Results

Parseable data
Matches to PDB90
Dali: mol1A,

Query: mol1A

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, to pre-computed structural neighbours in the Dali Database, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2i0z-A 21.0  2.6  209   416   25 PDB  MOLECULE: NAD(FAD)-UTILIZING DEHYDROGENASES;                         


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=mol1A Sbjct=2i0zA Z-score=21.0

back to top
DSSP  leeeeeeeeellllllhhhhhhhhhhlllhhheeeeeeeeeeelllleeeeeeeeeelll
Query xirineiklpldheegalldaitkklgipaekvisfnvfrrgydarihliytldiivegd   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllllleeellllllllllllllllLLLLEEELLLHHHHHHHHHHHHLLLLLE
Query etallakfandphvrqtpdxeykfvakapenlTERPIVIGFGPCGLFAGLVLAQXGFNPI  120
ident                                     |||| || || |    |  | |  
Sbjct -------------------------------mHYDVIVIGGGPSGLMAAIGAAEEGANVL   29
DSSP  -------------------------------lLLLEEEELLLHHHHHHHHHHHHLLLLEE


DSSP  EELLLLLhhhhhhhhhhhhhhllllllllllllLLHHHLLLL---LLLL------LLLL-
Query IVERGKEvrertkdtfgfwrkrtlnpesnvqfgEGGAGTFSD---GKLY------SQVK-  170
ident     |                             |     |                || 
Sbjct LLDKGNK--------------------------LGRKLAISGggrCNVTnrlpldEIVKh   63
DSSP  EELLLLL--------------------------LLHHHHHLHhhlLLLEelllhhHHHHl


DSSP  -----------LLLLHHHHHHHHHHHLLLLhhHHLL--LLLLLlhHHHHHHHHHHHHHHH
Query -----------DPNFYGRKVITEFVEAGAPeeILYV--SKPHIgtFKLVTXIEKXRATII  217
ident               |     || |   |                  |             
Sbjct ipgngrflysaFSIFNNEDIITFFENLGVK--LKEEdhGRMFPvsNKAQSVVDALLTRLK  121
DSSP  llllhhhhhhhHHHLLHHHHHHHHHHLLLL--EEELhhHEEEEllLLHHHHHHHHHHHHH


DSSP  HLLLEEELLLLEEEEEELLLLEEEEEELLLLEEELLLEEELLLLL-------LHHHHHHH
Query ELGGEIRFSTRVDDLHXEDGQITGVTLSNGEEIKSRHVVLAVGHS-------ARDTFEXL  270
ident  ||  ||  | |     | ||   | |  ||     ||| |||           |     
Sbjct DLGVKIRTNTPVETIEYENGQTKAVILQTGEVLETNHVVIAVGGKsvpqtgsTGDGYAWA  181
DSSP  HLLLEEELLLLEEEEEEELLEEEEEEELLLLEEELLLEEELLLLLllhhhllLLHHHHHH


DSSP  HhLLLL-LEELleeeeeeeeeehhhhhhhhllllllllllllllllleeellllleeeee
Query HeRGVY-XEAKpfsvgfriehkqsxidearfgpnaghpilgaadyklvhhckngrtvysf  329
ident                                                             
Sbjct E-KAGHtITEL---------------------------------fptevpilsnepfird  207
DSSP  H-HLLLlEEEE--------------