Query T0535 FGD5, Homo sapiens, 294 residues Match_columns 294 No_of_seqs 122 out of 2258 Neff 9.9 Searched_HMMs 11830 Date Fri May 21 18:07:06 2010 Command /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/hhm/T0535.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/hhm/T0535.hhr No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF00621 RhoGEF: RhoGEF domain 100.0 5.1E-31 4.3E-35 204.4 22.6 172 7-182 1-180 (180) 2 PF00169 PH: PH domain; Inter 97.7 4.8E-05 4.1E-09 45.7 6.7 72 223-294 16-102 (104) 3 PF12210 Hrs_helical: Hepatocy 39.9 6.5 0.00055 14.3 5.1 56 17-72 2-58 (96) 4 PF06971 Put_DNA-bind_N: Putat 10.8 26 0.0022 10.7 2.3 18 138-155 7-24 (50) 5 PF12269 zf-CpG_bind_C: CpG bi 9.9 28 0.0023 10.5 1.7 83 8-92 42-126 (236) 6 PF00540 Gag_p17: gag gene pro 8.9 30 0.0026 10.2 1.0 21 45-65 71-91 (140) 7 PF06983 3-dmu-9_3-mt: 3-demet 7.8 34 0.0029 9.9 3.6 29 265-293 66-94 (116) 8 PF10193 Telomere_reg-2: Telom 7.1 39 0.0033 9.6 3.4 34 146-179 2-35 (114) 9 PF03040 CemA: CemA family; I 7.0 40 0.0034 9.5 1.9 90 147-237 68-163 (230) 10 PF08458 PH_2: Plant pleckstri 6.8 41 0.0035 9.4 4.7 38 256-293 63-101 (110) No 1 >PF00621 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes. Like all members of the Ras superfamily, the Rho proteins cycle between active GTP-bound and inactive GDP-bound conformational states. Activation of Rho proteins through release of bound GDP and subsequent binding of GTP, is catalyzed by guanine nucleotide exchange factors (GEFs) in the Dbl family. The proteins encoded by members of the Dbl family share a common domain, presented in this entry, of about 200 residues (designated the Dbl homology or DH domain) that has been shown to encode a GEF activity specific for a number of Rho family members. In addition, all family members possess a second, shared domain designated the pleckstrin homology (PH) domain (IPR001849 from INTERPRO). Trio and its homolog UNC-73 are unique within the Dbl family insomuch as they encode two distinct DH/PH domain modules. The PH domain is invariably located immediately C-terminal to the DH domain and this invariant topography suggests a functional interdependence between these two structural modules. Biochemical data have established the role of the conserved DH domain in Rho GTPase interaction and activation, and the role of the tandem PH domain in intracellular targeting and/or regulation of DH domain function. The DH domain of Dbl has been shown to mediate oligomerization that is mostly homophilic in nature. In addition to the tandem DH/PH domains Dbl family GEFs contain diverse structural motifs like serine/threonine kinase, RBD, PDZ, RGS, IQ, REM, Cdc25 RasGEF, CH, SH2, SH3, EF, spectrin or Ig. The DH domain is composed of three structurally conserved regions separated by more variable regions. It does not share significant sequence homology with other subtypes of small G-protein GEF motifs such as the Cdc25 domain and the Sec7 domain, which specifically interact with Ras and ARF family small GTPases, respectively, nor with other Rho protein interactive motifs, indicating that the Dbl family proteins are evolutionarily unique. The DH domain is composed of 11 alpha helices that are folded into a flattened, elongated alpha-helix bundle in which two of the three conserved regions, conserved region 1 (CR1) and conserved region 3 (CR3), are exposed near the centre of one surface. CR1 and CR3, together with a part of alpha-6 and the DH/PH junction site, constitute the Rho GTPase interacting pocket.; GO: 0005089 Rho guanyl-nucleotide exchange factor activity, 0035023 regulation of Rho protein signal transduction, 0005622 intracellular; PDB: 1x86_A 1txd_A 1xcg_E 3eo2_A 2z0q_A 1ki1_D 3gf9_A 1by1_A 1xdv_B 1xd4_B .... Probab=100.00 E-value=5.1e-31 Score=204.45 Aligned_cols=172 Identities=28% Similarity=0.471 Sum_probs=156.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHH Q ss_conf 999999999999976899999-9999873102456678988998871288899999899999999886247875018999 Q T0535 7 IAQELLSSEKAYVELQHLNLD-FHGAVRALDDDHEDTLAREELRQGLSELPAIHDLHQGILEELEERLSNWESQQKVADV 85 (294) Q Consensus 7 ii~Eli~tE~~Yv~~l~l~~~-~~~~l~~~~~~~~~~l~~~~~~~lF~ni~~i~~~h~~~l~~L~~~~~~~~~~~~i~~~ 85 (294) ||+||++||++|+++|..+.. |..|+... .+.++.+++..+|+++++|.++|+.|++.|+...+.|.....+|++ T Consensus 1 vi~Eli~tE~~yv~~L~~l~~~y~~~l~~~----~~~l~~~~~~~lF~~i~~l~~~h~~ll~~L~~~~~~~~~~~~i~~~ 76 (180) T PF00621_consen 1 VIEELIETEENYVRDLKILIEVYLKPLKKA----SPLLSPEEIKTLFSNIEELIELHEKLLKELKERLENWSSIQSIGDI 76 (180) T ss_dssp HHHHHHHHHHHHHHHHHHHHHHTHHHHHHC----TTSSTHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHTTCCGGGHHHH T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHC----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH T ss_conf 977899999999999999999999999866----5669878999998669999998999999999999837659999999 Q ss_pred HHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HCCCHHHHHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 999875557-889986007899999999850099999999986------2780256778887644778999998642789 Q T0535 86 FLAREQGFD-HHAHILQFDRYLGLLSENCLHSPRLAAAVREFE------QSTAKHRLLRVVQRLFQYQVLLTDYLNNLCP 158 (294) Q Consensus 86 f~~~~~~~~-y~~y~~~~~~~~~~l~~~~~~~~~f~~~~~~~~------~~~l~~~L~~PiQRl~kY~lLl~~llk~t~~ 158 (294) |....+++. |..||.++..+...+.++.+.++.|..+++.+. +.++.++|+.|+||++||++||++++++||+ T Consensus 77 f~~~~~~~~~Y~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~P~qRl~rY~lll~~l~k~t~~ 156 (180) T PF00621_consen 77 FLKFSPFFKVYITYCSNYPRSLELLNELRKKNSEFQQFLKEIEKQPECKRLSLDSLLIKPIQRLPRYPLLLERLLKNTPP 156 (180) T ss_dssp HHHHTTGGHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHCSHCCTSSTHHHHTTHHHHHHHHHHHHHHHHHHTSTT T ss_pred HHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 99874867899518741146789999987036789999998876503578879999987988899999999999983899 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 883679999999999999999988 Q T0535 159 DSAEYDNTQGALSLISKVTDRAND 182 (294) Q Consensus 159 ~~~d~~~l~~a~~~~~~~~~~in~ 182 (294) +|||+..++.|++.+++++..||+ T Consensus 157 ~~~d~~~l~~a~~~~~~l~~~ine 180 (180) T PF00621_consen 157 DHPDYANLEQAIDKIKELIQYINE 180 (180) T ss_dssp TSTHHHHHHHHHHHHHHHHHHHHH T ss_pred CCCCHHHHHHHHHHHHHHHHHHCC T ss_conf 980299999999999999998386 No 2 >PF00169 PH: PH domain; InterPro: IPR001849 The 'pleckstrin homology' (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signaling or as constituents of the cytoskeleton , , , , , , . The function of this domain is not clear, several putative functions have been suggested: binding to the beta/gamma subunit of heterotrimeric G proteins, binding to lipids, e.g. phosphatidylinositol-4,5-bisphosphate, binding to phosphorylated Ser/Thr residues, attachment to membranes by an unknown mechanism. It is possible that different PH domains have totally different ligand requirements. The 3D structure of several PH domains has been determined . All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families: Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w.; PDB: 2cod_A 2p0h_A 2p0f_A 2p0d_A 1dro_A 1mph_A 1btn_A 1wjm_A 2j59_O 2dhj_A .... Probab=97.67 E-value=4.8e-05 Score=45.66 Aligned_cols=72 Identities=25% Similarity=0.371 Sum_probs=49.7 Q ss_pred CCCC-EEEEEECCEEEEEEEECC-CEEEEEEEEEECC-------CC----CCCCCEEEEEEC--CEEEEEECCHHHHHHH Q ss_conf 5420-025651553799986148-7278755664122-------55----667601788708--3899981898999999 Q T0535 223 KNRR-PRHLFLNDVLLYTYPQKD-GKYRLKNTLAVSR-------PV----EKVPYALKIETS--ESCLLSASSCAERDEW 287 (294) Q Consensus 223 ~~~~-~~~fLf~D~li~~k~~~~-~~~~~~~~i~l~~-------~~----~~~~~~f~i~~~--~~~~l~a~s~~ek~~W 287 (294) ++.+ ++++|+++.|++.+.... ........|+|.+ .. .+.+++|.|... .+++|+|.|.+++..| T Consensus 16 ~~wk~r~~vL~~~~L~~~k~~~~~~~~~~~~~i~L~~~~v~~~~~~~~~~~~~~~~f~i~~~~~~~~~~~~~s~~e~~~W 95 (104) T PF00169_consen 16 KSWKKRYFVLRDSRLLYYKDSSDSSNSKPKGSIPLSGCTVRDVPDSKSSQKKRKHCFEIVTKDGKSYLFQAESEEERQQW 95 (104) T ss_dssp SSEEEEEEEEETTEEEEESSTTHTSCSSESEEEEGTTEEEEEESSSTSSSSSSSSEEEEEETTSEEEEEEESSHHHHHHH T ss_pred CCEEEEEEEEECCEEEEEECCCCCCCCCEEEEEECCCCEEEECCCCCCCCCCCCCEEEEEECCCCEEEEECCCHHHHHHH T ss_conf 98689999997999999957866666653689988853999977653455789879999969997999993999999999 Q ss_pred HHHHHHC Q ss_conf 9999719 Q T0535 288 YGCLSRA 294 (294) Q Consensus 288 ~~~i~~A 294 (294) +.+|+.| T Consensus 96 ~~~i~~~ 102 (104) T PF00169_consen 96 INAIQNA 102 (104) T ss_dssp HHHHHHH T ss_pred HHHHHHH T ss_conf 9999997 No 3 >PF12210 Hrs_helical: Hepatocyte growth factor-regulated tyrosine kinase substrate; PDB: 3f1i_H. Probab=39.85 E-value=6.5 Score=14.32 Aligned_cols=56 Identities=9% Similarity=0.124 Sum_probs=34.8 Q ss_pred HHHHHHH-HHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHH Q ss_conf 9997689-9999999987310245667898899887128889999989999999988 Q T0535 17 AYVELQH-LNLDFHGAVRALDDDHEDTLAREELRQGLSELPAIHDLHQGILEELEER 72 (294) Q Consensus 17 ~Yv~~l~-l~~~~~~~l~~~~~~~~~~l~~~~~~~lF~ni~~i~~~h~~~l~~L~~~ 72 (294) .|++.+. -++.|...+..-.....++.....+.+||.++...+.---.+.+.+++. T Consensus 2 ef~~~lr~~Ve~f~nRm~Sns~RGRsi~~DsaVQsLF~~lt~mH~qll~~~~~~ee~ 58 (96) T PF12210_consen 2 EFCNNLRTQVEIFVNRMQSNSSRGRSISNDSAVQSLFQTLTEMHPQLLSYMNQMEEK 58 (96) T ss_dssp HHHHHHHHHHHHHHHHHHHHHH----GGG-HHHHHHHHHH---HHHHHHHHHHHHHH T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 788999999999999998725058877540889999999998629999999999999 No 4 >PF06971 Put_DNA-bind_N: Putative DNA-binding protein N-terminus; InterPro: IPR009718 This entry represents the C terminus (approximately 30 residues) of a number of Rex proteins. These are redox-sensing repressors that appear to be widespread among Gram-positive bacteria . They modulate transcription in response to changes in cellular NADH/NAD^(+) redox state. Rex is predicted to include a pyridine nucleotide-binding domain (Rossmann fold), and residues that might play key structural and nucleotide binding roles are highly conserved.; GO: 0016564 transcription repressor activity, 0006980 redox signal response, 0016481 negative regulation of transcription, 0005737 cytoplasm; PDB: 1xcb_F 2dt5_A 2vt3_A 2vt2_B. Probab=10.78 E-value=26 Score=10.66 Aligned_cols=18 Identities=22% Similarity=0.322 Sum_probs=12.9 Q ss_pred HHHHHHHHHHHHHHHHHC Q ss_conf 887644778999998642 Q T0535 138 VVQRLFQYQVLLTDYLNN 155 (294) Q Consensus 138 PiQRl~kY~lLl~~llk~ 155 (294) -++|+|.|--.|+.+... T Consensus 7 ti~RLp~Y~r~L~~l~~~ 24 (50) T PF06971_consen 7 TIRRLPLYLRYLKQLQEE 24 (50) T ss_dssp HHHHHHHHHHHHHHHHH- T ss_pred HHHHHHHHHHHHHHHHHC T ss_conf 999999999999999985 No 5 >PF12269 zf-CpG_bind_C: CpG binding protein zinc finger C terminal domain Probab=9.88 E-value=28 Score=10.47 Aligned_cols=83 Identities=16% Similarity=0.203 Sum_probs=36.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC-CCHHHHHHHHCCHHHHHHHH-HHHHHHHHHHHHCCCCCCHHHHH Q ss_conf 99999999999976899999999987310245667-89889988712888999998-99999999886247875018999 Q T0535 8 AQELLSSEKAYVELQHLNLDFHGAVRALDDDHEDT-LAREELRQGLSELPAIHDLH-QGILEELEERLSNWESQQKVADV 85 (294) Q Consensus 8 i~Eli~tE~~Yv~~l~l~~~~~~~l~~~~~~~~~~-l~~~~~~~lF~ni~~i~~~h-~~~l~~L~~~~~~~~~~~~i~~~ 85 (294) =.+|.+=|+..-++..++...-..... ....... -..+.--.+|.-.-.. ++| ..-++.++.+...+++..++|.+ T Consensus 42 r~~L~ELEkr~~eLe~iI~rak~~~~~-~~~~q~~~d~~Dtdl~i~CVtCgh-eI~~r~AikHMEkCf~K~Es~~sfGs~ 119 (236) T PF12269_consen 42 RFRLAELEKRFHELEAIIERAKQQTVD-QQEEQDEGDQEDTDLQIYCVTCGH-EIPPRTAIKHMEKCFNKYESQTSFGSI 119 (236) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCC-CCHHCCCCCCCCHHHEEEEEECCC-CCCHHHHHHHHHHHHHHHHHHCCCCCC T ss_conf 999999999999999999999872202-221005433300101256664488-677889999999999877643123787 Q ss_pred HHHHHHH Q ss_conf 9998755 Q T0535 86 FLAREQG 92 (294) Q Consensus 86 f~~~~~~ 92 (294) +-..... T Consensus 120 ~~t~i~g 126 (236) T PF12269_consen 120 YKTRIEG 126 (236) T ss_pred CCCCCCC T ss_conf 5023577 No 6 >PF00540 Gag_p17: gag gene protein p17 (matrix protein); InterPro: IPR000071 Retroviral matrix proteins (or major core proteins) are components of envelope-associated capsids, which line the inner surface of virus envelopes and are associated with viral membranes . Matrix proteins are produced as part of Gag precursor polyproteins. During viral maturation, the Gag polyprotein is cleaved into major structural proteins by the viral protease, yielding the matrix (MA), capsid (CA), nucleocapsid (NC), and some smaller peptides. Gag-derived proteins govern the entire assembly and release of the virus particles, with matrix proteins playing key roles in Gag stability, capsid assembly, transport and budding. Although matrix proteins from different retroviruses appear to perform similar functions and can have similar structural folds, their primary sequences can be very different. This entry represents matrix proteins from immunodeficiency lentiviruses, such as Human immunodeficiency virus (HIV) and Simian immunodeficiency virus (SIV-cpz) . The structure of the HIV protein consists of 5 alpha helices, a short 3.10 helix and a 3-stranded mixed beta-sheet . ; GO: 0005198 structural molecule activity; PDB: 2nv3_A 2jmg_A 1l6n_A 2h3f_A 1hiw_Q 2h3z_A 2h3v_A 2gol_A 2h3i_A 2hmx_A .... Probab=8.88 E-value=30 Score=10.23 Aligned_cols=21 Identities=29% Similarity=0.404 Sum_probs=14.3 Q ss_pred HHHHHHHHCCHHHHHHHHHHH Q ss_conf 889988712888999998999 Q T0535 45 REELRQGLSELPAIHDLHQGI 65 (294) Q Consensus 45 ~~~~~~lF~ni~~i~~~h~~~ 65 (294) .+++..||+.+-.|+=+|+.+ T Consensus 71 SeeLkSL~NtvavLyCVH~~i 91 (140) T PF00540_consen 71 SEELKSLFNTVAVLYCVHQRI 91 (140) T ss_dssp -HHHHHHHHHHHHHHHHHTT- T ss_pred CHHHHHHHHCHHEEEEEECCC T ss_conf 501455653410146553673 No 7 >PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; InterPro: IPR009725 This entry contains a number of bacterial and archaeal 3-demethylubiquinone-9 3-methyltransferases (2.1.1.64 from EC) which have a conserved region of approximately 100 residues. In some proteins this region occurs more than once.; PDB: 1u69_B 1u7i_B 1tsj_A. Probab=7.84 E-value=34 Score=9.92 Aligned_cols=29 Identities=21% Similarity=0.188 Sum_probs=23.2 Q ss_pred EEEEEECCEEEEEECCHHHHHHHHHHHHH Q ss_conf 17887083899981898999999999971 Q T0535 265 ALKIETSESCLLSASSCAERDEWYGCLSR 293 (294) Q Consensus 265 ~f~i~~~~~~~l~a~s~~ek~~W~~~i~~ 293 (294) .+...+.-++.+.+.|.+|-+.+.++|++ T Consensus 66 ~~~~~~~~sl~v~~~~~eE~~~~f~~Ls~ 94 (116) T PF06983_consen 66 DFPFGNAISLCVECDSEEEIDRLFDKLSE 94 (116) T ss_dssp S----TTEEEEEEESSHHHHHHHHHHHHH T ss_pred CCCCCCCEEEEEECCCHHHHHHHHHHHHH T ss_conf 98888967999992999999999999973 No 8 >PF10193 Telomere_reg-2: Telomere length regulation protein Probab=7.11 E-value=39 Score=9.58 Aligned_cols=34 Identities=29% Similarity=0.438 Sum_probs=0.0 Q ss_pred HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 8999998642789883679999999999999999 Q T0535 146 QVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDR 179 (294) Q Consensus 146 ~lLl~~llk~t~~~~~d~~~l~~a~~~~~~~~~~ 179 (294) |.++++++.....+..|++..+.|+......++. T Consensus 2 PvYi~Dl~~~L~~~~~~~e~~e~aL~~a~~LIr~ 35 (114) T PF10193_consen 2 PVYIRDLLEYLRSDTEDYERFELALKTAPKLIRR 35 (114) T ss_pred CCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH T ss_conf 7519999998736655589999999989999983 No 9 >PF03040 CemA: CemA family; InterPro: IPR004282 Members of this family are probable integral membrane proteins. Their molecular function is unknown. CemA proteins are found in the inner envelope membrane of chloroplasts but not in the thylakoid membrane . A cyanobacterial member of this family has been implicated in CO2 transport, but is probably not a CO2 transporter itself .; GO: 0009507 chloroplast, 0016021 integral to membrane Probab=6.96 E-value=40 Score=9.51 Aligned_cols=90 Identities=11% Similarity=0.083 Sum_probs=0.0 Q ss_pred HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHCCCCCCC------CCCCCCCC Q ss_conf 999998642789883679999999999999999988887667899999986204421000214454------33464312 Q T0535 147 VLLTDYLNNLCPDSAEYDNTQGALSLISKVTDRANDSEQGENLQKLVHIEHSVRGQGDLLQPGREF------LKEGTLKV 220 (294) Q Consensus 147 lLl~~llk~t~~~~~d~~~l~~a~~~~~~~~~~in~~~~~~~~~~~~~~~~~~~~~~~l~~~~r~~------i~~g~~~~ 220 (294) +.++.+++..|+.+++ .-=....++...+.+.-|+.....-..-..++........-+....+.+ +.+-.-+. T Consensus 68 l~fd~lI~~~~~~~~~-~~~~~i~~ka~el~~~~~~~~i~~i~n~~~d~i~~~~~~~~~~~~k~~l~il~s~~~e~~y~L 146 (230) T PF03040_consen 68 LEFDELIGEAPELSLE-ELRIEIHEKAIELAKEYNEESIHAILNLLTDLISFIIFSGLLILGKEQLAILNSFLQEFFYSL 146 (230) T ss_pred HHHHHHHHCCCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCC T ss_conf 9999997036888677-999999999999999999870899999999999999999999957237899999999998477 Q ss_pred CCCCCCEEEEEECCEEE Q ss_conf 34542002565155379 Q T0535 221 TGKNRRPRHLFLNDVLL 237 (294) Q Consensus 221 ~~~~~~~~~fLf~D~li 237 (294) ++-.+--..+||+|+++ T Consensus 147 sDt~KAF~iiL~TD~~v 163 (230) T PF03040_consen 147 SDTAKAFLIILFTDLFV 163 (230) T ss_pred CHHHHHHHHHHHHHHHH T ss_conf 68988999999987873 No 10 >PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function. Probab=6.77 E-value=41 Score=9.41 Aligned_cols=38 Identities=11% Similarity=0.138 Sum_probs=0.0 Q ss_pred CCCCCCCCCEEEEEECC-EEEEEECCHHHHHHHHHHHHH Q ss_conf 22556676017887083-899981898999999999971 Q T0535 256 SRPVEKVPYALKIETSE-SCLLSASSCAERDEWYGCLSR 293 (294) Q Consensus 256 ~~~~~~~~~~f~i~~~~-~~~l~a~s~~ek~~W~~~i~~ 293 (294) .....+....|.+.+.. -+.|-|.|..+++.|.+.|+. T Consensus 63 ~~e~~~~~~yfgLkT~~G~iefec~~~~~~q~W~~gI~~ 101 (110) T PF08458_consen 63 EREGGEERRYFGLKTAQGVIEFECKSQRHYQRWVTGIQH 101 (110) T ss_pred CCCCCCEEEEEEEEECCCEEEEECCCHHHHHHHHHHHHH T ss_conf 004874389999984461699982883788999999999 Done!