Query T0546 BvR159, , 134 residues Match_columns 134 No_of_seqs 67 out of 69 Neff 3.4 Searched_HMMs 11830 Date Fri May 21 18:06:50 2010 Command /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/hhm/T0546.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/hhm/T0546.hhr No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF08948 DUF1859: Domain of un 84.1 0.081 6.8E-06 29.6 -0.0 41 3-43 78-118 (126) 2 PF06711 DUF1198: Protein of u 29.3 11 0.00096 16.4 2.0 65 59-127 39-104 (148) 3 PF04630 Phage_tail: Phage maj 22.0 6.8 0.00057 17.8 -0.3 81 22-103 110-196 (199) 4 PF10929 DUF2811: Protein of u 20.0 11 0.00093 16.5 0.5 30 93-128 16-45 (57) 5 PF02630 SCO1-SenC: SCO1/SenC; 16.2 29 0.0025 13.9 6.5 101 11-126 31-142 (174) 6 PF01023 S_100: S-100/ICaBP ty 15.8 30 0.0026 13.8 3.4 35 62-102 8-42 (44) 7 PF08343 RNR_N: Ribonucleotide 15.4 21 0.0018 14.8 1.0 44 73-127 13-57 (82) 8 PF09820 AAA-ATPase_like: Pred 13.7 34 0.0029 13.4 2.3 31 89-119 229-259 (284) 9 PF05830 NodZ: Nodulation prot 13.1 22 0.0018 14.7 0.6 49 52-101 186-237 (321) 10 PF11465 Receptor_2B4: Natural 12.6 14 0.0012 15.9 -0.5 31 3-38 6-37 (108) No 1 >PF08948 DUF1859: Domain of unknown function (DUF1859); InterPro: IPR015043 This protein has no known function. It is predominantly found in the N-terminus of bacteriophage spike proteins . ; PDB: 1w8x_N. Probab=84.13 E-value=0.081 Score=29.60 Aligned_cols=41 Identities=29% Similarity=0.551 Sum_probs=35.8 Q ss_pred HHHHHHCCCCCEEEEECCCCCEEEEEEECCCCEEEEECCCC Q ss_conf 04211328983267621588636887411686067620654 Q T0546 3 KTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHD 43 (134) Q Consensus 3 ~~IlsIsGKPGLykLvsq~k~g~IvESLd~~kkr~~~~~~~ 43 (134) +.|-+-+||-|-|-|++++|.-||+..+.++||.+|.+--+ T Consensus 78 QRIt~~AG~QGYfPlL~~~~~KFv~~~~~~GKks~P~~FlN 118 (126) T PF08948_consen 78 QRITCPAGKQGYFPLLVPGRAKFVVRHTGSGKKSVPMFFLN 118 (126) T ss_dssp ---------------BB----SS--BB----------S--- T ss_pred CEEECCCCCCCCCEEECCCHHHHHHHHCCCCCCCEEEEEEE T ss_conf 48874577853214660666555445506887220268980 No 2 >PF06711 DUF1198: Protein of unknown function (DUF1198); InterPro: IPR009587 This family consists of several bacterial proteins of around 150 residues in length which are specific to Escherichia coli, Salmonella species and Yersinia pestis. The function of this family is unknown. Probab=29.34 E-value=11 Score=16.39 Aligned_cols=65 Identities=25% Similarity=0.472 Sum_probs=36.4 Q ss_pred CCCHHHHHHHHHHHHCCCCCCCCCC-CCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC Q ss_conf 7558899999987626762326855-58978999999985886552135334789899999888736874 Q T0546 59 EVPLSEVLEAVKKKENGAVASINYK-KASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGIT 127 (134) Q Consensus 59 evPL~eV~~~i~~ke~g~~~~i~~k-kas~~eL~~yf~eVLP~yD~dRVy~SDIKKliqWYniL~~~g~~ 127 (134) -||+...++-|.+. .|..- +-+- ..+..+|+. -+-||==|--=-|-+|| .-+-+|||+|++.++- T Consensus 39 pv~iESMi~qmGk~-~g~~F-iryl~~~~e~hl~n-aA~vllI~q~~I~d~sd-~Nl~~W~~~L~ka~l~ 104 (148) T PF06711_consen 39 PVPIESMIDQMGKR-QGQEF-IRYLSRGDEEHLQN-AAQVLLIYQTFIVDGSD-ENLQQWRRLLQKARLA 104 (148) T ss_pred EEEHHHHHHHHCCH-HHHHH-HHHHCCCCHHHHHH-HHHHHHHHEEEEECCCH-HHHHHHHHHHHHCCCC T ss_conf 25599999997404-07899-99970898899973-47677523001326737-7899999999982689 No 3 >PF04630 Phage_tail: Phage major tail protein; InterPro: IPR006724 This family contains a major tail protein from phage. Probab=22.00 E-value=6.8 Score=17.78 Aligned_cols=81 Identities=17% Similarity=0.242 Sum_probs=47.3 Q ss_pred CCEEEEEE--ECCCCEEEEECCCCCEEECCCEEEEECCCCC---CHHHHHHHHH-HHHCCCCCCCCCCCCCHHHHHHHHH Q ss_conf 86368874--1168606762065440230224676327775---5889999998-7626762326855589789999999 Q T0546 22 KNMLIVET--VDAAKKRVPAYAHDKVISLADIAMYTDAEEV---PLSEVLEAVK-KKENGAVASINYKKASADELHAYFA 95 (134) Q Consensus 22 k~g~IvES--Ld~~kkr~~~~~~~~Vs~L~dIaiYT~~eev---PL~eV~~~i~-~ke~g~~~~i~~kkas~~eL~~yf~ 95 (134) .-.++.|| ++.++.+..++.+-+++. .++.+=|.++.. +-.=.++.+. ...++..-.+-.-.+++-.+..||+ T Consensus 110 ~VA~l~~s~~~dg~~~~y~gf~kG~fs~-~~~~~~T~~~~~~~~~d~lt~~al~~~~~~~~~~ki~~~~~~~F~~~~m~k 188 (199) T PF04630_consen 110 HVAVLFESEDLDGKKAVYFGFYKGTFSE-DDINLQTDEKAETRQNDKLTFTALSDRRFDGQPYKIYYSGDPGFDEDKMLK 188 (199) T ss_pred CEEEEEEEECCCCCEEEEEEEEEEEECC-CCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCEEEEEECCCCCCCHHHHHH T ss_conf 7899999976899805899983269866-765455577886555735999984046779946999966898989899999 Q ss_pred HHCCCCCC Q ss_conf 85886552 Q T0546 96 EVLPNYDR 103 (134) Q Consensus 96 eVLP~yD~ 103 (134) ||+|.|-- T Consensus 189 eVF~Gy~~ 196 (199) T PF04630_consen 189 EVFGGYTK 196 (199) T ss_pred HHCCCCCC T ss_conf 87188103 No 4 >PF10929 DUF2811: Protein of unknown function (DUF2811) Probab=20.00 E-value=11 Score=16.49 Aligned_cols=30 Identities=30% Similarity=0.596 Sum_probs=22.6 Q ss_pred HHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC Q ss_conf 999858865521353347898999998887368744 Q T0546 93 YFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGITE 128 (134) Q Consensus 93 yf~eVLP~yD~dRVy~SDIKKliqWYniL~~~g~~~ 128 (134) -|-|--|++|++||..+-+- .-|.+||..+ T Consensus 16 ~fie~hP~WDQ~Rl~~aALa------~FL~QnG~~~ 45 (57) T PF10929_consen 16 DFIETHPNWDQYRLFQAALA------GFLLQNGCQD 45 (57) T ss_pred HHHHCCCCCHHHHHHHHHHH------HHHHHCCCCH T ss_conf 99871998329999999999------9999858601 No 5 >PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems. In yeast the SCO1 protein is specifically required for a post-translational step in the accumulation of subunits 1 and 2 of cytochrome c oxidase (COXI and COX-II) . It is a mitochondrion-associated cytochrome c oxidase assembly factor. The purple nonsulphur photosynthetic eubacterium Rhodobacter capsulatus is a versatile organism that can obtain cellular energy by several means, including the capture of light energy for photosynthesis as well as the use of light-independent respiration, in which molecular oxygen serves as a terminal electron acceptor. The SENC protein is required for optimal cytochrome c oxidase activity in aerobically grown R. capsulatus cells and is involved in the induction of structural polypeptides of the light-harvesting and reaction centre complexes .; GO: 0006118 electron transport; PDB: 2b7k_B 2b7j_B 2ggt_B 2gt5_A 1wp0_B 2gqm_A 2hrf_A 2gvp_A 2gt6_A 2hrn_A .... Probab=16.24 E-value=29 Score=13.86 Aligned_cols=101 Identities=19% Similarity=0.254 Sum_probs=65.1 Q ss_pred CCCEEEEECCCCCEEEEEEECCCCEEEEECCCCCEEECCCEEEEECCCCC-C-----HHHHHHHHHHHHCCCC-----CC Q ss_conf 98326762158863688741168606762065440230224676327775-5-----8899999987626762-----32 Q T0546 11 KPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEV-P-----LSEVLEAVKKKENGAV-----AS 79 (134) Q Consensus 11 KPGLykLvsq~k~g~IvESLd~~kkr~~~~~~~~Vs~L~dIaiYT~~eev-P-----L~eV~~~i~~ke~g~~-----~~ 79 (134) -+|-|+|+.|.-.-+=.++ ...|++++. =+||.-.++ | |.++++.+.+. +.. .| T Consensus 31 ~~~~f~L~d~~G~~~~~~~-----------l~Gk~~lv~--F~yT~CpdvCP~~l~~l~~~~~~L~~~--~~~v~~v~IS 95 (174) T PF02630_consen 31 IVPDFTLTDQDGKTFTLED-----------LKGKWVLVF--FGYTSCPDVCPTTLANLSQAQEKLGEE--GKDVQFVFIS 95 (174) T ss_dssp -----EEEB----EEEGGG-----------GTTSEEEEE--EE-TTSSSHHHHHHHHHHHHHHHHHHC--CTTEEEEEEE T ss_pred CCCCCEEECCCCCEECHHH-----------HCCCEEEEE--EEECCCCCCCHHHHHHHHHHHHHHHHC--CCCEEEEEEE T ss_conf 4798379818999972788-----------399889999--982798875888999999999997644--7855999999 Q ss_pred CCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCC Q ss_conf 68555897899999998588655213533478989999988873687 Q T0546 80 INYKKASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGI 126 (134) Q Consensus 80 i~~kkas~~eL~~yf~eVLP~yD~dRVy~SDIKKliqWYniL~~~g~ 126 (134) ++++..+++.|++|-...=|+++-=+--..+|+.+.+.|++...... T Consensus 96 vDP~rDtp~~L~~Y~~~f~~~~~~ltg~~~~i~~l~~~~~v~~~~~~ 142 (174) T PF02630_consen 96 VDPERDTPEVLKKYAKRFGADFDGLTGDREDIEELAKAFGVYYEKVP 142 (174) T ss_dssp SSTTTC-HHHHHHHHHTCTTTCBGEBEEHHHHHHHHHHTTHCEECES T ss_pred ECCCCCCHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHCCCEEECC T ss_conf 79898999999999997098877048689999999998174068456 No 6 >PF01023 S_100: S-100/ICaBP type calcium binding domain; InterPro: IPR013787 The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain . S100s are small dimeric acidic calcium and zinc-binding proteins abundant in the brain, with S100B playing an important role in modulating the proliferation and differentiation of neurons and glia cells . S100 proteins have two different types of calcium-binding sites: a low affinity one with a special structure, and a 'normal' EF-hand type high-affinity site. Calbindin-D9k (CaBP-9k) also belong to this family of proteins, but it does not form dimers. CaBP-9k is a cytosolic protein expressed in a variety of tissues. Although its precise function is unknown, it appears to be under the control of the steroid hormones oestrogen and progesterone in the female reproductive system . In the intestine, CaBP-9k may be involved in calcium absorption by mediating intracellular diffusion . This entry represents a subdomain of the calcium-binding domain found in S100, CaBP-9k, and related proteins. ; PDB: 1zfs_B 2k2f_B 1k2h_B 2kbm_A 2jpt_B 1xyd_A 2k7o_A 1mwn_B 1sym_A 1b4c_A .... Probab=15.76 E-value=30 Score=13.79 Aligned_cols=35 Identities=31% Similarity=0.488 Sum_probs=26.0 Q ss_pred HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCCC Q ss_conf 88999999876267623268555897899999998588655 Q T0546 62 LSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPNYD 102 (134) Q Consensus 62 L~eV~~~i~~ke~g~~~~i~~kkas~~eL~~yf~eVLP~yD 102 (134) +-+||.+-..++ |...++ +..||+..+..=||+|= T Consensus 8 iI~vFhkYa~~~-G~~~tL-----sk~Elk~Ll~~El~~fl 42 (44) T PF01023_consen 8 IIEVFHKYAGKE-GDKDTL-----SKKELKELLEKELPNFL 42 (44) T ss_dssp HHHHHHHHHTT----TTCE-----EHHHHHHHHHHHSTTTS T ss_pred HHHHHHHHHCCC-CCCCCC-----CHHHHHHHHHHHHHHHH T ss_conf 999999986327-985657-----79999999999888886 No 7 >PF08343 RNR_N: Ribonucleotide reductase N-terminal; InterPro: IPR013554 This domain is found at the N terminus of bacterial ribonucleoside-diphosphate reductases (ribonucleotide reductases, RNRs) which catalyse the formation of deoxyribonucleotides . It occurs together with the RNR all-alpha domain (IPR013509 from INTERPRO) and the RNR barrel domain (IPR000788 from INTERPRO). ; GO: 0004748 ribonucleoside-diphosphate reductase activity, 0005515 protein binding, 0006260 DNA replication, 0005971 ribonucleoside-diphosphate reductase complex; PDB: 1pem_A 2bq1_E 1peu_A 1peq_A 1peo_A. Probab=15.37 E-value=21 Score=14.78 Aligned_cols=44 Identities=36% Similarity=0.612 Sum_probs=25.5 Q ss_pred HCCCCCCCCCCCCCHHHHHHHHHH-HCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC Q ss_conf 267623268555897899999998-5886552135334789899999888736874 Q T0546 73 ENGAVASINYKKASADELHAYFAE-VLPNYDRDRVHNGDIKKLISWYNILVNNGIT 127 (134) Q Consensus 73 e~g~~~~i~~kkas~~eL~~yf~e-VLP~yD~dRVy~SDIKKliqWYniL~~~g~~ 127 (134) ++|. +.. ..|.+.+++||.+ |.|+- |.=.+++.=+.| |+++|+- T Consensus 13 ~~G~---iql-~kD~eA~~~y~~e~V~pnt----~~F~sl~erl~y---Lv~~~YY 57 (82) T PF08343_consen 13 EDGK---IQL-DKDKEALRAYFEEHVNPNT----VFFHSLEERLDY---LVENGYY 57 (82) T ss_dssp ---------T-HHHHHHHHHHHHHTTGGGB-------SSHHHH------TTT---- T ss_pred CCCC---CCC-HHHHHHHHHHHHHHHCCCC----CCCCCHHHHHHH---HHHCCCH T ss_conf 6887---174-4579999999998613241----004989999999---9986858 No 8 >PF09820 AAA-ATPase_like: Predicted AAA-ATPase Probab=13.69 E-value=34 Score=13.44 Aligned_cols=31 Identities=23% Similarity=0.489 Sum_probs=11.5 Q ss_pred HHHHHHHHHCCCCCCCCCCHHHHHHHHHHHH Q ss_conf 9999999858865521353347898999998 Q T0546 89 ELHAYFAEVLPNYDRDRVHNGDIKKLISWYN 119 (134) Q Consensus 89 eL~~yf~eVLP~yD~dRVy~SDIKKliqWYn 119 (134) |+++.|.+.+.++++..=+...+.++=.||| T Consensus 229 EV~~~l~~y~~~~~~~~~~e~~~~~lk~wYd 259 (284) T PF09820_consen 229 EVETLLKEYLENLAEKQDREEILEELKEWYD 259 (284) T ss_pred HHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC T ss_conf 9999999999851101789999999998627 No 9 >PF05830 NodZ: Nodulation protein Z (NodZ); InterPro: IPR008716 The nodulation genes of Rhizobia are regulated by the nodD gene product in response to host-produced flavonoids and appear to encode enzymes involved in the production of a lipo-chitose signal molecule required for infection and nodule formation. NodZ is required for the addition of a 2-O-methylfucose residue to the terminal reducing N-acetylglucosamine of the nodulation signal. This substitution is essential for the biological activity of this molecule. Mutations in nodZ result in defective nodulation. nodZ represents a unique nodulation gene that is not under the control of NodD and yet is essential for the synthesis of an active nodulation signal .; GO: 0016758 transferase activity, transferring hexosyl groups, 0009312 oligosaccharide biosynthetic process, 0009877 nodulation; PDB: 2hhc_A 2hlh_A 2ocx_A. Probab=13.13 E-value=22 Score=14.67 Aligned_cols=49 Identities=29% Similarity=0.342 Sum_probs=36.8 Q ss_pred EEEECCCCCCHHHHHHHHHH---HHCCCCCCCCCCCCCHHHHHHHHHHHCCCC Q ss_conf 67632777558899999987---626762326855589789999999858865 Q T0546 52 AMYTDAEEVPLSEVLEAVKK---KENGAVASINYKKASADELHAYFAEVLPNY 101 (134) Q Consensus 52 aiYT~~eevPL~eV~~~i~~---ke~g~~~~i~~kkas~~eL~~yf~eVLP~y 101 (134) +-|-.+.|.||..|.++|.+ +-..++..|-....|+ +..+-|.+.+|++ T Consensus 186 apy~~D~e~~L~~V~t~I~~~Ka~~p~kp~rIFLATDSa-~Vvdqfr~~FPdi 237 (321) T PF05830_consen 186 APYWADMERPLHQVCTSIRKAKALKPNKPVRIFLATDSA-EVVDQFREEFPDI 237 (321) T ss_dssp ----HHHHHHHHHHHHHHHHHHTS--SS-EEEEEEES-H-HHHHHH----TTE T ss_pred CCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCH-HHHHHHHHHCCCC T ss_conf 876323276899999999998730888772299965949-9999999877970 No 10 >PF11465 Receptor_2B4: Natural killer cell receptor 2B4; PDB: 2ptu_C 2ptt_B 1z2k_A. Probab=12.64 E-value=14 Score=15.85 Aligned_cols=31 Identities=23% Similarity=0.357 Sum_probs=17.1 Q ss_pred HHHHHHCCCCCEEEE-ECCCCCEEEEEEECCCCEEEE Q ss_conf 042113289832676-215886368874116860676 Q T0546 3 KTILSIAGKPGLYKL-ISQGKNMLIVETVDAAKKRVP 38 (134) Q Consensus 3 ~~IlsIsGKPGLykL-vsq~k~g~IvESLd~~kkr~~ 38 (134) +++++|||||=-.+- --|+|. -|+ +=||+.+ T Consensus 6 eeVvgvSGkPv~LrPsnIQtK~----vSi-~WKK~~~ 37 (108) T PF11465_consen 6 EEVVGVSGKPVRLRPSNIQTKD----VSI-QWKKKTQ 37 (108) T ss_dssp EEEE------EEE--SS---SS----EEE-EEEEE-- T ss_pred HHEEEECCCEEEECCCCCCCCE----EEE-EEEEECC T ss_conf 0157634835666565441231----268-8744065 Done!