Query T0544 SnR168A, , 135 residues Match_columns 135 No_of_seqs 113 out of 289 Neff 4.5 Searched_HMMs 11830 Date Fri May 21 18:06:26 2010 Command /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/hhm/T0544.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/hhm/T0544.hhr No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF00427 PBS_linker_poly: Phyc 100.0 0 0 385.8 14.1 131 5-135 1-131 (131) 2 PF07583 PSCyt2: Protein of un 90.3 0.07 5.9E-06 30.2 2.7 54 73-127 23-76 (208) 3 PF10216 ChpXY: CO2 hydration 79.1 1.1 9E-05 22.8 4.2 89 4-124 10-108 (353) 4 PF07587 PSD1: Protein of unkn 69.8 3.3 0.00028 19.7 4.9 91 14-106 19-124 (266) 5 PF07624 PSD2: Protein of unkn 60.3 4.3 0.00037 19.0 3.9 29 37-65 48-76 (76) 6 PF01450 IlvC: Acetohydroxy ac 43.4 3.5 0.00029 19.6 1.2 63 59-123 5-76 (145) 7 PF05598 DUF772: Transposase d 31.4 15 0.0012 15.7 4.1 26 82-107 38-67 (77) 8 PF09824 ArsR: ArsR transcript 30.5 15 0.0013 15.6 3.2 30 38-67 111-140 (160) 9 PF12408 DUF3666: Ribose-5-pho 29.1 16 0.0013 15.4 3.0 26 52-77 16-41 (48) 10 PF06464 DMAP_binding: DMAP1-b 24.2 16 0.0013 15.5 2.0 25 34-58 10-34 (111) 11 PF05120 GvpG: Gas vesicle pro 23.6 20 0.0017 14.8 3.4 41 15-57 17-57 (80) No 1 >PF00427 PBS_linker_poly: Phycobilisome Linker polypeptide; InterPro: IPR001297 The phycobilisome linker polypeptide determines the state of aggregation and the location of the disc-shaped phycobiliprotein units within the phycobilisome and modulates their spectroscopic properties in order to mediate a directed and optimal energy transfer. The phycobilisome is a hemidiscoidal structure that is composed of two distinct substructures, a core complex (that contains the phycobiliproteins) and a number of rods radiating from the core. The linker polypeptide is also found in the chloroplast of some eukaryotes where it is required for attachment of phycocyanin to allophycocyanin in the core of the phycobilisome.; GO: 0015979 photosynthesis, 0030089 phycobilisome Probab=100.00 E-value=0 Score=385.80 Aligned_cols=131 Identities=56% Similarity=0.913 Sum_probs=130.1 Q ss_pred CCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHCCCCCCCHHHHHHHHHH Q ss_conf 27998988899999999898712554322233035788874689778999999842578887226678706899988877 Q T0544 5 WRAGASSDEINAIIRAVYRQVLGNDYVMSTERLTSAESLLRGGEISVRDFVRAVALSELYREKFFHNNAHNRFIELNFKH 84 (135) Q Consensus 5 l~p~~s~~~~~~vI~AaYrQVf~~~~~~~~er~~~~ES~lr~g~IsVreFVr~la~S~~yr~~f~~~~~~~r~iEl~~kh 84 (135) |+|+.|++++++||+|||||||||+++|+++|++++|||||||+||||||||+||||++||++||++++|||+||++||| T Consensus 1 ~~~~~s~~~~~~vI~AaYrQVfgn~~~~~~eRl~~~ES~Lrng~IsvreFVr~La~S~~yr~~f~~~~~~~R~iEl~~kh 80 (131) T PF00427_consen 1 MRPNASESELEEVIRAAYRQVFGNDHPMESERLTSLESQLRNGDISVREFVRGLAKSDLYRKRFFEPNSNYRAIELAFKH 80 (131) T ss_pred CCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHCCHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHCCCCCHHHHHHHHHH T ss_conf 99999999999999999999965753145430204999988699829999999975699999870266601899999988 Q ss_pred HCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHCCCHHHHHCCCCCCCCCCCC Q ss_conf 507899898899999999870682346675248678885078757888799 Q T0544 85 LLGRAPYDQAEVAAHAATYHSHGYDADINSYIDSAEYTESFGDNVVPYFRG 135 (135) Q Consensus 85 lLGR~p~~~~Ei~~~~~i~a~~G~~a~Id~lidS~EY~~~FG~d~VPY~RG 135 (135) ||||||+|++|+++|++|+|++|++|+||+||||+||.++||+|||||+|| T Consensus 81 lLGR~~~~~~Ei~~~~~i~a~~G~~a~Id~lldS~EY~~~FG~d~VPy~R~ 131 (131) T PF00427_consen 81 LLGRAPYNQAEISAYSIILAEQGFEAFIDSLLDSDEYLENFGEDTVPYQRG 131 (131) T ss_pred HHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHCCHHHHHHCCCCCCCCCCC T ss_conf 728899999999999999992380999999968799998759988997889 No 2 >PF07583 PSCyt2: Protein of unknown function (DUF1549); InterPro: IPR011444 This domain is found in a family of paralogues in the planctomycetes. The function is not known. It is found associated with the Planctomycete cytochrome C domain IPR011429 from INTERPRO. Probab=90.32 E-value=0.07 Score=30.15 Aligned_cols=54 Identities=20% Similarity=0.327 Sum_probs=39.3 Q ss_pred CCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHCCCHHHHHCCCC Q ss_conf 7068999888775078998988999999998706823466752486788850787 Q T0544 73 AHNRFIELNFKHLLGRAPYDQAEVAAHAATYHSHGYDADINSYIDSAEYTESFGD 127 (135) Q Consensus 73 ~~~r~iEl~~khlLGR~p~~~~Ei~~~~~i~a~~G~~a~Id~lidS~EY~~~FG~ 127 (135) ..-.++-=.+--|.|++|..+ |+.++..--+..-++..||.|+.|++|.+.++. T Consensus 23 dd~t~lRRv~lDL~Gl~Pt~e-Ev~~Fl~d~s~~~~~~lVD~LLasp~y~e~wa~ 76 (208) T PF07583_consen 23 DDETFLRRVYLDLTGLPPTPE-EVRAFLADQSPDKREKLVDRLLASPHYGERWAR 76 (208) T ss_pred CHHHHHHHHHHHHHCCCCCHH-HHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHH T ss_conf 899999999999807995999-999998579857999999999778089999999 No 3 >PF10216 ChpXY: CO2 hydration protein (ChpXY) Probab=79.09 E-value=1.1 Score=22.77 Aligned_cols=89 Identities=22% Similarity=0.393 Sum_probs=55.8 Q ss_pred CCCCCCCHHHHHHH-HHHHHHHHHCCCCCCCCCCHHHHHHHHH---------CCCCCHHHHHHHHHCCHHHHHHCCCCCC Q ss_conf 32799898889999-9999898712554322233035788874---------6897789999998425788872266787 Q T0544 4 EWRAGASSDEINAI-IRAVYRQVLGNDYVMSTERLTSAESLLR---------GGEISVRDFVRAVALSELYREKFFHNNA 73 (135) Q Consensus 4 el~p~~s~~~~~~v-I~AaYrQVf~~~~~~~~er~~~~ES~lr---------~g~IsVreFVr~la~S~~yr~~f~~~~~ 73 (135) .|.|+..+.-++.| |-.+|--|+. . +..+-+--+|.||- ||++++....+- .|+--- T Consensus 10 alL~Dtp~nlleVVgilksYgvvlD-a--YsrnL~yiae~qFL~~fP~FKyF~Ge~~~~kLl~H----------l~hDRI 76 (353) T PF10216_consen 10 ALLPDTPDNLLEVVGILKSYGVVLD-A--YSRNLLYIAERQFLNPFPFFKYFNGEISLPKLLHH----------LWHDRI 76 (353) T ss_pred CCCCCCHHHHHHHHHHHHHHCCHHH-H--HHHHHHHHHHHHHCCCCHHHHHHCCCCCHHHHHHH----------HHHCHH T ss_conf 6689975879999999987410299-8--88889999986630322587771788788999999----------731110 Q ss_pred CHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHCCCHHHHHC Q ss_conf 068999888775078998988999999998706823466752486788850 Q T0544 74 HNRFIELNFKHLLGRAPYDQAEVAAHAATYHSHGYDADINSYIDSAEYTES 124 (135) Q Consensus 74 ~~r~iEl~~khlLGR~p~~~~Ei~~~~~i~a~~G~~a~Id~lidS~EY~~~ 124 (135) |+.+.|.|-|..+=- .. +-.|+++||+||.++ T Consensus 77 N~EyAEyCmkaM~WH---------------g~----GglDaYLDs~ef~~~ 108 (353) T PF10216_consen 77 NFEYAEYCMKAMFWH---------------GG----GGLDAYLDSEEFKEN 108 (353) T ss_pred HHHHHHHHHHHHHCC---------------CC----CCCCCCCCCHHHHHH T ss_conf 159999999987516---------------77----885521288999999 No 4 >PF07587 PSD1: Protein of unknown function (DUF1553); InterPro: IPR011444 This domain is found in a family of paralogues in the planctomycetes. The function is not known. It is found associated with the Planctomycete cytochrome C domain IPR011429 from INTERPRO. Probab=69.80 E-value=3.3 Score=19.68 Aligned_cols=91 Identities=20% Similarity=0.229 Sum_probs=59.2 Q ss_pred HHHHHHHHHHHHHCCCCCC-----CC--------CCHHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHCCCCCCCHHHHHH Q ss_conf 9999999989871255432-----22--------3303578887468977899999984257888722667870689998 Q T0544 14 INAIIRAVYRQVLGNDYVM-----ST--------ERLTSAESLLRGGEISVRDFVRAVALSELYREKFFHNNAHNRFIEL 80 (135) Q Consensus 14 ~~~vI~AaYrQVf~~~~~~-----~~--------er~~~~ES~lr~g~IsVreFVr~la~S~~yr~~f~~~~~~~r~iEl 80 (135) -.++++=...+.||+..+. .. |-|..|...|....-++|.+||.++.|+.|++-=-..-.+ ..+ - T Consensus 19 aRviVNRvW~~~fGrGiV~pvdDfg~~g~~PshPeLLD~La~~F~~~g~dlK~L~R~I~~S~tYq~sS~~~~~~-~~~-d 96 (266) T PF07587_consen 19 ARVIVNRVWQHLFGRGIVEPVDDFGSQGNPPSHPELLDWLAQEFVDHGWDLKRLIRLIVLSRTYQQSSQPNEEN-LEI-D 96 (266) T ss_pred HHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHCCHHHHCCCCCCCHH-HCC-C T ss_conf 99999999999809867389655558899999989999999999986999999999998559884868688022-046-9 Q ss_pred HHHHHCCCCCCC--HHHHHHHHHHHHHC Q ss_conf 887750789989--88999999998706 Q T0544 81 NFKHLLGRAPYD--QAEVAAHAATYHSH 106 (135) Q Consensus 81 ~~khlLGR~p~~--~~Ei~~~~~i~a~~ 106 (135) --.+++.|++-- .+|.+.-+.+.++. T Consensus 97 p~n~~~~~~~~rRL~AE~irDsil~~sg 124 (266) T PF07587_consen 97 PDNRLFARFPRRRLSAEQIRDSILQASG 124 (266) T ss_pred CCCHHHCCCCCCCCCHHHHHHHHHHHHH T ss_conf 7553125799928899999999999987 No 5 >PF07624 PSD2: Protein of unknown function (DUF1585); InterPro: IPR011478 This entry represents a conserved region at the C-terminus of a family of cytochrome-like proteins in Rhodopirellula baltica and Solibacter usitatus. These proteins also contain IPR013036 from INTERPRO, IPR013039 from INTERPRO, IPR013042 from INTERPRO and IPR013043 from INTERPRO. Probab=60.31 E-value=4.3 Score=18.97 Aligned_cols=29 Identities=17% Similarity=0.415 Sum_probs=19.0 Q ss_pred HHHHHHHHHCCCCCHHHHHHHHHCCHHHH Q ss_conf 03578887468977899999984257888 Q T0544 37 LTSAESLLRGGEISVRDFVRAVALSELYR 65 (135) Q Consensus 37 ~~~~ES~lr~g~IsVreFVr~la~S~~yr 65 (135) +..+..+++.+.-+++++|.+|..|+.|| T Consensus 48 i~~i~~~~~~~~y~~~~Li~~iV~S~~Fr 76 (76) T PF07624_consen 48 IDAIVEAFKANGYRLRDLILAIVTSDAFR 76 (76) T ss_pred HHHHHHHHHHCCCCHHHHHHHHHCCCCCC T ss_conf 99999999886998999999997584679 No 6 >PF01450 IlvC: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR000506 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine . The enzyme forms a tetramer of similar but non-identical chains, and requires magnesium as a cofactor. ; GO: 0004455 ketol-acid reductoisomerase activity, 0009082 branched chain family amino acid biosynthetic process; PDB: 1yrl_C 1yve_J 1qmg_C 3fr7_A 3fr8_A 1np3_A. Probab=43.35 E-value=3.5 Score=19.56 Aligned_cols=63 Identities=25% Similarity=0.330 Sum_probs=40.5 Q ss_pred HCCHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCHHHHH---------HHHHHHHHCCCHHHHHHHCCCHHHHH Q ss_conf 425788872266787068999888775078998988999---------99999870682346675248678885 Q T0544 59 ALSELYREKFFHNNAHNRFIELNFKHLLGRAPYDQAEVA---------AHAATYHSHGYDADINSYIDSAEYTE 123 (135) Q Consensus 59 a~S~~yr~~f~~~~~~~r~iEl~~khlLGR~p~~~~Ei~---------~~~~i~a~~G~~a~Id~lidS~EY~~ 123 (135) ..||+|-.+-.=+-.-.-.|+.+|.+|. ++=++. |+. .-.++++++|+..+.+++=|..||-. T Consensus 5 ~~sDLfGEq~vL~Gg~~~lv~~~Fe~Lv-eaG~~p-E~Ay~e~~~e~klI~dli~~~Gi~~M~~~iS~TAeyG~ 76 (145) T PF01450_consen 5 TESDLFGEQAVLCGGVHALVEAGFETLV-EAGYSP-EMAYFECLHETKLIVDLIYEGGIAGMYDSISDTAEYGA 76 (145) T ss_dssp HHHHH---TTTTHHHHHHHHHHHHHHHH-H----H-HHHHHHTHHHHHHHHHHHHHHHHHHHHHTS-HHHHHHH T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCCCCH-HHHHHHHHHHHHHHHHHHHHCCHHHHHHHCCCHHHCCH T ss_conf 8876431169999899999999999999-859988-99999999999999999998769999986587987220 No 7 >PF05598 DUF772: Transposase domain (DUF772); InterPro: IPR008490 This family consists of several proteins from Sulfolobus solfataricus described as first ORF in transposon ISC1212. Probab=31.45 E-value=15 Score=15.68 Aligned_cols=26 Identities=19% Similarity=0.372 Sum_probs=12.7 Q ss_pred HHHHCC----CCCCCHHHHHHHHHHHHHCC Q ss_conf 877507----89989889999999987068 Q T0544 82 FKHLLG----RAPYDQAEVAAHAATYHSHG 107 (135) Q Consensus 82 ~khlLG----R~p~~~~Ei~~~~~i~a~~G 107 (135) ++.++| .++-+.+-+..+-+.+..+| T Consensus 38 ~~~~~gl~~~~~~pd~stl~rfr~rl~~~~ 67 (77) T PF05598_consen 38 FRYFCGLDLDEPVPDHSTLSRFRKRLIEHG 67 (77) T ss_pred HHHHHCCCCCCCCCCHHHHHHHHHHHHHCC T ss_conf 999828531357998279999999986720 No 8 >PF09824 ArsR: ArsR transcriptional regulator Probab=30.46 E-value=15 Score=15.58 Aligned_cols=30 Identities=20% Similarity=0.372 Sum_probs=25.9 Q ss_pred HHHHHHHHCCCCCHHHHHHHHHCCHHHHHH Q ss_conf 357888746897789999998425788872 Q T0544 38 TSAESLLRGGEISVRDFVRAVALSELYREK 67 (135) Q Consensus 38 ~~~ES~lr~g~IsVreFVr~la~S~~yr~~ 67 (135) ..+|....+|.+++-+..|.++.|.+|-+. T Consensus 111 ~~ie~~i~~g~~si~dlsr~~g~sp~~irg 140 (160) T PF09824_consen 111 EKIEAEIENGNTSIGDLSRKLGISPTFIRG 140 (160) T ss_pred HHHHHHHHCCCCCHHHHHHHHCCCHHHHHH T ss_conf 999999985982189999881878999999 No 9 >PF12408 DUF3666: Ribose-5-phosphate isomerase ; PDB: 3c5y_N 2ppw_A. Probab=29.12 E-value=16 Score=15.44 Aligned_cols=26 Identities=27% Similarity=0.512 Sum_probs=20.7 Q ss_pred HHHHHHHHCCHHHHHHCCCCCCCHHH Q ss_conf 99999984257888722667870689 Q T0544 52 RDFVRAVALSELYREKFFHNNAHNRF 77 (135) Q Consensus 52 reFVr~la~S~~yr~~f~~~~~~~r~ 77 (135) +|+|++-..++-|++.||.++-.-.. T Consensus 16 qdlvK~AvsGe~Fqe~FF~Ncq~~eI 41 (48) T PF12408_consen 16 QDLVKTAVSGERFQECFFANCQDEEI 41 (48) T ss_dssp HHHHHHHC---HHHHHHCCC---HHH T ss_pred HHHHHHHHHHHHHHHHHHHCCCHHHH T ss_conf 99999882339899998842880899 No 10 >PF06464 DMAP_binding: DMAP1-binding Domain; InterPro: IPR010506 This domain binds DMAP1, a transcriptional co-repressor.; GO: 0008134 transcription factor binding, 0005634 nucleus Probab=24.19 E-value=16 Score=15.46 Aligned_cols=25 Identities=24% Similarity=0.417 Sum_probs=21.9 Q ss_pred CCCHHHHHHHHHCCCCCHHHHHHHH Q ss_conf 2330357888746897789999998 Q T0544 34 TERLTSAESLLRGGEISVRDFVRAV 58 (135) Q Consensus 34 ~er~~~~ES~lr~g~IsVreFVr~l 58 (135) ..+|..|+-.+.+|+||-+++...- T Consensus 10 ~~~L~~L~~e~~~GdiT~KGY~kkr 34 (111) T PF06464_consen 10 RERLKELDLELSEGDITEKGYEKKR 34 (111) T ss_pred HHHHHHHHHHHCCCCCHHHHHHHHH T ss_conf 9999999987411422099999999 No 11 >PF05120 GvpG: Gas vesicle protein G ; InterPro: IPR007804 Gas vesicles are intracellular, protein-coated, and hollow organelles found in cyanobacteria and halophilic archaea. They are permeable to ambient gases by diffusion and provide buoyancy, enabling cells to move upwards in water to access oxygen and/or light. Proteins containing this family are involved in the formation of gas vesicles . Probab=23.58 E-value=20 Score=14.80 Aligned_cols=41 Identities=24% Similarity=0.275 Sum_probs=28.8 Q ss_pred HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCHHHHHHH Q ss_conf 9999999898712554322233035788874689778999999 Q T0544 15 NAIIRAVYRQVLGNDYVMSTERLTSAESLLRGGEISVRDFVRA 57 (135) Q Consensus 15 ~~vI~AaYrQVf~~~~~~~~er~~~~ES~lr~g~IsVreFVr~ 57 (135) +.|..+|=+|... ..--..++..++-+|..|+||-.+|-+. T Consensus 17 e~I~~~Ae~e~~D--~~~i~~~L~~L~~~~e~GEIseEEf~~~ 57 (80) T PF05120_consen 17 EQIQEQAERELYD--PAAIRRQLAELQLALEMGEISEEEFDRR 57 (80) T ss_pred HHHHHHHHHHHCC--HHHHHHHHHHHHHHHHCCCCCHHHHHHH T ss_conf 9999999998658--8999999999999988599988999989 Done!