELLlllLLLHhHHHHhhhhhHLLEEEEElllllll
Query ----EKQAEKLSSRY------EAEFIWDlhkGVGSiAGIHaalrhFGSCVVAAidxpfvk   97
ident        ||            | |                                    
Sbjct vlpfAIRAENVKRYVmrkygfEPEIVKI---TNPY-GKTL----dVDFEYLVV-------   92
DSSP  lllhHHHHHHHHHHHhhhhllLLEEEEE---LLLL-LLLL----lLLLLEEEE-------


DSSP  hhhhhhhhhhhhhhllleeeeellllLLLEeeelhhhhhhhhhhhhlllllLHHHHHLLl
Query pevlehlykegekagcdalipkhdypEPLLayyaesaadelerailqgirkILVPLERLn  157
ident                           |  |                          |   
Sbjct ---------------------spetyEMAL-------------------kiNQKREELG-  111
DSSP  ---------------------llllhHHHH-------------------hhHHHHHHHL-


DSSP  eeeeehhhhlllllllhhhlllllhhhhhhhHHHH----hhl
Query vvyypveklrkfdkelisffnintpddlkraEEIC----skx  195
ident                                           
Sbjct ------------------krkitivkvdwmmSSTRikrgeid  135
DSSP  ------------------lllleeeeeelllLLLLlllllll


No 167: Query=mol1A Sbjct=3khdB Z-score=2.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aagasmqsaanitlrqilepnvnlrskkthivctlgpacksvetlvklidagmdicrfnf   60
DSSP  lllllhhhhhlllhhhhhlllllhhhllleeeeellhhhllhhhhhhhhhhleeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct shgshedhkemfnnvlkaqelrpncllgmlldtkgpeirtgflknkevhlkegsklklvt  120
DSSP  llllhhhhhhhhhhhhhhhhhlllllleeeeelllllllllllllleeeelllleeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct dyeflgdetciacsykklpqsvkpgniiliadgsvsckvlethedhvitevlnsaviger  180
DSSP  llllllllleeelllllhhhhllllleeeelllleeeeeeeellleeeeeellleeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct knmnlpnvkvdlpiisekdkndilnfaipmgcnfiaasfiqsaddvrlirnllgprgrhi  240
DSSP  lleellllllllllllhhhhhhhhhlhhhhllleeeelllllhhhhhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct kiipkieniegiihfdkilaesdgimiargdlgmeispekvflaqklmiskcnlqgkpii  300
DSSP  eeeellllhhhhhlhhhhhhhllleeelhhhhlllllhhhhhhhhhhhhhhhhhhlllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct tatqmlesmtknprptraevtdvanavldgtdcvmlsgetaggkfpveavtimskiclea  360
DSSP  elllllhhhhllllllhhhhhhhhhhhhhllleeeelhhhhllllhhhhhhhhhhhhhhh


DSSP  ---------------------------------------LEEEEELllllllllllhhhl
Query ---------------------------------------XKVAVLVggvgrrigxektev   21
ident                                             |               
Sbjct eacidykllyqslvnaitpisvqeavarsavetaesiqaSLIIALT--------------  406
DSSP  hllllhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhllLEEEEEL--------------


DSSP  eelleehHHHHHHHHLL----LEEEEELllhhHHHHHHLLLL----LLEELlllLLLLHH
Query xlcgkklIEWVLEKYSP----FQTVFVCrdekQAEKLSSRYE----AEFIWdlhKGVGSI   73
ident                                                  |       |  
Sbjct ------eTGYTARLIAKykpsCTILALS----ASDSTVKCLNvhrgVTCIK-vgSFQGTD  455
DSSP  ------lLLHHHHHHHHllllLEEEEEE----LLHHHHHHHHhlllEEEEE-llLLLLHH


DSSP  HHHHHHHHHH---------lLEEEEELLLLLllhhhhhhhhhhhhhhllleeeeelllll
Query AGIHAALRHF---------gSCVVAAIDXPFvkpevlehlykegekagcdalipkhdype  124
ident   |  |              |                                       
Sbjct IVIRNAIEIAkqrnmakvgdSVIAIHGIKEE------------------------vsggt  491
DSSP  HHHHHHHHHHhhllllllllEEEEEEELLLL------------------------lllll


DSSP  lLEEEELHHhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhh
Query pLLAYYAESaadelerailqgirkilvplerlnvvyypveklrkfdkelisffnintpdd  184
ident  |                                                          
Sbjct nLMKVVQIE---------------------------------------------------  500
DSSP  eEEEEEELL---------------------------------------------------


DSSP  hhhhhhhhhhl
Query lkraeeicskx  195
ident            
Sbjct -----------  500
DSSP  -----------


No 168: Query=mol1A Sbjct=3a1cB Z-score=2.9

back to top
DSSP  -------------------LEEEEELL---LLLLLL------------------------
Query -------------------XKVAVLVG---GVGRRI------------------------   14
ident                      |          |                           
Sbjct aelgiliknadalevaekvTAVIFDKTgtlTKGKPEvtdlvplngderellrlaaiaerr   60
DSSP  lllleeellllhhhhhhhlLEEEEEHHhhlLLLLLEeeeeeellllhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   14
ident                                                             
Sbjct sehpiaeaivkkalehgielgepekveviagegvvadgilvgnkrlmedfgvavsnevel  120
DSSP  lllhhhhhhhhhhhhllllllllllleeellleeeelleeeelhhhhhhllllllhhhhh


DSSP  ---------------------------lLLHHhleelleEHHHHHHHHHL--LLEEEEEL
Query ---------------------------gXEKTevxlcgkKLIEWVLEKYS--PFQTVFVC   45
ident                                                             
Sbjct aleklereaktavivarngrvegiiavsDTLK-------ESAKPAVQELKrmGIKVGMIT  173
DSSP  hhhhhhlllleeeeeeelleeeeeeeeeLLLL-------LLHHHHHHHHHhlLLEEEEEL


DSSP  LL-HHHHHHHHLLLLL-LEELLLLLLllhhhhhHHHHHHHL---LEEEEElllllllhhh
Query RD-EKQAEKLSSRYEA-EFIWDLHKGvgsiagiHAALRHFG---SCVVAAidxpfvkpev  100
ident  |    ||  |        |                                        
Sbjct GDnWRSAEAISRELNLdLVIAEVLPH-----qkSEEVKKLQakeVVAFVG------dgin  222
DSSP  LLlHHHHHHHHHHHLLlEEELLLLLL-----lhHHHHHHHLlllLEEEEE------llll


DSSP  hhhhhhhhhhhllleeeeeLLLLLLleeeelhhhhhhhhhhhhllllllhhhhhllleee
Query lehlykegekagcdalipkHDYPEPllayyaesaadelerailqgirkilvplerlnvvy  160
ident                                                             
Sbjct dapalaqadlgiavgsgsdVAVESG-----------------------------------  247
DSSP  lhhhhhhlleeeeelllllLLLLLL-----------------------------------


DSSP  eehhhhlllllllhHHLLL---llhhhhhhhhhhhhhl
Query ypveklrkfdkeliSFFNI---ntpddlkraeeicskx  195
ident                                       
Sbjct ------------diVLIRDdlrdvvaaiqlsrktmski  273
DSSP  ------------leEELLLllhhhhhhhhhhhhhhlll


No 169: Query=mol1A Sbjct=2v5hB Z-score=2.8

back to top
DSSP  ----------------------LEEEEELLLlllllllLHHHLEelleEHHHHHHHHHLL
Query ----------------------XKVAVLVGGvgrrigxEKTEVXlcgkKLIEWVLEKYSP   38
ident                         | |  ||                  | | |      
Sbjct agaadrvrilsealpylqqfagRTVVVKYGG-------AAMKQE----ELKEAVMRDIVF   49
DSSP  lllllhhhhhhhlhhhhhhlllLEEEEEELL-------HHHHLH----HHHHHHHHHHHH


DSSP  L-----EEEEELL-------------------------------------lhHHHHHHHL
Query F-----QTVFVCR-------------------------------------deKQAEKLSS   56
ident         | |                                                |
Sbjct LacvgmRPVVVHGggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgRVNKDIVS  109
DSSP  HhhlllEEEEEELlhhhhhhhhhhlllllleelleelllhhhhhhhhhhhhhLHHHHHHH


DSSP  LLL-------------------------------------------------lLEELLLL
Query RYE-------------------------------------------------aEFIWDLH   67
ident |                                                      |    
Sbjct RINttggravgfcgtdgrlvlarphdqegigfvgevnsvnseviepllergyiPVISSVA  169
DSSP  HHHhhllleeeeellhhhleeeeellllllllleeeeeelhhhlhhhhhllleEEEELEE


DSSP  --------lLLLHHHHHHHHHHhHLLEEEEELLlllllhhhhhhhhhhhhhhllleeEEE
Query --------kGVGSIAGIHAALRhFGSCVVAAIDxpfvkpevlehlykegekagcdalIPK  119
ident                    |                                        
Sbjct adengqsfnINADTVAGEIAAA-LNAEKLILLT-------dtrgiledpkrpeslipRLN  221
DSSP  ellllleeeLLHHHHHHHHHHH-LLLLEEEEEE-------lllllllllllllllllEEE


DSSP  LLLLllleeeelhhhhhhhhhhhhllllLLHH----------hhhllleeeeehhhhlll
Query HDYPepllayyaesaadelerailqgirKILV----------plerlnvvyypveklrkf  169
ident                                                             
Sbjct IPQS----------reliaqgivgggmiPKVDccirslaqgvraahiidgriphalllei  271
DSSP  HHHH----------hhhhhlllllllhhHHHHhhhhhhhlllleeeeeelllllhhhhhh


DSSP  llLLHHHlllllhhhhhhhhhhhhhl
Query dkELISFfnintpddlkraeeicskx  195
ident                           
Sbjct ftDAGIG--------tmivgsgyhea  289
DSSP  hlLLLLE--------eeeelllllll


No 170: Query=mol1A Sbjct=2rd5B Z-score=2.8

back to top
DSSP  ---------------------LEEEEELLLLlllllllHHHLeelleEHHHHHHHHHL--
Query ---------------------XKVAVLVGGVgrrigxeKTEVxlcgkKLIEWVLEKYS--   37
ident                          |  ||                       |      
Sbjct spdyrveilseslpfiqkfrgKTIVVKYGGA-------AMTS-pelkSSVVSDLVLLAcv   52
DSSP  lhhhhhhhhhllhhhhhhlllLEEEEEELHH-------HLLL-hhhhHHHHHHHHHHHhl


DSSP  LLEEEEELL-------------------------------------lhHHHHHHHLLLL-
Query PFQTVFVCR-------------------------------------deKQAEKLSSRYE-   59
ident       |                                         |    | |    
Sbjct GLRPILVHGggpdinrylkqlnipaefrdglrvtdattmeivsmvlvgKVNKNLVSLINa  112
DSSP  LLEEEEEELlhhhhhhhhhhhllllleelleelllhhhhhhhhhhhhhLHHHHHHHHHHl


DSSP  -------------------------------------------------lLEELLLL---
Query -------------------------------------------------aEFIWDLH---   67
ident                                                     |       
Sbjct agatavglsghdgrlltarpvpnsaqlgfvgevarvdpsvlrplvdygyiPVIASVAadd  172
DSSP  lllleeeelllhhhleeeeelllhhhhllleeeeeelhhhhhhhhhllleEEELLEEell


DSSP  -----LLLLHHHHHHHHHHhHLLEEEEELL------------------------------
Query -----KGVGSIAGIHAALRhFGSCVVAAID------------------------------   92
ident                 |    |                                      
Sbjct sgqayNINADTVAGELAAA-LGAEKLILLTdvagilenkedpsslikeidikgvkkmied  231
DSSP  llleeELLHHHHHHHHHHH-LLLLEEEEEEllllllllllllllllleeehhhhhhhhhl


DSSP  ----------------------------------LLLLLHHHhhhhhhhhhhhllleeee
Query ----------------------------------XPFVKPEVlehlykegekagcdalip  118
ident                                                             
Sbjct gkvaggmipkvkccirslaqgvktasiidgrrqhSLLHEIMS------------------  273
DSSP  llllllhhhhhhhhhhhhhlllleeeeeelllllHHHHHHLL------------------


DSSP  ellllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllLLHHHLl
Query khdypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkELISFFn  178
ident                                                             
Sbjct -----------------------------------------------------DEGAGT-  279
DSSP  -----------------------------------------------------LLLLEE-


DSSP  lllhhhhhhhhhhhhhl
Query intpddlkraeeicskx  195
ident                  
Sbjct ------------mitgr  284
DSSP  ------------eeell


No 171: Query=mol1A Sbjct=2ap9A Z-score=2.8

back to top
DSSP  -------------------------LEEEEELLLlllllllLHHHLEElleEHHHHHHHH
Query -------------------------XKVAVLVGGvgrrigxEKTEVXLcgkKLIEWVLEK   35
ident                            | |  ||                          
Sbjct iealpthikaqvlaealpwlkqlhgKVVVVKYGG-------NAXTDDT-lrRAFAADXAF   52
DSSP  lllllhhhhhhhhhhhhhhhhhhllLEEEEEELL-------HHHHLHH-hhHHHHHHHHH


DSSP  HLL--LEEEEELL-------------------------------------lhHHHHHHHL
Query YSP--FQTVFVCR-------------------------------------deKQAEKLSS   56
ident         | |                                              |  
Sbjct LRNcgIHPVVVHGggpqitaxlrrlgiegdfkggfrvttpevldvarxvlfgQVGRELVN  112
DSSP  HHLllLEEEEEELllhhhhhhhhhhllllllllllllllhhhhhhhhhhhhhLHHHHHHH


DSSP  LLL-------------------------------------------------------lL
Query RYE-------------------------------------------------------aE   61
ident                                                             
Sbjct LINahgpyavgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaaxldlvaagriP  172
DSSP  HHLllllleeeeellhhhleeeeelllllllllllllleeeeeeelhhhhhhhhhllleE


DSSP  EELLLL--------LLLLHHHHHHHHHHhHLLEEEEELL---------------------
Query FIWDLH--------KGVGSIAGIHAALRhFGSCVVAAID---------------------   92
ident     |               |    |    |                             
Sbjct VVSTLApdadgvvhNINADTAAAAVAEA-LGAEKLLXLTdidglytrwpdrdslvseidt  231
DSSP  EEELEEellllleeEELHHHHHHHHHHH-LLLLEEEEEElllleelllllllleeleeeh


DSSP  -----------------------------------------LLLLLHHHhhhhhhhhhhh
Query -----------------------------------------XPFVKPEVlehlykegeka  111
ident                                             |               
Sbjct gtlaqllptlelgxvpkveaclraviggvpsahiidgrvthCVLVELFT---------da  282
DSSP  hhhhhhhhhlllllhhhhhhhhhhhhhllleeeeeelllllHHHHHHHL---------ll


DSSP  llleEEEELLllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllll
Query gcdaLIPKHDypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdk  171
ident                                                             
Sbjct gtgtKVVRGE--------------------------------------------------  292
DSSP  llleEEELLL--------------------------------------------------


DSSP  llhhhlllllhhhhhhhhhhhhhl
Query elisffnintpddlkraeeicskx  195
ident                         
Sbjct -----------------ghhhhhh  299
DSSP  -----------------lhhhhhl


No 172: Query=mol1A Sbjct=3hbjA Z-score=2.8

back to top
DSSP  ----LEEEEELLLLLlllllLHHHleelleEHHHHHHHHH---lLLEEEEELlLHHHHHH
Query ----XKVAVLVGGVGrrigxEKTEvxlcgkKLIEWVLEKY---sPFQTVFVCrDEKQAEK   53
ident       ||||    |                |   |             | |        
Sbjct gnnlLHVAVLAFPFG-----THAA------PLLSLVKKIAteapKVTFSFFC-TTTTNDT   48
DSSP  llllLEEEEELLLLL-----LLHH------HHHHHHHHHHhhllLLEEEEEE-EHHHHHH


DSSP  HHLL-----llLLEELLL-------------------llllLHHHHHHHHHHHH-----L
Query LSSR-----yeAEFIWDL-------------------hkgvGSIAGIHAALRHF-----G   84
ident | ||                                           |            
Sbjct LFSRsneflpnIKYYNVHdglpkgyvssgnprepiflfikaMQENFKHVIDEAVaetgkN  108
DSSP  HLLLlllllllEEEEEELllllllllllllllhhhhhhhhhHHHHHHHHHHHHHhhhllL


DSSP  LEEEEELLLllllhhhhhhhhhhhhhhllleeeeellllLLLE--EEELhhhhhhhhhhh
Query SCVVAAIDXpfvkpevlehlykegekagcdalipkhdypEPLL--AYYAesaadelerai  142
ident                                              |              
Sbjct ITCLVTDAF-----------------------------fWFGAdlAEEM-----------  128
DSSP  LLEEEEELL-----------------------------lLLHHhhHHHH-----------


DSSP  hllllllhhhhhllleeeeehhhhlllllllhhhlLLLLHHHHH----------------
Query lqgirkilvplerlnvvyypveklrkfdkelisffNINTPDDLK----------------  186
ident                                        |  |                 
Sbjct ----------------------------hakwvplWTAGPHSLLthvytdlirektgske  160
DSSP  ----------------------------lleeeeeELLLHHHHHhhhlhhhhhhlllhhh


DSSP  ---------------------------------------------------hHHHH----
Query ---------------------------------------------------rAEEI----  191
ident                                                             
Sbjct vhdvksidvlpgfpelkasdlpegvikdidvpfatmlhkmglelpranavaiNSFAtihp  220
DSSP  hllllllllllllllllllllllllllllllhhhhhhhhhhhhhhhllleeeLLLLlllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  191
ident                                                             
Sbjct lienelnskfklllnvgpfnlttpqrkvsdehgclewldqhenssvvyisfgsvvtppph  280
DSSP  hhhhhhhhhllleeelllhhhhlllllllllllhhhhhhlllllleeeeellllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  191
ident                                                             
Sbjct eltalaesleecgfpfiwsfrgdpkeklpkgflertktkgkivawapqveilkhssvgvf  340
DSSP  hhhhhhhhhlllllleeeellllllllllhhhhhhlllleeeellllhhhhhhllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  191
ident                                                             
Sbjct lthsgwnsvlecivggvpmisrpffgdqglntiltesvleigvgvdngvltkesikkale  400
DSSP  eelllhhhhhhhhhhllleeellllllhhhhhhhhhhlllleeelhhhlllhhhhhhhhh


DSSP  -----------------------------------------hhhl
Query -----------------------------------------cskx  195
ident                                              
Sbjct ltmssekggimrqkivklkesafkaveqngtsamdfttliqivts  445
DSSP  hhllllhhhhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhll


No 173: Query=mol1A Sbjct=3g1uC Z-score=2.8

back to top
DSSP  ------------------------------------------LEEEEELLlllllllllh
Query ------------------------------------------XKVAVLVGgvgrrigxek   18
ident                                            | |              
Sbjct dykvkdislaewgrkaielaenempglmelrreygpsqplkgAKIAGCLH----------   50
DSSP  llllllhhhhhhhhhhhhhhhhllhhhhhhhhhhllllllllLEEEEELL----------


DSSP  hhleelleEHHHHHHHHHL--LLEEEEEL-llhhhhHHHHLLL--LLLEEL-----llLL
Query tevxlcgkKLIEWVLEKYS--PFQTVFVC-rdekqaEKLSSRY--EAEFIW-----dlHK   68
ident                |                                            
Sbjct ------mtVQTAVLIETLKalGAELRWSScnifstqDNAAAAIakTGVPVFawkgetdEE  104
DSSP  ------llHHHHHHHHHHHhlLLEEEEELlllllllHHHHHHHhlLLLLEEllllllhHH


DSSP  LLlhhHHHHhHHHHH----LLEEEEEL---------------------------------
Query GVgsiAGIHaALRHF----GSCVVAAI---------------------------------   91
ident               |                                             
Sbjct YE--wCIAQ-TVKGFsgdgLPNMILDDggdltnlvidrypelvpkifgiseetttgvknl  161
DSSP  HH--hHHHH-LLLLLllllLLLEEEELllhhhhhhhhhllllhhhllleeellhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   91
ident                                                             
Sbjct ykrlskgnlpisainvndkskfdnlygcreslvdgikratdvmiagktccvcgygdvgkg  221
DSSP  hhhhhllllllleeelllllllhhhhhhhhhhhhhhhhhhllllllleeeeelllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   91
ident                                                             
Sbjct caaalrafgarvvvtevdpinalqasmegyqvalvedvmadahifvtttgnddiitsdhf  281
DSSP  hhhhhhhllleeeeelllhhhhhhhhhllleellhhhhllllleeeellllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   91
ident                                                             
Sbjct phmrddaivcnighfdteiqvgwleanakehveikpqvdrytmengrhiillakgrlvnl  341
DSSP  hhlllleeeeellllhhhllhhhhhhhlleeeeeelleeeeellllleeeeehhhllhhh


DSSP  ------------lLLLLLHHHHHHHHHHhHHHLlleeeeellllllleeeelhhhhhhhh
Query ------------dXPFVKPEVLEHLYKEgEKAGcdalipkhdypepllayyaesaadele  139
ident                         |       |                           
Sbjct gcasghpsfvmsnSFTNQVLAQIELWSN-RDNG---------------------------  373
DSSP  hhlllllhhhhhhHHHHHHHHHHHHHHL-LLLL---------------------------


DSSP  hhhhllllllhhhhhlLLEEEEEHhhHLLLLLLLHhhlllllhhhhhhhhhHHHHL----
Query railqgirkilvplerLNVVYYPVekLRKFDKELIsffnintpddlkraeeICSKX----  195
ident                           | |   |                           
Sbjct ------------kyprGDKAGVFF--LPKALDEKV--------------aaLHLAHvgak  405
DSSP  ------------llllLLLLLEEL--LLLLHHHHH--------------hhHLLLLllll


DSSP  -------------------
Query -------------------  195
ident                    
Sbjct ltkltpkqaeyincpvpfk  424
DSSP  lllllhhhhhhhlllllll


No 174: Query=mol1A Sbjct=2qf7B Z-score=2.8

back to top
DSSP  ---LEEEEELllllllllllhhhleelleEHHHHHHHHHL--LLEEEEELlLHHHhHHHH
Query ---XKVAVLVggvgrrigxektevxlcgkKLIEWVLEKYS--PFQTVFVCrDEKQaEKLS   55
ident     |  |                          |          ||     |       
Sbjct gpiSKILVAN-----------------rsEIAIRVFRAANelGIKTVAIW-AEED-KLAL   41
DSSP  lllLEEEELL-----------------lhHHHHHHHHHHHhlLLEEEEEE-LHHH-LLLH


DSSP  llLLLL-EELL-----------llllLLHHHHHHHHHHHHllEEEEELLlllllhhhhhh
Query srYEAE-FIWD-----------lhkgVGSIAGIHAALRHFgsCVVAAIDxpfvkpevleh  103
ident     |                           |  |                        
Sbjct hrFKADeSYQVgrgphlrdlgpiesyLSIDEVIRVAKLSG-aDAIHPGY-------glls   93
DSSP  hhHHLLeEEELllllllllllllhhhLLHHHHHHHHHHHL-lLEEELLL-------llll


DSSP  hhhhhhhhlLLEE-----eEELLLL---------------llleeeelhhhhhhhhhhhh
Query lykegekagCDAL-----iPKHDYP---------------epllayyaesaadelerail  143
ident            |                                                
Sbjct espefvdacNKAGiifigpKADTMRqlgnkvaarnlaisvgvpvvpateplppvmlkasr  153
DSSP  llhhhhhhhHHHLleelllLHHHHHhhhlllhhhhhhhhlllllllllllllleeeelll


DSSP  llllllhhhhhllleeeeehhhHLLL----------------------------------
Query qgirkilvplerlnvvyypvekLRKF----------------------------------  169
ident                                                             
Sbjct virvyleklverarhvesqilgDTHGnvvhlferdcsvqrrnqkvverapapylseaqrq  213
DSSP  eelleeeelllleeeeeeeeeeLLLLleeeeeeeeeeeeelleeeeeeellllllhhhhh


DSSP  ------------lllLHHH--------------------lLLLLhhhhhhHHHHHHHL--
Query ------------dkeLISF--------------------fNINTpddlkrAEEICSKX--  195
ident                                                             
Sbjct elaayslkiagatnyIGAGtveylmdadtgkfyfievnprIQVE------HTVTEVVTgi  267
DSSP  hhhhhhhhhhhhlllLEEEeeeeeeellllleeeeeeellLLLL------HHHHHHHHll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct divkaqihildgaaigtpqsgvpnqedirlnghalqcrvttedpehnfipdygritayrs  327
DSSP  lhhhhhhhhhlllllllhhhllllhhhllllleeeeeeeeleehhhlleelleelleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct asgfgirldggtsysgaiitryydpllvkvtawapnpleaisrmdralrefrirgvatnl  387
DSSP  llllleeeelllllllleelllllleeeeeeeeellhhhhhhhhhhhhhhleeelllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct tfleaiighpkfrdnsyttrfidttpelfqqvrqdratklltyladvtvnghpeakdrpk  447
DSSP  hhhhhhhllhhhhllllllllllllhhhlllllllhhhhhhhhhhhhhhhllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct pleaarpvvpygngvkdgtkqlldtlgpkkfgewmrnekrvlltdttmrdghqsllatrm  507
DSSP  llllllllllllllllllhhhhhhhhlhhhhhhhhhhlllleeeellllhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct rtydiariagtyshalpnllslecwggatfdvsmrfltedpwerlaliregapnlllqml  567
DSSP  lhhhhhllhhhhhhhllllleeeeeellhhhhhhhhhlllhhhhhhhhhhhlllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct lrgangvgytnypdnvvkyfvrqaakggidlfrvfdclnwvenmrvsmdaiaeenklcea  627
DSSP  eelllllllllllhhhhhhhhhhhhhlllleeeeelllllhhhhhhhhhhhhhllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct aicytgdilnsarpkydlkyytnlavelekagahiiavxdmagllkpaaakvlfkalrea  687
DSSP  eeellllllllllhhhlhhhhhhhhhhhhhlllleeeeeellllllhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct tglpihfhthdtsgiaaatvlaaveagvdavdaamdalsgntsqpclgsivealsgserd  747
DSSP  lllleeeeellllllhhhhhhhhhhlllleeeellhhhllllllllhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct pgldpawirrisfyweavrnqyaafesdlkgpasevylhempggqftnlkeqarslglet  807
DSSP  llllhhhhhhhhhhhhhhhhllhhhllllllllllhhhhlllhhhhhhhhhhhhhlllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct rwhqvaqayadanqmfgdivkvtpsskvvgdmalmmvsqdltvadvvspdrevsfpesvv  867
DSSP  hhhhhhhhhhhhhhhlllllllllhhhhhhhhhhhhhhhlllhhhhhlllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct smlkgdlgqppsgwpealqkkalkgekpytvrpgsllkeadldaerkviekklerevsdf  927
DSSP  hhhhlllllllllllhhhhhhhhlllllllllhhhhlllllhhhhhhhhhhhllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  195
ident                                                             
Sbjct efasylmypkvftdfalasdtygpvsvlptpayfygladgeelfadiekgktlvivnqav  987
DSSP  hhhhhhhlhhhhhhhhhhhhhhllhhhllhhhhhhlllllleeeeellllleeeeeeeee


DSSP  -----------------------------
Query -----------------------------  195
ident                              
Sbjct satdsqgmvtvffelngqprrikvpdrah 1016
DSSP  llllllleeeeeeeelleeeeeeeellll


No 175: Query=mol1A Sbjct=1ybdA Z-score=2.8

back to top
DSSP  ----LEEEEELLllllllllLHHHLE---ellEEHHHHHHHHHLL-----LEEEEELL--
Query ----XKVAVLVGgvgrrigxEKTEVX---lcgKKLIEWVLEKYSP-----FQTVFVCR--   46
ident       |             |              |               |   |    
Sbjct qikyKRVLLKLS-------gESLXGSdpfginHDTIVQTVGEIAEvvkxgVQVGIVVGgg   53
DSSP  llllLEEEEEEL-------hHHHHLLllllllHHHHHHHHHHHHHhhhllLEEEEEELlh


DSSP  ---------------------lHHHHHHHHLLLL--------------------------
Query ---------------------dEKQAEKLSSRYE--------------------------   59
ident                                                             
Sbjct nifrgvsaqagsxdratadyxgXXATVXNALALKdafetlgikarvqsalsxqqiaetya  113
DSSP  hhhhhhhhhhllllhhhhhhhhHHHHHHHHHHHHhhhhhlllleeeeelllllllleell


DSSP  ------------lLEEL-LLLL--LLLHHHHHHHHHHhHLLEEEEELL--lllllhhhhh
Query ------------aEFIW-DLHK--GVGSIAGIHAALRhFGSCVVAAID--xpfvkpevle  102
ident                              |            |                 
Sbjct rpkaiqyleegkvVIFAaGTGNpfFTTDTAAALRGAE-XNCDVXLKATnvdgvytadpkk  172
DSSP  hhhhhhhhhllleEEEElLLLLllLLHHHHHHHHHHH-LLLLEEEEELlllllllllhhh


DSSP  hhhhhhhhhllleeeeeLLLLLLleeeelhhhhhhhhhhhhllLLLLH-----hhhhlll
Query hlykegekagcdalipkHDYPEPllayyaesaadelerailqgIRKIL-----vplerln  157
ident                                                             
Sbjct dpsatryetitfdeallKNLKVX-------------------dATAFAlcrerklnivvf  213
DSSP  lllllllleeehhhhhhLLLLLL-------------------lHHHHHhhhhlllleeee


DSSP  eeeeehhhhlllllLLHHHlllllhhhhhhhhhhhhhl
Query vvyypveklrkfdkELISFfnintpddlkraeeicskx  195
ident               |                       
Sbjct giakegslkrvitgEDEGT---------------lvhc  236
DSSP  llllllhhhhhhhlLLLLE---------------eeel


No 176: Query=mol1A Sbjct=2va1B Z-score=2.8

back to top
DSSP  ---------LEEEEELLLlllllllLHHHL---eellEEHHHHHHHHHLL----LEEEEE
Query ---------XKVAVLVGGvgrrigxEKTEV---xlcgKKLIEWVLEKYSP----FQTVFV   44
ident                  |                      |    |             |
Sbjct prgshmmrkQRIVIKISG-------ACLKQndssiidFIKINDLAEQIEKiskkYIVSIV   53
DSSP  lllllllllEEEEEEELH-------HHHLLlllllllHHHHHHHHHHHHHhlllEEEEEE


DSSP  LL-----------------------lHHHHHHHHLLLL----------------------
Query CR-----------------------dEKQAEKLSSRYE----------------------   59
ident                                      |                      
Sbjct LGggniwrgsiakeldmdrnladnmgMMATIINGLALEnalnhlnvntivlsaikcdklv  113
DSSP  ELllllllhhhhhhllllhhhhhhhhHHHHHHHHHHHHhhhhllllleeeeellllllll


DSSP  ----------------LLEEL-LLLL--LLLHHHHHHHHHHhHLLEEEEELL--------
Query ----------------AEFIW-DLHK--GVGSIAGIHAALRhFGSCVVAAID--------   92
ident                                       |     |               
Sbjct hessannikkaiekeqVMIFVaGTGFpyFTTDSCAAIRAAE-TESSIILMGKngvdgvyd  172
DSSP  eellhhhhhhhhhlllEEEEElLLLLllLLHHHHHHHHHHH-LLLLEEEEEEllllllll


DSSP  -----------------------------------------LLLL--lHHHHHHhhhhhh
Query -----------------------------------------XPFV--kPEVLEHlykege  109
ident                                                   |||       
Sbjct pnaqfyehitfnmaltqnlkvmdatalalcqenninllvfnIDKPnaiVDVLEK------  226
DSSP  llllllleeehhhhhhlllllllhhhhhhhhhllleeeeeeLLLLlhhHHHHLL------


DSSP  hhllleEEEEllllllleeeelhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlll
Query kagcdaLIPKhdypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkf  169
ident          |                                                  
Sbjct -knkytIVSK--------------------------------------------------  235
DSSP  -llleeEEEL--------------------------------------------------


DSSP  llllhhhlllllhhhhhhhhhhhhhl
Query dkelisffnintpddlkraeeicskx  195
ident                           
Sbjct --------------------------  235
DSSP  --------------------------


No 177: Query=mol1A Sbjct=2ptgA Z-score=2.8

back to top
DSSP  --------LEEEEELllllllllllHHHLeelleEHHHHHHHHHL--LLEEEEELLLhHH
Query --------XKVAVLVggvgrrigxeKTEVxlcgkKLIEWVLEKYS--PFQTVFVCRDeKQ   50
ident             |                                               
Sbjct plpvdlrgKTAFVAG---------vADSN-----GYGWAICKLLRaaGARVLVGTWP-PV   45
DSSP  llllllllLEEEEEL---------lLLLL-----LHHHHHHHHHHhlLLEEEEEELH-HH


DSSP  HHHHHLlllLLEEL-------------------llLLLLLHHHHHHHHHHHHLLE-EEEE
Query AEKLSSryeAEFIW-------------------dlHKGVGSIAGIHAALRHFGSC-VVAA   90
ident                                      |        |     |       
Sbjct YSIFKK-vfDKIYPldavfdtpqdvppevssnyagVGGFTISEVAEAVRADVGQIdILVH  104
DSSP  HHHHHL-llLEEEElllllllhhhllhhhhlllllLLLLLHHHHHHHHHHHHLLEeEEEE


DSSP  LL----------------------------lllllhhhhhhhHHHH--hhhllleeeeEL
Query ID----------------------------xpfvkpevlehlYKEG--ekagcdalipKH  120
ident                                              |              
Sbjct SLangpevtkpllqtsrkgylaavssssysfvsllqhflplmKEGGsalalsyialesDC  164
DSSP  EEellllllllhhhllhhhhhhhhhhhlhhhhhhhhhhhhheEEEEeeeeeeelllhhHH


DSSP  LLLllleeeelhhhhhhhhhhhhllllllhhhhhllleEEEE------------------
Query DYPepllayyaesaadelerailqgirkilvplerlnvVYYP------------------  162
ident                                                             
Sbjct RTL---------------------------------afEAGRaravrvncisagplkele  191
DSSP  HHH---------------------------------hhHHHHhhlleeeeeeelllllll


DSSP  ------------hhhHLLLLLLLHhhlllllhhhhhhhhhHHHHL----
Query ------------vekLRKFDKELIsffnintpddlkraeeICSKX----  195
ident                 |                                
Sbjct sddvgraalfllsplARAVTGATL----------------YVDNGlham  224
DSSP  hhhhhhhhhhhllhhHLLLLLLEE----------------EELLLllll


No 178: Query=mol1A Sbjct=1vlhB Z-score=2.8

back to top
DSSP  LEEEEELLLlllllllLHHHleelleEHHHHHHHHHLL--LEEEEELL----------LH
Query XKVAVLVGGvgrrigxEKTEvxlcgkKLIEWVLEKYSP--FQTVFVCR----------DE   48
ident  |                                         |               |
Sbjct MKAVYPGSF-------DPIT------LGHVDIIKRALSifDELVVLVTenprkkcmftLE   47
DSSP  LEEEEEELL-------LLLL------HHHHHHHHHHLLllLEEEEEEEllllllllllHH


DSSP  HHHHHHHLLLL----LLEELLLLllllhhhhHHHHHHhHLLEEEEEllLLLLlhhhhhhh
Query KQAEKLSSRYE----AEFIWDLHkgvgsiagIHAALRhFGSCVVAAidXPFVkpevlehl  104
ident                                        |  |                 
Sbjct ERKKLIEEVLSdldgVKVDVHHG------llVDYLKK-HGIKVLVR--GLRA--------   90
DSSP  HHHHHHHHHLLllllEEEEEELL------lhHHHHHH-HLLLEEEE--EELL--------


DSSP  hhhhhhhllleeeeellLLLLleeeelhHHHHhhhhhhhllllllhhhhhllleeeeehh
Query ykegekagcdalipkhdYPEPllayyaeSAADelerailqgirkilvplerlnvvyypve  164
ident                                                             
Sbjct ----------vtdyeyeLQMA---lankKLYS----------------------------  109
DSSP  ----------lllhhhhHHHH---hhhhHHLL----------------------------


DSSP  hhlllllllhhhlllllhhhhhhHHHHH--------------------------------
Query klrkfdkelisffnintpddlkrAEEIC--------------------------------  192
ident                         |                                   
Sbjct --------------dletvfliaSEKFSfissslvkevalyggdvtewvppevaralnek  155
DSSP  --------------lleeeeeelLHHHLlllhhhhhhhhhllllllllllhhhhhhhhhh


DSSP  hhl
Query skx  195
ident    
Sbjct lke  158
DSSP  lll


No 179: Query=mol1A Sbjct=2e9yA Z-score=2.8

back to top
DSSP  -LEEEEELLLL--LLLLLL-lhhhleelleEHHHHHHHHHL-LLEEEEELL---------
Query -XKVAVLVGGV--GRRIGX-ektevxlcgkKLIEWVLEKYS-PFQTVFVCR---------   46
ident         ||                                    |             
Sbjct gRLAVIALGGNaiAGPGMDvsvesqtaavkRASSIIADVLAdGWRSVITHGngpqvgyls   60
DSSP  lLEEEEELLHHhhLLLLLLllhhhhhhhhhHHHHHHHHHHHlLLEEEEELLlhhhhhhhh


DSSP  ----------------------LHHHHHHHHLLLL-------------------------
Query ----------------------DEKQAEKLSSRYE-------------------------   59
ident                              |    |                         
Sbjct eafealpperprqplyiatamtQAWIGLLLKHSLEeelrrrglnvlvpvvisrvlvdvsd  120
DSSP  hhhhllllllllllhhhhhhhhHHHHHHHHHHHHHhhhhhlllllllleelleeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   59
ident                                                             
Sbjct psfnnpskpvgpiygreeaeelsrrygwvfkrdprggfrrvvpsprpvsivdrdliaeas  180
DSSP  hhhlllleeeeeeelhhhhhhhhhhhlleeeellllleeeeelllleeeellhhhhhhhh


DSSP  ----lLEEL--LLLL---------------LLLHHHHHHHHHHhHLLEEEEELL------
Query ----aEFIW--DLHK---------------GVGSIAGIHAALRhFGSCVVAAID------   92
ident                                    |    |                   
Sbjct aespaVVALggGGVPvverpggvlepveavVDKDLASSLLATQ-LNADLLVILTdvpgva  239
DSSP  hhlleEEELhhHLEEeeellllleeellllLLHHHHHHHHHHH-LLLLEEEEEEllllle


DSSP  -------------------------------------------------------LLLL-
Query -------------------------------------------------------XPFV-   96
ident                                                             
Sbjct vnygregerwlrraaaselkkylreghfppgsmgpkveaaisfvertgkpavigsLEEAr  299
DSSP  ellllllleelleeehhhhhhhhhllllllllhhhhhhhhhhhhhhhllleeeeeLLLHh


DSSP  -LHHHhhhhhhhhhhhllleEEEELlllllleeeelhhhhhhhhhhhhllllllhhhhhl
Query -KPEVlehlykegekagcdaLIPKHdypepllayyaesaadelerailqgirkilvpler  155
ident                                                             
Sbjct qVLSL-----------qagtVVMLG-----------------------------------  313
DSSP  hHHLL-----------llleEEELL-----------------------------------


DSSP  lleeeeehhhhlllllllhhhlllllhhhhhhhhhhhhhl
Query lnvvyypveklrkfdkelisffnintpddlkraeeicskx  195
ident                                         
Sbjct ----------------------------------------  313
DSSP  ----------------------------------------


No 180: Query=mol1A Sbjct=3cf4G Z-score=2.8

back to top
DSSP  ---------------------------------LEEEEELLLLllllllLHHHleelleE
Query ---------------------------------XKVAVLVGGVgrrigxEKTEvxlcgkK   27
ident                                        ||                   
Sbjct vdttkntklftsygvntskavspemaakiiskaKRPLLMVGTL------ALDP------E   48
DSSP  lllllllllllllllllleellhhhhhhhhhhlLLEEEEELLL------LLLH------H


DSSP  HHHHHHHHHLLLEEEEELLLhHHHHHHHlLLLLLEELLlllLLLHH---hhhhhhHHHH-
Query LIEWVLEKYSPFQTVFVCRDeKQAEKLSsRYEAEFIWDlhkGVGSI---agihaaLRHF-   83
ident |   |                     |                                 
Sbjct LLDRVVKISKAANIPIAATG-SSLAVLA-DKDVDAKYI--nAHMLGfyltdpkwpGLDGn  104
DSSP  HHHHHHHHHHHHLLLEEELL-LLHHHHL-LLLLLEEEL--lHHHHHhhlllllllLLLLl


DSSP  LLEE-EEELllllllhhhhhhhhhhhhhhllleeeeellllllleeeelhhhhhhhhhhh
Query GSCV-VAAIdxpfvkpevlehlykegekagcdalipkhdypepllayyaesaadelerai  142
ident |       |                                                   
Sbjct GNYDmIITI---------------------------------------------gfkkfy  119
DSSP  LLLLeEEEE---------------------------------------------lllhhh


DSSP  hlllLLLH-HHHHllleeeeehhhhlllllllhhhlLLLL---------HHHHHHH----
Query lqgiRKIL-VPLErlnvvyypveklrkfdkelisffNINT---------PDDLKRA----  188
ident                                                             
Sbjct inqvLSAAkNFSN-----------------lktiaiERGYiqnatmsfgNLSKADHyaal  162
DSSP  hhhhHHHHhHHLL-----------------lleeelLLLLllllleellLLLHHHHhhhh


DSSP  hhhhhhl
Query eeicskx  195
ident        
Sbjct delinal  169
DSSP  hhhhhll


No 181: Query=mol1A Sbjct=3k9wA Z-score=2.8

back to top
DSSP  ---LEEEEELLLLlllllllhhhleelleEHHHHHHHHHLL--LEEEEELLL--------
Query ---XKVAVLVGGVgrrigxektevxlcgkKLIEWVLEKYSP--FQTVFVCRD--------   47
ident                                 |      |      |    |        
Sbjct gsmVVAVYPGTFD-------------pltRGHEDLVRRASSifDTLVVGVADsrakkpff   47
DSSP  lllLEEEEEELLL-------------lllHHHHHHHHHHHHhlLEEEEEEELlhhhllll


DSSP  --hHHHHHHHLLLL----LLEELLLLllllhhHHHHHHHHhHLLEEEEElllLLLLhhhh
Query --eKQAEKLSSRYE----AEFIWDLHkgvgsiAGIHAALRhFGSCVVAAidxPFVKpevl  101
ident                                              |              
Sbjct sleERLKIANEVLGhypnVKVMGFTG------LLKDFVRA-NDARVIVR---GLRA----   93
DSSP  lhhHHHHHHHHHHLllllEEEEEELL------LHHHHHHH-LLLLEEEE---ELLL----


DSSP  hhhhhhhhhhllleeeeellLLLLleeeelhhhhhhhhhhhhllllLLHHHhhllleeee
Query ehlykegekagcdalipkhdYPEPllayyaesaadelerailqgirKILVPlerlnvvyy  161
ident                                                             
Sbjct -------------vsdfeyeFQMA---------------------gMNRYL--------l  111
DSSP  -------------lllhhhhHHHH---------------------hHHHHH--------l


DSSP  ehhhhlllllllhhhllLLLH------------------hhhhhhhhhhhhl
Query pveklrkfdkelisffnINTP------------------ddlkraeeicskx  195
ident                    |                                
Sbjct pdvetmfmtpsdqyqfiSGTIvreiaqlggdvskfvfpsvekwltekvaama  163
DSSP  llleeeeelllhhhlllLHHHhhhhhhllllllllllhhhhhhhhhhhhhhl


No 182: Query=mol1A Sbjct=1lvhA Z-score=2.8

back to top
DSSP  -LEEEEELLL----LLLLLL----------------------------------------
Query -XKVAVLVGG----VGRRIG----------------------------------------   15
ident   |                                                         
Sbjct mFKAVLFXLDgvitDTAEYHfrawkalaeeigingvdrqfneqlkgvsredslqkildla   60
DSSP  lLLEEEELLLllllLLHHHHhhhhhhhhhhllllllllllhhhhllllhhhhhhhhhlll


DSSP  ----------------------llhhhleelleEHHHHHHHHHL-LLEEEEE-LLLHHHH
Query ----------------------xektevxlcgkKLIEWVLEKYS-PFQTVFV-CRDEKQA   51
ident                                    |   |                    
Sbjct dkkvsaeefkelakrkndnyvkmiqdvspadvyPGILQLLKDLRsNKIKIALaSASKNGP  120
DSSP  lllllhhhhhhhhhhhhhhhhhhhhhllhhhllLLHHHHHHHHHhLLLEEEElLLLLLHH


DSSP  HHHHLL--LLLL-eELLLLLL---llhhhHHHHHHHHHLL---EEEEE------------
Query EKLSSR--YEAE-fIWDLHKG---vgsiaGIHAALRHFGS---CVVAA------------   90
ident   |           | |               ||    |                     
Sbjct FLLERMnlTGYFdaIADPAEVaaskpapdIFIAAAHAVGVapsESIGLedsqagiqaikd  180
DSSP  HHHHHLllHHHLleELLHHHLlllllllhHHHHHHHHLLLlhhHEEEEellhhhhhhhhh


DSSP  ---------------------llLLLLLHHHHHHHHHHHhhhllleeeeellllllleee
Query ---------------------idXPFVKPEVLEHLYKEGekagcdalipkhdypepllay  129
ident                              | |                            
Sbjct sgalpigvgrpedlgddivivpdTSHYTLEFLKEVWLQK---------------------  219
DSSP  hlleeeeellhhhhlllleeellHHHLLHHHHHHHHHLL---------------------


DSSP  elhhhhhhhhhhhhllllllhhhhhllleeeeehhhhlllllllhhhlllllhhhhhhhh
Query yaesaadelerailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkrae  189
ident                                                             
Sbjct ------------------------------------------------------------  219
DSSP  ------------------------------------------------------------


DSSP  hhhhhl
Query eicskx  195
ident       
Sbjct ----qk  221
DSSP  ----ll


No 183: Query=mol1A Sbjct=3f3mA Z-score=2.8

back to top
DSSP  ---LEEEEELLLLlllllllhhhleelleEHHHHHHHHHLL--LEEEEELL-----LHHH
Query ---XKVAVLVGGVgrrigxektevxlcgkKLIEWVLEKYSP--FQTVFVCR-----DEKQ   50
ident                                     |                    |  
Sbjct mehTIAVIPGSFD-------------pitYGHLDIIERSTDrfDEIHVCVLkgtfsLEER   47
DSSP  lllLEEEEEELLL-------------lllHHHHHHHHHHHHhlLEEEEEELlllllHHHH


DSSP  HHHHHLLLL----LLEELLLlllllhHHHHHHHHHhHLLEEEEelLLLLllhhhhhhhhh
Query AEKLSSRYE----AEFIWDLhkgvgsIAGIHAALRhFGSCVVAaiDXPFvkpevlehlyk  106
ident                                      |                      
Sbjct MDLIEQSVKhlpnVKVHQFS------GLLVDYCEQ-VGAKTII--RGLR-----------   87
DSSP  HHHHHHHLLllllEEEEELL------LLHHHHHHH-HLLLEEE--EEEL-----------


DSSP  hhhhhllleeeeellLLLLleeeelhhhhhhhhhhhhlllllLHHHHhllleeeeehhhh
Query egekagcdalipkhdYPEPllayyaesaadelerailqgirkILVPLerlnvvyypvekl  166
ident                                                             
Sbjct -------avsdfeyeLRLT--------------------smnKKLNN---------eiet  111
DSSP  -------llllhhhhHHHH--------------------hhhHHHLL---------llee


DSSP  lllllllhhhllLLLH---------------hhhhhhhhhhhhl
Query rkfdkelisffnINTP---------------ddlkraeeicskx  195
ident                                             
Sbjct lymmsstnysfiSSSIvkevaayradisefvppyvekalkkkfk  155
DSSP  eeeellllllllLHHHhhhhhhllllllllllhhhhhhhhhhhl


No 184: Query=mol1A Sbjct=2obnD Z-score=2.8

back to top
DSSP  -----LEEEEELLLllllllLLHHhleelleEHHHHHHHHhLLLEE-EEELLLHhhhHHH
Query -----XKVAVLVGGvgrrigXEKTevxlcgkKLIEWVLEKySPFQT-VFVCRDEkqaEKL   54
ident        || |                    |     |   |         |       |
Sbjct rlplnQRVAILLHE---gttGTIG-------KTGLALLRY-SEAPIvAVIDRNC-agQSL   48
DSSP  lllllLLEEEELLL---lllLLLL-------HHHHHHHHH-LLLLEeEEELLLL-llLLH


DSSP  HL--LLLL-LEELLllllllhhhHHHHHHHhHLLEEEEELLlllllhhhhhhhhhhhhhh
Query SS--RYEA-EFIWDlhkgvgsiaGIHAALRhFGSCVVAAIDxpfvkpevlehlykegeka  111
ident            |              |||      |                        
Sbjct REitGIYRyVPIVK---------SVEAALE-YKPQVLVIGI---apgggipddywielkt   95
DSSP  HHhhLLLLlLLEEL---------LHHHHHH-HLLLEEEELL---lllllllhhhhhhhhh


DSSP  lLLEE---------eEELLLlllleeeelhhhhhhhhhhhhllllllhhhhhllLEEEEe
Query gCDAL---------iPKHDYpepllayyaesaadelerailqgirkilvplerlNVVYYp  162
ident    |                                                        
Sbjct aLQAGxslvnglhtpLANIP------------------------------dlnaLLQPG-  124
DSSP  hHHLLleeeelllllLLLLH------------------------------hhhhHLLLL-


DSSP  hhhhllLLLL--------------------------------------------------
Query veklrkFDKE--------------------------------------------------  172
ident                                                             
Sbjct qliwdvRKEPanldvasgaartlpcrrvltvgtdxaigkxstslelhwaaklrgwrskfl  184
DSSP  lleeelLLLLllllllllhhhhllleeeeeeellllllhhhhhhhhhhhhhhhllleeee


DSSP  --------------------------lhhhlllllhhhhhhhhHHHHH------------
Query --------------------------lisffnintpddlkraeEICSK------------  194
ident