Query         T0591 YP_354942.1, , 406 residues
Match_columns 406
No_of_seqs    188 out of 8756
Neff          8.6 
Searched_HMMs 22458
Date          Mon Jul  5 09:17:00 2010
Command       /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/seq/T0591.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pdb70_15May10_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pdb70search/T0591.hhr 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1j32_A Aspartate aminotransfer 100.0       0       0  549.5  35.9  386    1-404     1-387 (388)
  2 1xi9_A Putative transaminase;  100.0       0       0  507.5  35.7  356   38-404    38-403 (406)
  3 3b46_A Aminotransferase BNA3;  100.0       0       0  513.7  28.5  359   39-401    58-444 (447)
  4 1bw0_A TAT, protein (tyrosine  100.0       0       0  501.0  36.5  360   39-406    34-415 (416)
  5 3fvs_A Kynurenine--oxoglutarat 100.0       0       0  504.7  33.3  365   37-404    27-422 (422)
  6 1b5p_A Protein (aspartate amin 100.0       0       0  501.3  34.5  378    3-403     4-384 (385)
  7 2o1b_A Aminotransferase, class 100.0       0       0  507.6  29.6  361   35-405    43-404 (404)
  8 2o0r_A RV0858C (N-succinyldiam 100.0       0       0  503.4  31.8  362   37-405    24-397 (411)
  9 1d2f_A MALY protein; aminotran 100.0       0       0  496.9  36.4  381    4-405     5-390 (390)
 10 1yiz_A Kynurenine aminotransfe 100.0       0       0  497.7  35.3  360   39-401    38-426 (429)
 11 3dyd_A Tyrosine aminotransfera 100.0       0       0  495.2  36.6  356   39-405    55-425 (427)
 12 3kax_A Aminotransferase, class 100.0       0       0  494.2  34.6  376    3-401     4-382 (383)
 13 3dzz_A Putative pyridoxal 5'-p 100.0       0       0  492.7  34.3  361   37-405    26-390 (391)
 14 3e2y_A Kynurenine-oxoglutarate 100.0       0       0  491.6  34.1  362   36-400    21-409 (410)
 15 3fdb_A Beta C-S lyase, putativ 100.0       0       0  492.0  32.0  353   37-404    22-376 (377)
 16 1gd9_A Aspartate aminotransfer 100.0       0       0  482.7  37.8  385    1-405     1-387 (389)
 17 1c7n_A Cystalysin; transferase 100.0       0       0  490.4  31.7  383    5-405     7-394 (399)
 18 1u08_A Hypothetical aminotrans 100.0       0       0  479.0  36.4  353   39-400    31-386 (386)
 19 1o4s_A Aspartate aminotransfer 100.0       0       0  479.0  36.4  375    3-403    14-388 (389)
 20 3h14_A Aminotransferase, class 100.0       0       0  477.4  34.4  372   12-405    11-383 (391)
 21 2dou_A Probable N-succinyldiam 100.0       0       0  475.6  31.0  352   38-402    25-376 (376)
 22 3ihj_A Alanine aminotransferas 100.0       0       0  469.9  34.7  380   19-405    42-494 (498)
 23 2gb3_A Aspartate aminotransfer 100.0       0       0  471.0  33.8  354   38-406    43-404 (409)
 24 2z61_A Probable aspartate amin 100.0       0       0  470.2  34.2  367    3-403     2-370 (370)
 25 1wst_A MSAT, multiple substrat 100.0       0       0  469.9  32.7  362   37-404    40-411 (417)
 26 3jtx_A Aminotransferase; NP_28 100.0       0       0  463.1  34.1  354   36-402    27-396 (396)
 27 3ei9_A LL-diaminopimelate amin 100.0       0       0  467.5  28.9  387    4-405    27-429 (432)
 28 2zc0_A Alanine glyoxylate tran 100.0       0       0  458.3  34.9  393    1-404     1-404 (407)
 29 1m7y_A ACC synthase, 1-aminocy 100.0       0       0  461.3  31.3  388    7-405     4-433 (435)
 30 3g0t_A Putative aminotransfera 100.0       0       0  460.7  31.6  391    3-403    11-436 (437)
 31 1iay_A ACC synthase 2, 1-amino 100.0       0       0  465.3  26.5  354   39-403    37-426 (428)
 32 1vp4_A Aminotransferase, putat 100.0       0       0  457.6  32.1  382    3-405    17-419 (425)
 33 3if2_A Aminotransferase; YP_26 100.0       0       0  456.8  30.3  391    1-405     2-441 (444)
 34 3ezs_A Aminotransferase ASPB;  100.0       0       0  452.7  30.8  356   28-404    13-375 (376)
 35 3ele_A Amino transferase; RER0 100.0       0       0  449.2  28.5  383    1-405     2-397 (398)
 36 2r2n_A Kynurenine/alpha-aminoa 100.0       0       0  446.3  27.2  356   37-404    30-424 (425)
 37 2zyj_A Alpha-aminodipate amino 100.0       0       0  431.0  33.4  353   37-406    31-395 (397)
 38 3g7q_A Valine-pyruvate aminotr 100.0       0       0  440.9  25.3  387    7-404     4-413 (417)
 39 1v2d_A Glutamine aminotransfer 100.0       0       0  428.9  33.0  369    1-406     1-373 (381)
 40 3d6k_A Putative aminotransfera 100.0       0       0  423.6  26.1  359   27-403    21-417 (422)
 41 3ez1_A Aminotransferase MOCR f 100.0       0       0  418.5  26.7  353   36-406    23-421 (423)
 42 3f6t_A Aspartate aminotransfer 100.0       0       0  414.6  22.3  323   71-404   131-525 (533)
 43 2zy4_A L-aspartate beta-decarb 100.0       0       0  405.6  28.2  323   71-404   132-522 (546)
 44 7aat_A Aspartate aminotransfer 100.0       0       0  408.9  25.1  345   37-402    27-401 (401)
 45 1ajs_A Aspartate aminotransfer 100.0       0       0  404.6  20.6  359   27-405    20-412 (412)
 46 3cq5_A Histidinol-phosphate am 100.0       0       0  386.5  33.4  334   38-402    30-366 (369)
 47 3get_A Histidinol-phosphate am 100.0       0       0  392.1  27.3  363    1-401     2-364 (365)
 48 3ftb_A Histidinol-phosphate am 100.0       0       0  383.9  33.3  335   38-404    26-361 (361)
 49 3fsl_A Aromatic-amino-acid ami 100.0       0       0  391.7  26.8  344   37-401    25-397 (397)
 50 3euc_A Histidinol-phosphate am 100.0       0       0  386.9  30.1  334   39-403    31-367 (367)
 51 2q7w_A Aspartate aminotransfer 100.0       0       0  396.1  22.0  344   38-401    26-396 (396)
 52 2ay1_A Aroat, aromatic amino a 100.0       0       0  389.0  26.3  344   37-400    25-392 (394)
 53 1lc5_A COBD, L-threonine-O-3-p 100.0       0       0  380.1  31.8  336   39-405    25-361 (364)
 54 1yaa_A Aspartate aminotransfer 100.0       0       0  391.0  22.8  348   37-404    28-411 (412)
 55 3fkd_A L-threonine-O-3-phospha 100.0       0       0  385.6  25.7  331   36-405    13-343 (350)
 56 3ffh_A Histidinol-phosphate am 100.0       0       0  374.5  31.7  359    1-400     4-362 (363)
 57 3hdo_A Histidinol-phosphate am 100.0       0       0  362.1  34.0  326   38-402    26-353 (360)
 58 3bwn_A AT1G70560, L-tryptophan 100.0       0       0  378.5  20.2  337   26-400     9-383 (391)
 59 1fg7_A Histidinol phosphate am 100.0       0       0  360.4  29.8  311   40-388    31-343 (356)
 60 3meb_A Aspartate aminotransfer 100.0       0       0  359.2  26.9  364   29-404    41-444 (448)
 61 3ly1_A Putative histidinol-pho 100.0       0       0  352.0  30.9  336   36-403    14-351 (354)
 62 1uu1_A Histidinol-phosphate am 100.0       0       0  352.9  26.4  318   37-405    18-335 (335)
 63 2hox_A ALLIIN lyase 1; cystein 100.0       0       0  359.2  16.9  328   40-405    58-426 (427)
 64 2z9v_A Aspartate aminotransfer 100.0 2.2E-34   1E-38  250.5  28.6  333   37-404     6-371 (392)
 65 2aeu_A Hypothetical protein MJ 100.0 1.8E-34 7.9E-39  251.2  19.7  320   41-401    31-372 (374)
 66 1eg5_A Aminotransferase; PLP-d 100.0 2.6E-28 1.2E-32  209.4  23.2  322   52-405    12-377 (384)
 67 3f0h_A Aminotransferase; RER07 100.0 9.8E-27 4.4E-31  198.8  25.9  329   38-403    18-373 (376)
 68 2e7j_A SEP-tRNA:Cys-tRNA synth 100.0 2.3E-26   1E-30  196.2  20.7  336   38-404     7-370 (371)
 69 1elu_A L-cysteine/L-cystine C-  99.9 2.1E-25 9.2E-30  189.8  23.2  332   34-399    11-387 (390)
 70 2yrr_A Aminotransferase, class  99.9 3.6E-25 1.6E-29  188.2  23.7  325   41-402     2-351 (353)
 71 3kki_A CAI-1 autoinducer synth  99.9 2.3E-24   1E-28  182.8  26.3  330   39-404    60-404 (409)
 72 1jg8_A L-ALLO-threonine aldola  99.9 3.6E-24 1.6E-28  181.4  21.7  328   40-404     5-346 (347)
 73 1svv_A Threonine aldolase; str  99.9 9.3E-24 4.2E-28  178.6  23.8  331   38-402    13-356 (359)
 74 3lws_A Aromatic amino acid bet  99.9 9.7E-25 4.3E-29  185.3  18.6  318   55-401    21-356 (357)
 75 3lvm_A Cysteine desulfurase; s  99.9 4.7E-23 2.1E-27  173.8  22.4  338   32-405    15-400 (423)
 76 1v72_A Aldolase; PLP-dependent  99.9 1.6E-22   7E-27  170.3  25.0  338   37-406     6-355 (356)
 77 1fc4_A 2-amino-3-ketobutyrate   99.9 2.8E-22 1.2E-26  168.6  21.4  342   37-404    43-397 (401)
 78 3frk_A QDTB; aminotransferase,  99.9   8E-24 3.6E-28  179.1  13.2  306   60-400    22-364 (373)
 79 1ax4_A Tryptophanase; tryptoph  99.9 6.7E-21   3E-25  159.3  26.7  332   57-405    57-442 (467)
 80 2ez2_A Beta-tyrosinase, tyrosi  99.9 7.5E-21 3.4E-25  158.9  26.5  329   58-404    57-431 (456)
 81 2w8t_A SPT, serine palmitoyltr  99.9 6.6E-21   3E-25  159.3  25.6  323   54-404    80-415 (427)
 82 2dr1_A PH1308 protein, 386AA l  99.9 5.1E-20 2.3E-24  153.3  29.6  329   41-406    22-381 (386)
 83 3b8x_A WBDK, pyridoxamine 5-ph  99.9 7.6E-21 3.4E-25  158.9  24.6  316   41-397     4-389 (390)
 84 3cai_A Possible aminotransfera  99.9 1.8E-20 8.2E-25  156.3  24.9  340   27-399    13-404 (406)
 85 3a2b_A Serine palmitoyltransfe  99.9 1.2E-19 5.1E-24  150.9  27.9  334   40-405    45-393 (398)
 86 1kmj_A Selenocysteine lyase; p  99.9   2E-19 9.1E-24  149.2  28.7  317   53-402    35-403 (406)
 87 3a9z_A Selenocysteine lyase; P  99.9 2.1E-19 9.3E-24  149.2  25.9  320   53-406    30-430 (432)
 88 1bs0_A Protein (8-amino-7-oxon  99.9 9.7E-19 4.3E-23  144.6  28.3  324   40-400    41-383 (384)
 89 2huf_A Alanine glyoxylate amin  99.9 6.6E-19   3E-23  145.8  25.4  322   54-406    31-385 (393)
 90 1t3i_A Probable cysteine desul  99.9 1.2E-17 5.3E-22  137.2  29.9  324   53-405    40-414 (420)
 91 2c81_A Glutamine-2-deoxy-scyll  99.8 1.2E-17 5.3E-22  137.3  28.0  324   48-404     9-414 (418)
 92 3gbx_A Serine hydroxymethyltra  99.8 6.3E-19 2.8E-23  145.9  21.1  336   40-403    32-395 (420)
 93 3bc8_A O-phosphoseryl-tRNA(SEC  99.8 3.7E-19 1.6E-23  147.5  19.4  312   80-405    97-444 (450)
 94 1e5e_A MGL, methionine gamma-l  99.8 4.8E-17 2.1E-21  133.2  29.5  290   71-401    54-399 (404)
 95 2bwn_A 5-aminolevulinate synth  99.8   6E-17 2.7E-21  132.5  29.8  336   40-403    48-399 (401)
 96 3ht4_A Aluminum resistance pro  99.8 7.9E-20 3.5E-24  152.0  14.1  230   82-332    66-313 (431)
 97 3kgw_A Alanine-glyoxylate amin  99.8 4.2E-17 1.9E-21  133.6  26.8  321   54-405    35-389 (393)
 98 1cs1_A CGS, protein (cystathio  99.8 1.9E-16 8.3E-21  129.2  28.8  283   69-392    42-374 (386)
 99 2rfv_A Methionine gamma-lyase;  99.8 4.6E-16 2.1E-20  126.5  30.3  289   71-403    56-395 (398)
100 2z67_A O-phosphoseryl-tRNA(SEC  99.8 8.5E-18 3.8E-22  138.3  20.9  302   82-401   134-455 (456)
101 2pb2_A Acetylornithine/succiny  99.8 2.8E-16 1.3E-20  128.0  28.7  333   39-406    58-420 (420)
102 3f9t_A TDC, L-tyrosine decarbo  99.8 5.2E-17 2.3E-21  132.9  24.9  325   53-402    42-396 (397)
103 1ibj_A CBL, cystathionine beta  99.8 2.1E-16 9.4E-21  128.8  27.8  288   71-404   125-462 (464)
104 1gc0_A Methionine gamma-lyase;  99.8 3.6E-16 1.6E-20  127.2  28.8  283   71-394    57-390 (398)
105 1qgn_A Protein (cystathionine   99.8 5.7E-16 2.5E-20  125.9  28.8  228   71-333   106-340 (445)
106 3cog_A Cystathionine gamma-lya  99.8 1.4E-16 6.1E-21  130.1  24.1  282   71-394    59-391 (403)
107 2oqx_A Tryptophanase; lyase, p  99.8 1.9E-16 8.5E-21  129.1  24.7  327   59-403    57-441 (467)
108 3dr4_A Putative perosamine syn  99.8 5.1E-17 2.3E-21  133.0  21.6  317   41-400    27-389 (391)
109 3ju7_A Putative PLP-dependent   99.8 1.8E-16 8.2E-21  129.2  23.5  318   53-402    14-373 (377)
110 3e6g_A Xometc, cystathionine g  99.8 1.2E-15 5.5E-20  123.6  27.7  282   71-394    59-392 (400)
111 3jzl_A Putative cystathionine   99.8 2.6E-17 1.2E-21  134.9  18.7  227   82-332    60-307 (409)
112 2bkw_A Alanine-glyoxylate amin  99.8   7E-17 3.1E-21  132.1  20.3  299   81-405    38-385 (385)
113 2fq6_A Cystathionine beta-lyas  99.8 1.6E-15 7.1E-20  122.9  26.0  284   71-393    74-406 (415)
114 2ord_A Acoat, acetylornithine   99.8 6.7E-16   3E-20  125.4  23.9  341   37-403    38-396 (397)
115 3ffr_A Phosphoserine aminotran  99.8 7.9E-16 3.5E-20  125.0  23.8  326   41-401     6-361 (362)
116 1z7d_A Ornithine aminotransfer  99.8 1.8E-15 7.9E-20  122.6  25.5  341   39-405    66-430 (433)
117 1mdo_A ARNB aminotransferase;   99.8   2E-15   9E-20  122.2  25.3  309   55-403    20-385 (393)
118 2eh6_A Acoat, acetylornithine   99.8 2.2E-15 9.7E-20  122.0  25.4  334   37-401    26-375 (375)
119 3i4j_A Aminotransferase, class  99.8 6.3E-15 2.8E-19  118.8  27.1  353   39-404    30-428 (430)
120 2ctz_A O-acetyl-L-homoserine s  99.8   1E-14 4.5E-19  117.4  28.1  286   71-395    50-417 (421)
121 1sff_A 4-aminobutyrate aminotr  99.8 4.5E-15   2E-19  119.8  26.2  346   39-405    42-425 (426)
122 2cb1_A O-acetyl homoserine sul  99.8 1.5E-14 6.9E-19  116.2  28.5  282   69-393    46-404 (412)
123 2po3_A 4-dehydrase; external a  99.8 2.8E-15 1.2E-19  121.2  24.4  321   43-403    21-385 (424)
124 3bv0_A Adenosylmethionine-8-am  99.8 3.1E-15 1.4E-19  120.9  24.3  335   40-405    57-434 (437)
125 2oga_A Transaminase; PLP-depen  99.7 4.5E-15   2E-19  119.9  25.0  310   55-404    44-396 (399)
126 2dgk_A GAD-beta, GADB, glutama  99.7 1.5E-14 6.5E-19  116.4  26.0  340   53-405    54-435 (452)
127 1b9h_A AHBA synthase, protein   99.7 5.4E-14 2.4E-18  112.5  28.9  312   53-403    15-387 (388)
128 1vef_A Acetylornithine/acetyl-  99.7 1.5E-14 6.8E-19  116.2  25.0  324   39-401    46-394 (395)
129 1iug_A Putative aspartate amin  99.7   4E-14 1.8E-18  113.4  26.6  316   54-406    13-350 (352)
130 3dxv_A Alpha-amino-epsilon-cap  99.7 3.9E-14 1.7E-18  113.5  26.3  347   39-406    57-440 (452)
131 3e9k_A Kynureninase; kynurenin  99.7 6.4E-15 2.8E-19  118.8  21.1  318   55-403    81-460 (465)
132 2oat_A Ornithine aminotransfer  99.7 4.5E-14   2E-18  113.0  25.4  338   40-404    78-439 (439)
133 1vjo_A Alanine--glyoxylate ami  99.7 1.3E-14 5.7E-19  116.7  22.1  317   54-401    46-392 (393)
134 2qma_A Diaminobutyrate-pyruvat  99.7 1.1E-13 5.1E-18  110.3  26.6  319   66-404   125-496 (497)
135 3bb8_A CDP-4-keto-6-deoxy-D-gl  99.7 2.6E-14 1.1E-18  114.7  23.0  310   54-402    42-434 (437)
136 3hl2_A O-phosphoseryl-tRNA(SEC  99.7 2.6E-14 1.1E-18  114.7  22.8  308   82-405   117-462 (501)
137 1s0a_A Adenosylmethionine-8-am  99.7   3E-13 1.3E-17  107.5  27.0  341   39-403    44-423 (429)
138 2ch1_A 3-hydroxykynurenine tra  99.7 6.7E-14   3E-18  111.9  23.6  320   54-405    30-384 (396)
139 3fq8_A Glutamate-1-semialdehyd  99.7 1.8E-13 8.2E-18  108.9  25.2  340   39-404    53-427 (427)
140 1js3_A DDC;, DOPA decarboxylas  99.7   1E-12 4.5E-17  103.9  28.8  319   71-406   103-476 (486)
141 1c4k_A Protein (ornithine deca  99.7   3E-13 1.3E-17  107.5  26.0  166   87-263   179-364 (730)
142 2eo5_A 419AA long hypothetical  99.7 3.9E-13 1.7E-17  106.7  26.5  337   39-405    43-419 (419)
143 3i16_A Aluminum resistance pro  99.7 1.1E-14 5.1E-19  117.1  18.6  227   82-332    74-324 (427)
144 1m32_A 2-aminoethylphosphonate  99.7 9.9E-14 4.4E-18  110.7  23.3  294   84-402    40-363 (366)
145 3l44_A Glutamate-1-semialdehyd  99.7 1.4E-13 6.5E-18  109.6  23.8  341   39-405    56-431 (434)
146 3hbx_A GAD 1, glutamate decarb  99.7   3E-13 1.3E-17  107.5  25.3  338   53-405    68-445 (502)
147 2cjg_A L-lysine-epsilon aminot  99.7 8.7E-15 3.9E-19  117.9  17.3  347   40-404    56-448 (449)
148 1qz9_A Kynureninase; kynurenin  99.7 2.5E-14 1.1E-18  114.8  19.5  334   34-403    23-401 (416)
149 3hvy_A Cystathionine beta-lyas  99.7 7.6E-15 3.4E-19  118.3  16.7  230   78-332    75-324 (427)
150 3ecd_A Serine hydroxymethyltra  99.7 3.4E-13 1.5E-17  107.1  24.7  337   39-403    33-396 (425)
151 1zod_A DGD, 2,2-dialkylglycine  99.7 2.2E-12   1E-16  101.6  28.7  349   37-403    41-431 (433)
152 1pff_A Methionine gamma-lyase;  99.7 4.3E-13 1.9E-17  106.4  24.9  215   82-333     3-226 (331)
153 2vyc_A Biodegradative arginine  99.7 4.6E-13   2E-17  106.2  24.9  162   87-256   211-390 (755)
154 1n8p_A Cystathionine gamma-lya  99.6 9.1E-13   4E-17  104.2  26.0  219   70-325    46-274 (393)
155 3k40_A Aromatic-L-amino-acid d  99.6 9.9E-12 4.4E-16   97.2  29.6  322   66-405    98-472 (475)
156 2epj_A Glutamate-1-semialdehyd  99.6 2.8E-13 1.2E-17  107.7  21.3  340   40-404    58-431 (434)
157 3k28_A Glutamate-1-semialdehyd  99.6 2.1E-13 9.1E-18  108.6  20.5  342   39-406    54-429 (429)
158 2cy8_A D-phgat, D-phenylglycin  99.6 5.8E-12 2.6E-16   98.8  27.8  338   40-405    59-436 (453)
159 2vi8_A Serine hydroxymethyltra  99.6 3.4E-13 1.5E-17  107.1  21.3  335   40-402    25-385 (405)
160 2dkj_A Serine hydroxymethyltra  99.6 7.6E-13 3.4E-17  104.7  23.1  337   39-403    24-387 (407)
161 2fnu_A Aminotransferase; prote  99.6 7.2E-13 3.2E-17  104.9  22.3  311   54-405    12-373 (375)
162 3gju_A Putative aminotransfera  99.6 3.4E-11 1.5E-15   93.6  30.4  344   39-404    52-456 (460)
163 3h7f_A Serine hydroxymethyltra  99.6 2.3E-12   1E-16  101.4  23.9  337   39-402    46-412 (447)
164 3dod_A Adenosylmethionine-8-am  99.6 3.7E-12 1.7E-16  100.1  24.7  345   39-406    45-445 (448)
165 3i5t_A Aminotransferase; pyrid  99.6 8.2E-12 3.6E-16   97.7  25.8  344   39-405    55-455 (476)
166 2a7v_A Serine hydroxymethyltra  99.6 1.2E-11 5.4E-16   96.6  26.6  341   40-402    56-439 (490)
167 2e7u_A Glutamate-1-semialdehyd  99.6 2.6E-13 1.1E-17  107.9  17.9  336   39-401    53-424 (424)
168 3ke3_A Putative serine-pyruvat  99.6 2.7E-12 1.2E-16  101.0  21.6  285  102-405    52-377 (379)
169 1rv3_A Serine hydroxymethyltra  99.6 1.9E-11 8.6E-16   95.2  25.1  340   37-402    43-429 (483)
170 1ohv_A 4-aminobutyrate aminotr  99.5 2.6E-12 1.2E-16  101.1  20.3  343   39-405    64-472 (472)
171 2okj_A Glutamate decarboxylase  99.5 1.8E-10   8E-15   88.7  29.2  325   61-404   112-502 (504)
172 3hmu_A Aminotransferase, class  99.5 1.5E-11 6.7E-16   96.0  23.0  343   39-404    56-452 (472)
173 3a8u_X Omega-amino acid--pyruv  99.5 1.1E-11 4.8E-16   97.0  22.0  341   39-405    51-448 (449)
174 1o69_A Aminotransferase; struc  99.5 2.4E-12 1.1E-16  101.4  18.2  309   57-402    14-385 (394)
175 3m5u_A Phosphoserine aminotran  99.5 2.4E-10 1.1E-14   87.8  26.9  327   39-404     5-360 (361)
176 2fyf_A PSAT, phosphoserine ami  99.5 1.8E-11 8.2E-16   95.4  20.4  323   37-404    38-398 (398)
177 2jis_A Cysteine sulfinic acid   99.5 1.1E-09 4.7E-14   83.4  29.1  323   63-403   130-514 (515)
178 1bjn_A PSAT, phosphoserine ami  99.4 1.3E-11 5.9E-16   96.3  16.6  326   41-404     3-359 (360)
179 1w23_A Phosphoserine aminotran  99.3 1.4E-09 6.4E-14   82.6  20.8  325   40-403     4-359 (360)
180 1wyu_A Glycine dehydrogenase (  99.2 1.8E-08 8.1E-13   75.1  22.7  318   44-400    70-436 (438)
181 2c0r_A PSAT, phosphoserine ami  99.2 1.7E-09 7.6E-14   82.0  17.3  323   40-404     5-361 (362)
182 1wyu_B Glycine dehydrogenase s  99.0 2.5E-07 1.1E-11   67.4  21.4  366    4-403    31-440 (474)
183 3e77_A Phosphoserine aminotran  98.7 4.5E-06   2E-10   58.9  19.1  333   41-405    11-376 (377)
184 3gh5_A HEX1, beta-hexosaminida  91.2    0.68   3E-05   23.8   7.8  104   94-215   124-273 (525)
185 2gjx_A Beta-hexosaminidase alp  91.1    0.67   3E-05   23.9   6.9  105   94-216    94-233 (507)
186 1jak_A Beta-N-acetylhexosamini  89.9    0.87 3.9E-05   23.1   7.7  105   94-216   100-249 (512)
187 3m07_A Putative alpha amylase;  86.9     1.3   6E-05   21.8   6.7   36  190-225   195-230 (618)
188 2nu8_A Succinyl-COA ligase [AD  86.0     1.5 6.7E-05   21.5   8.3   87  122-224    38-128 (288)
189 1oi7_A Succinyl-COA synthetase  83.3       2 8.7E-05   20.7   7.7   86  122-223    38-127 (288)
190 3l6e_A Oxidoreductase, short-c  82.3     2.1 9.4E-05   20.5   8.6   95  102-207     4-108 (235)
191 1g94_A Alpha-amylase; beta-alp  81.9     2.2 9.8E-05   20.4   5.4   18   80-99     65-82  (448)
192 3k1d_A 1,4-alpha-glucan-branch  81.8     2.2 9.9E-05   20.3   6.4   36  190-225   305-340 (722)
193 2e8y_A AMYX protein, pullulana  81.0       1 4.5E-05   22.7   3.2   28  197-224   315-342 (718)
194 2bhu_A Maltooligosyltrehalose   80.7     2.4 0.00011   20.1   6.9   35  187-224   185-219 (602)
195 3l55_A B-1,4-endoglucanase/cel  80.2     2.5 0.00011   20.0   6.4   19  139-157    58-76  (353)
196 2yv2_A Succinyl-COA synthetase  79.3     2.7 0.00012   19.8   5.0   78  129-222    53-133 (297)
197 1yht_A DSPB; beta barrel, hydr  79.3     2.1 9.5E-05   20.5   4.4   22  198-219   197-219 (367)
198 1now_A Beta-hexosaminidase bet  78.9     2.7 0.00012   19.7   7.1  105   94-216   100-238 (507)
199 1m7x_A 1,4-alpha-glucan branch  78.6     2.8 0.00012   19.7   6.7   35  191-225   198-232 (617)
200 3czg_A Sucrose hydrolase; (alp  78.5     2.5 0.00011   20.0   4.6   27  196-222   154-180 (644)
201 1hx0_A Alpha amylase (PPA); in  78.0     2.9 0.00013   19.5   5.8   18   80-99     77-94  (496)
202 1h4p_A Glucan 1,3-beta-glucosi  77.1     3.1 0.00014   19.4   6.2   33  334-369   363-395 (408)
203 2yv1_A Succinyl-COA ligase [AD  76.5     3.2 0.00014   19.3   7.5  109   96-221     8-131 (294)
204 1jae_A Alpha-amylase; glycosid  73.6     2.9 0.00013   19.6   3.8   26  197-222    74-99  (471)
205 1c7s_A Beta-N-acetylhexosamini  71.3     4.2 0.00019   18.4   5.2  118   94-216   262-418 (858)
206 1eh9_A Glycosyltrehalose treha  71.0     4.3 0.00019   18.4   8.0   32  193-224   163-194 (558)
207 1bf2_A Isoamylase; hydrolase,   70.4     4.4  0.0002   18.3   4.5   30  196-225   271-300 (750)
208 2vr5_A Glycogen operon protein  70.2     4.5  0.0002   18.3   4.9   29  196-224   265-293 (718)
209 1ua7_A Alpha-amylase; beta-alp  69.3     4.3 0.00019   18.4   3.9   18  200-217    77-94  (422)
210 3dmy_A Protein FDRA; predicted  67.2     4.4 0.00019   18.3   3.6  136   41-184    37-177 (480)
211 1edg_A Endoglucanase A; family  64.5     5.8 0.00026   17.5   6.2   18  138-155    66-83  (380)
212 3cn9_A Carboxylesterase; alpha  62.3     4.6 0.00021   18.2   2.9   22  102-123   116-137 (226)
213 1ud2_A Amylase, alpha-amylase;  61.2     5.4 0.00024   17.7   3.1   10  334-343   402-411 (480)
214 3bh4_A Alpha-amylase; calcium,  61.0     5.7 0.00025   17.6   3.2   25  197-221    78-102 (483)
215 1mxg_A Alpha amylase; hyperthe  59.8     6.8  0.0003   17.0   3.4   23  198-220    87-109 (435)
216 1k2w_A Sorbitol dehydrogenase;  59.6       7 0.00031   17.0   9.5   93  103-206     7-109 (256)
217 2guy_A Alpha-amylase A; (beta-  58.5       7 0.00031   17.0   3.3   27  196-222    96-122 (478)
218 2qlc_A DNA repair protein RADC  57.8     7.5 0.00033   16.8   4.4   49  165-215    53-107 (126)
219 2c07_A 3-oxoacyl-(acyl-carrier  57.7     7.5 0.00034   16.7   9.3  141  101-266    43-196 (285)
220 1hvx_A Alpha-amylase; hydrolas  56.7     7.5 0.00033   16.8   3.2   16   81-98     83-98  (515)
221 3m1a_A Putative dehydrogenase;  56.6     7.8 0.00035   16.6   9.0  139  103-266     6-154 (281)
222 2osx_A Endoglycoceramidase II;  56.5     7.9 0.00035   16.6   6.3   16  201-216   245-262 (481)
223 2ixa_A Alpha-N-acetylgalactosa  55.8     8.1 0.00036   16.5   4.5  105   54-178    54-167 (444)
224 3c7b_A Sulfite reductase, diss  55.7       5 0.00022   18.0   2.2   20  103-122   135-154 (417)
225 3bc9_A AMYB, alpha amylase, ca  55.2     8.2 0.00036   16.5   3.2   26  196-221   207-232 (599)
226 1d3c_A Cyclodextrin glycosyltr  55.1     8.3 0.00037   16.5   3.6   29  195-223   113-141 (686)
227 1ht6_A AMY1, alpha-amylase iso  55.0     8.3 0.00037   16.5   3.4   26  197-222    68-93  (405)
228 1wza_A Alpha-amylase A; hydrol  54.5     8.5 0.00038   16.4   4.5   19   79-99     81-99  (488)
229 2a4k_A 3-oxoacyl-[acyl carrier  54.2     8.6 0.00038   16.4   8.8   93  103-206     8-110 (263)
230 3bmv_A Cyclomaltodextrin gluca  54.2     8.6 0.00038   16.4   3.6   28  196-223   115-142 (683)
231 1ea9_C Cyclomaltodextrinase; h  53.9     8.7 0.00039   16.3   4.4   60  164-223   167-244 (583)
232 1cyg_A Cyclodextrin glucanotra  53.9     8.7 0.00039   16.3   3.2   27  196-222   110-136 (680)
233 2zic_A Dextran glucosidase; TI  53.3     8.9 0.00039   16.3   7.7   16  327-342   465-480 (543)
234 1qho_A Alpha-amylase; glycosid  53.3     8.9 0.00039   16.3   3.2   26  196-221   106-131 (686)
235 3faw_A Reticulocyte binding pr  52.8       9  0.0004   16.2   3.4   29  196-224   368-396 (877)
236 2z1k_A (NEO)pullulanase; hydro  52.3     9.2 0.00041   16.2   3.8   23  198-220    97-119 (475)
237 2p0o_A Hypothetical protein DU  52.0     9.3 0.00041   16.1   3.8   22  191-214   153-174 (372)
238 2dh2_A 4F2 cell-surface antige  51.1     9.6 0.00043   16.0   3.6   17  327-343   334-350 (424)
239 2hmc_A AGR_L_411P, dihydrodipi  50.8     9.7 0.00043   16.0   7.6   36  178-218   151-187 (344)
240 1lwj_A 4-alpha-glucanotransfer  50.5     9.8 0.00044   16.0   3.8   27  196-222    68-94  (441)
241 3grp_A 3-oxoacyl-(acyl carrier  50.4     9.8 0.00044   16.0   8.9  131  103-258    29-169 (266)
242 1wzl_A Alpha-amylase II; pullu  50.4     9.8 0.00044   16.0   6.8   61  163-223   167-245 (585)
243 2wan_A Pullulanase; hydrolase,  49.8      10 0.00045   15.9   3.6   28  197-224   531-558 (921)
244 3h7a_A Short chain dehydrogena  48.7      10 0.00046   15.8  10.2  139  103-266     9-158 (252)
245 1tz9_A Mannonate dehydratase;   48.5      10 0.00047   15.8   4.1   17  199-215   199-215 (367)
246 2csu_A 457AA long hypothetical  47.8     2.4 0.00011   20.1  -0.4   17   53-69     73-89  (457)
247 1g5a_A Amylosucrase; glycosylt  47.3      11 0.00049   15.7   3.2   28  196-223   161-188 (628)
248 3gvc_A Oxidoreductase, probabl  47.1      11 0.00049   15.6   8.5  140  103-267    30-179 (277)
249 3g7s_A Long-chain-fatty-acid--  47.0      11 0.00049   15.6   9.0  111   40-153     4-131 (549)
250 1j0h_A Neopullulanase; beta-al  46.9      11 0.00049   15.6   7.0   61  164-224   171-249 (588)
251 1q7b_A 3-ketoacyl-acyl, 3-oxoa  45.9      11 0.00051   15.5   8.7   93  103-206     7-109 (244)
252 2ffh_A Protein (FFH); SRP54, s  45.7      12 0.00051   15.5   3.9  132   82-220    74-222 (425)
253 3dhu_A Alpha-amylase; structur  45.6      12 0.00051   15.5   4.1   27  196-222    82-108 (449)
254 1gjw_A Maltodextrin glycosyltr  45.5      12 0.00052   15.5   3.4   31  194-224   178-208 (637)
255 1nff_A Putative oxidoreductase  45.1      12 0.00052   15.4   9.0   93  103-206     9-111 (260)
256 3edf_A FSPCMD, cyclomaltodextr  44.8      12 0.00053   15.4   7.3   62  162-223   141-224 (601)
257 3f9i_A 3-oxoacyl-[acyl-carrier  44.4      12 0.00054   15.4   7.4   94  103-206    16-114 (249)
258 2yrx_A Phosphoribosylglycinami  44.3     8.9  0.0004   16.3   2.0   19  387-405   405-423 (451)
259 1i4n_A Indole-3-glycerol phosp  44.1      12 0.00054   15.3   5.6   49  162-216   107-155 (251)
260 1qwg_A PSL synthase;, (2R)-pho  42.9      11  0.0005   15.6   2.3  114   73-216    46-166 (251)
261 3k8k_A Alpha-amylase, SUSG; al  42.9      13 0.00057   15.2   4.2   27  196-222   105-131 (669)
262 2p2s_A Putative oxidoreductase  42.8      13 0.00057   15.2   6.9   20  197-216   103-122 (336)
263 1oft_A SULA, hypothetical prot  42.4      13 0.00058   15.2   7.4  130   75-215    21-156 (161)
264 2v4j_A Sulfite reductase, diss  42.2      13 0.00057   15.2   2.5   41   81-122   113-157 (437)
265 1ceo_A Cellulase CELC; glycosy  41.2      13  0.0006   15.0   5.8   34  183-217   137-172 (343)
266 1hjs_A Beta-1,4-galactanase; 4  41.2      13  0.0006   15.0   4.5   34  189-222    51-84  (332)
267 1h1n_A Endo type cellulase ENG  41.0      14  0.0006   15.0   6.9   27  184-211   131-157 (305)
268 2tps_A Protein (thiamin phosph  41.0      14  0.0006   15.0   4.4   51  168-218    34-85  (227)
269 1wky_A Endo-beta-1,4-mannanase  40.2      14 0.00062   14.9   3.3   34   37-70     52-86  (464)
270 2fp4_A Succinyl-COA ligase [GD  39.1      14 0.00064   14.8   4.3   85  122-221    45-133 (305)
271 2z5l_A Tylkr1, tylactone synth  39.0      15 0.00065   14.8  11.6   17  242-258   384-400 (511)
272 2wc7_A Alpha amylase, catalyti  38.8      15 0.00065   14.8   3.6   15  328-342   406-420 (488)
273 1vjz_A Endoglucanase; TM1752,   38.8      15 0.00065   14.8   6.3   34  184-217   149-188 (341)
274 1a53_A IGPS, indole-3-glycerol  38.6      15 0.00066   14.8   4.1   49  162-216   109-157 (247)
275 1jbq_A Cystathionine beta-synt  37.9      15 0.00067   14.7   9.3   82   73-155   133-216 (435)
276 3hje_A 704AA long hypothetical  37.3      15 0.00069   14.6   5.0   27  334-360   392-428 (704)
277 2epl_X N-acetyl-beta-D-glucosa  37.3      15 0.00069   14.6  10.3   24  197-220   247-271 (627)
278 1g01_A Endoglucanase; alpha/be  36.8      16  0.0007   14.6   4.5   21  198-218    90-110 (364)
279 1xea_A Oxidoreductase, GFO/IDH  36.5      16 0.00071   14.6   3.4   68  102-177    65-138 (323)
280 2fvy_A D-galactose-binding per  36.3      13 0.00056   15.2   1.8   25  192-216   151-175 (309)
281 2fr1_A Erythromycin synthase,   35.8      16 0.00072   14.5  12.4  142  103-274   228-384 (486)
282 2o23_A HADH2 protein; HSD17B10  35.3      17 0.00074   14.4   9.5   93  103-206    14-122 (265)
283 1to3_A Putative aldolase YIHT;  34.9      17 0.00075   14.4   5.0   50  165-216   111-160 (304)
284 3ioy_A Short-chain dehydrogena  34.5      17 0.00076   14.4   8.7  142  103-267    10-169 (319)
285 2ew8_A (S)-1-phenylethanol deh  34.3      17 0.00076   14.3  10.1  139  103-267     9-158 (249)
286 3guy_A Short-chain dehydrogena  31.7      19 0.00084   14.1   8.0   93  104-206     4-102 (230)
287 1p9o_A Phosphopantothenoylcyst  31.6      19 0.00084   14.0   2.6   38   72-112    11-48  (313)
288 1ydw_A AX110P-like protein; st  31.2      19 0.00086   14.0   8.2   27  195-221   106-132 (362)
289 1vl8_A Gluconate 5-dehydrogena  31.1      19 0.00086   14.0  10.5  107   86-206     9-129 (267)
290 3kvo_A Hydroxysteroid dehydrog  31.0      19 0.00086   14.0  10.0   93  103-206    47-159 (346)
291 3gaf_A 7-alpha-hydroxysteroid   30.9      19 0.00086   14.0   8.6  141  102-267    12-164 (256)
292 3e96_A Dihydrodipicolinate syn  30.8      20 0.00087   14.0   6.4   76   56-136    33-118 (316)
293 3kzv_A Uncharacterized oxidore  30.5      20 0.00088   13.9   8.7   93  103-206     4-109 (254)
294 2h3h_A Sugar ABC transporter,   30.5      14 0.00061   15.0   1.2   31  102-132    59-89  (313)
295 2v4j_B Sulfite reductase, diss  28.9      21 0.00093   13.7   1.9   41   81-123    77-120 (381)
296 3edm_A Short chain dehydrogena  28.8      21 0.00094   13.7   8.5   93  103-206    10-117 (259)
297 1iv8_A Maltooligosyl trehalose  28.5      21 0.00095   13.7   3.3   14  347-360   417-430 (720)
298 3bww_A Protein of unknown func  27.8      22 0.00098   13.6   4.9   63  182-248   136-204 (307)
299 7a3h_A Endoglucanase; hydrolas  27.6      22 0.00098   13.6   4.9   11  200-210   155-165 (303)
300 3h5d_A DHDPS, dihydrodipicolin  27.6      22 0.00098   13.6   4.8   35  180-218   136-170 (311)
301 3dz1_A Dihydrodipicolinate syn  27.3      22 0.00099   13.6   7.4  133   56-219    29-172 (313)
302 2ho3_A Oxidoreductase, GFO/IDH  26.5      23   0.001   13.5   5.4   69  102-178    64-138 (325)
303 2an1_A Putative kinase; struct  26.4      23   0.001   13.4   3.2   19  104-122    66-84  (292)
304 3iv3_A Tagatose 1,6-diphosphat  25.1      24  0.0011   13.3   7.6   49  168-216   116-165 (332)
305 3ih1_A Methylisocitrate lyase;  24.8      25  0.0011   13.3   5.3   44  109-152    12-55  (305)
306 3lf2_A Short chain oxidoreduct  24.8      25  0.0011   13.3  10.0  140  103-267     9-163 (265)
307 3bzy_B ESCU; auto cleavage pro  24.0      26  0.0011   13.2   2.3   25  197-221    26-50  (83)
308 1v71_A Serine racemase, hypoth  23.7      26  0.0012   13.1   7.3   52  103-154    76-128 (323)
309 2pc8_A Hypothetical protein XO  23.3      26  0.0012   13.1   6.8   32  335-369   358-389 (400)
310 1edo_A Beta-keto acyl carrier   22.6      27  0.0012   13.0   9.5  130  104-258     4-147 (244)
311 3d0c_A Dihydrodipicolinate syn  22.4      27  0.0012   12.9   7.1   76   56-136    33-118 (314)
312 3imf_A Short chain dehydrogena  22.3      27  0.0012   12.9   9.6   94  103-206     7-113 (257)
313 2vos_A Folylpolyglutamate synt  22.1      28  0.0012   12.9   3.1   19  199-217   241-259 (487)
314 3ftp_A 3-oxoacyl-[acyl-carrier  21.8      28  0.0013   12.9   9.1  140  102-266    28-180 (270)
315 2cfc_A 2-(R)-hydroxypropyl-COM  21.8      28  0.0013   12.9   8.9  137  104-266     5-158 (250)
316 2h1i_A Carboxylesterase; struc  21.6      28  0.0013   12.8   7.5   27   98-125   116-142 (226)
317 1xi3_A Thiamine phosphate pyro  21.6      28  0.0013   12.8   5.0   55  164-220    25-79  (215)
318 3cpr_A Dihydrodipicolinate syn  21.2      29  0.0013   12.8   6.5  128   56-220    37-180 (304)
319 2pqm_A Cysteine synthase; OASS  21.0      29  0.0013   12.8   7.9   79   75-154    52-132 (343)
320 1o6d_A Hypothetical UPF0247 pr  20.9      29  0.0013   12.8   6.0   15  190-204    73-87  (163)
321 1p5j_A L-serine dehydratase; l  20.9      29  0.0013   12.7   6.5  101   77-191    73-176 (372)
322 3cxt_A Dehydrogenase with diff  20.6      30  0.0013   12.7   8.8   93  103-206    36-141 (291)
323 1xky_A Dihydrodipicolinate syn  20.6      30  0.0013   12.7   6.4   36  180-219   140-175 (301)
324 2i5i_A UPF0249 protein EF_3048  20.2      30  0.0014   12.6   7.8   51  165-215   100-156 (263)
325 1yxm_A Pecra, peroxisomal tran  20.1      30  0.0014   12.6   9.8   93  103-206    20-130 (303)
326 3kux_A Putative oxidoreductase  20.0      31  0.0014   12.6   7.2   39  102-141    69-107 (352)

No 1  
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1
Probab=100.00  E-value=0  Score=549.48  Aligned_cols=386  Identities=22%  Similarity=0.385  Sum_probs=345.1

Q ss_pred             CCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCC-CCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             9744688871466661578998878899999630378-983341567867887888999999999980878888788889
Q T0591             1 MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIE-GRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGD   79 (406)
Q Consensus         1 m~i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~   79 (406)
                      |++++|...+...  +...+.+.++.+       ..+ .+.|+|++|+||+.+ ++.+.+++.+++.++ .++|++..|.
T Consensus         1 m~~a~r~~~~~~s--~~~~i~~~a~~~-------~~~G~dvi~l~~G~p~~~~-p~~v~~a~~~a~~~~-~~~Y~~~~G~   69 (388)
T 1j32_A            1 MKLAARVESVSPS--MTLIIDAKAKAM-------KAEGIDVCSFSAGEPDFNT-PKHIVEAAKAALEQG-KTRYGPAAGE   69 (388)
T ss_dssp             CCCCHHHHTSCCC--SSTTTHHHHHHH-------HTTTCCCEECCCSSCSSCC-CHHHHHHHHHHHHTT-CCSCCCTTCC
T ss_pred             CCHHHHHHCCCCC--HHHHHHHHHHHH-------HHCCCCEEECCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCCCCCC
T ss_conf             9552474549957--999999999999-------8779984899999899998-899999999998558-8778999889


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCC
Q ss_conf             88999999999986488678867078824872789999999972001010131055138999998299699986044666
Q T0591            80 LGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSA  159 (406)
Q Consensus        80 ~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~  159 (406)
                      ++||++|++|+.+++|+.+++ ++|++|+|++++|.++++++++|||.|++++|+|+.|...++..|++++.+|++    
T Consensus        70 ~~lR~aia~~~~~~~g~~~~~-e~i~it~G~~~al~~~~~~l~~~gd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~----  144 (388)
T 1j32_A           70 PRLREAIAQKLQRDNGLCYGA-DNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTT----  144 (388)
T ss_dssp             HHHHHHHHHHHHHHHCCCCCG-GGEEEESHHHHHHHHHHHHHCCTTCEEEEESSCCTHHHHHHHHTTCEEEEECCC----
T ss_pred             HHHHHHHHHHHHHHCCCCCCC-CEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCEEEEEECC----
T ss_conf             999999999988741768881-229986878999999999980998989991898387999999849989997245----


Q ss_pred             CCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCC
Q ss_conf             77666778899999850254034215666432334437899999999863787578417502355688876522332102
Q T0591           160 DETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAV  239 (406)
Q Consensus       160 ~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~  239 (406)
                      .+++|.+|++++++.+++++|++++||||||||.+++.+++++|+++|++||++||+||+|+++.|++.++.++......
T Consensus       145 ~e~~~~~d~~~l~~~~~~~~~~~~l~~P~NPTG~~~s~~~~~~l~~~~~~~~~~ii~De~Y~~~~~~~~~~~s~~~~~~~  224 (388)
T 1j32_A          145 VETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAASPE  224 (388)
T ss_dssp             GGGTTCCCHHHHHHHCCTTEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTTTCBCTTCCCCCGGGSCHH
T ss_pred             CCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCEEECCCCCCCCCHHHHCCC
T ss_conf             55566889999997388898399989998987701899999999852110697797203101202589888788895888


Q ss_pred             CCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             67868998504001046311211433258999999987520367612457999999985652589999999999999999
Q T0591           240 DAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELL  319 (406)
Q Consensus       240 ~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~  319 (406)
                      ..+++|+++||||.|++||||+||+++|+++++.+.+.+.....+++.+.|.++..++.+.++++++.+..|+++++.+.
T Consensus       225 ~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~~~~~~~~~~~~~~~~~~~~~~~l~  304 (388)
T 1j32_A          225 AYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYML  304 (388)
T ss_dssp             HHHTEEEEEESTTTTTCTTTCCEEEECCHHHHHHHHHHHHTTTCSCCHHHHHHHHHHHHSCSHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCEEEEECCHHHHHCHHHHEEEEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             67848999776665248275628899889999999887763366787799999999986459999999999999999999


Q ss_pred             HHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHH
Q ss_conf             99972799455358873078776688788989999999986891896161026799985899850997999999999999
Q T0591           320 HVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVT  399 (406)
Q Consensus       320 ~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~  399 (406)
                      +.|++++|+.+..|+||||+|++++..+.++.+|+++|++++||.++||+.||  +++|+|++|+.++|++++|++||++
T Consensus       305 ~~l~~~~~~~~~~p~gg~~~~~~~~~~~~~~~~~~~~ll~~~gV~v~pG~~F~--~~~~iRis~~~~~e~i~~a~~rl~~  382 (388)
T 1j32_A          305 DALNAMPGLECPKPDGAFYMFPSIAKTGRSSLDFCSELLDQHQVATVPGAAFG--ADDCIRLSYATDLDTIKRGMERLEK  382 (388)
T ss_dssp             HHHHTCTTCBCCCCCBTTEECCBCGGGTCCHHHHHHHHHHHHCEECEEGGGGT--CTTBEEEECCSCHHHHHHHHHHHHH
T ss_pred             HHHHHCCCCEECCCCCEEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCC--CCCEEEEEEECCHHHHHHHHHHHHH
T ss_conf             99974799775688835899897888799999999999986999998264359--9996999980899999999999999


Q ss_pred             HHHHH
Q ss_conf             99985
Q T0591           400 LVERY  404 (406)
Q Consensus       400 ~~~~~  404 (406)
                      +++.+
T Consensus       383 ~l~~l  387 (388)
T 1j32_A          383 FLHGI  387 (388)
T ss_dssp             HHHHH
T ss_pred             HHHHH
T ss_conf             99975


No 2  
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg, hyperthermophIle; HET: PLP; 2.33A {Pyrococcus furiosus dsm 3638} SCOP: c.67.1.1
Probab=100.00  E-value=0  Score=507.51  Aligned_cols=356  Identities=22%  Similarity=0.338  Sum_probs=314.5

Q ss_pred             CCCEEECCCCC---CCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHH
Q ss_conf             98334156786---788788899999999998087888878888988999999999986488678867078824872789
Q T0591            38 GRPVDFSHGDV---DAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGAL  114 (406)
Q Consensus        38 ~~~i~ls~G~p---d~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l  114 (406)
                      .+.|+|++|+|   |+ .|++.+.+++.+++.++ .++|++..|.++||++||+|+++++|+++++ ++|++|+|+++++
T Consensus        38 ~~vi~l~~G~P~~~df-~~p~~i~~a~~~a~~~~-~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~~-~~i~~t~G~~~~l  114 (406)
T 1xi9_A           38 IKVIRLNIGDPVKFDF-QPPEHMKEAYCKAIKEG-HNYYGDSEGLPELRKAIVEREKRKNGVDITP-DDVRVTAAVTEAL  114 (406)
T ss_dssp             CCCEECCCCCGGGTTC-CCCHHHHHHHHHHHHTT-CCSCCCTTCCHHHHHHHHHHHHHHHCCCCCG-GGEEEESHHHHHH
T ss_pred             CCEEECCCCCCCCCCC-CCCHHHHHHHHHHHHCC-CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC-CCCEEECCCHHHH
T ss_conf             9608998999997899-99799999999999638-9988998679999999999777635776566-6304512311121


Q ss_pred             HHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCC
Q ss_conf             99999997200101013105513899999829969998604466677666778899999850254034215666432334
Q T0591           115 FLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVV  194 (406)
Q Consensus       115 ~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~  194 (406)
                      ..++.++++|||+|++++|+|+.|...+..+|++++.+++.    ++++|.+|++++++.+++++|++++||||||||.+
T Consensus       115 ~~~~~~~~~~Gd~Vl~~~P~Y~~~~~~~~~~g~~~v~v~~~----~~~~~~~d~~~l~~~~~~~~~~i~l~~P~NPTG~~  190 (406)
T 1xi9_A          115 QLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTI----EEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGAL  190 (406)
T ss_dssp             HHHHHHHCCTTCEEEEEESCCHHHHHHHHHTTCEEEEEEEE----GGGTSEECHHHHHHHCCTTEEEEEEESSCTTTCCC
T ss_pred             HHHHHHHCCCCCEEEECCCCCCCHHHHHHHCCCEEEEEECC----CCCCCCCCHHHHHHHHCCCCCEEEEECCCCCCCHH
T ss_conf             01223203799989982783331077898739767997511----34586657799999742576589981899974512


Q ss_pred             CCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHH--HH---
Q ss_conf             4378999999998637875784175023556888765223321026786899850400104631121143325--89---
Q T0591           195 YSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS--RA---  269 (406)
Q Consensus       195 ~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~--~~---  269 (406)
                      ++.+++++|+++|+++|++||+||+|.++.|++..+++...   ...+++|+++||||.|++||||+||++++  ..   
T Consensus       191 ~s~~~l~~l~~~~~~~~~~ii~De~y~~~~~~~~~~~~~~~---~~~~~vi~~~S~SK~~~~~GlRiG~~~~~~~~~~~~  267 (406)
T 1xi9_A          191 YDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSL---TKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKLS  267 (406)
T ss_dssp             CCHHHHHHHHHHHHHHTCCEEEECTTTTCBSSSCCCCHHHH---CSSSCEEEEEESTTTTCCGGGCCEEEEEECTTCTTH
T ss_pred             HHHHHHHHHHHHHHHCCEEEECCCCHHCCCCCCCCCCHHHC---CCCCCEEEEECCCHHCCCCCCCEECCCCCCHHHHHH
T ss_conf             30899999985442248011123101102333455570211---788888999586032405400004411278799999


Q ss_pred             -HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCC-C
Q ss_conf             -99999987520367612457999999985652589999999999999999999727994553588730787766887-8
Q T0591           270 -IIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL-A  347 (406)
Q Consensus       270 -~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~-~  347 (406)
                       +.+.+..+ .....+++.+.|.++..++...+.|+++.++.++++++.+.+.|.+++++.+..|+||||+|++++.. .
T Consensus       268 ~~~~~~~~~-~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~r~~~l~~~L~~~~~~~~~~p~gg~~l~~~l~~~~~  346 (406)
T 1xi9_A          268 EVREAIDRL-ARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPW  346 (406)
T ss_dssp             HHHHHHHHH-HHHTCCSCSHHHHHHHHHHHSCCHHHHHHHHHHHHHHHHHHHHHHTSTTEECCCCCBSSEECCEECSCSC
T ss_pred             HHHHHHHHH-HCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCEEEEEEEECCCCCC
T ss_conf             999999997-2478788889999999986086999999999999999999999986699410489854798177788899


Q ss_pred             CCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             898999999998689189616102679998589985099799999999999999985
Q T0591           348 VAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       348 ~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      .++.+|+.+|++++||.++||+.||..+++|+||||+.++|++++|++||+++++++
T Consensus       347 ~~~~~~~~~ll~~~gV~v~PG~~Fg~~~~~~iRis~~~~~e~l~~a~~rl~~~l~e~  403 (406)
T 1xi9_A          347 KNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKFMKER  403 (406)
T ss_dssp             SSHHHHHHHHHHHHCEECEEGGGGCGGGTTBEEEECCSCHHHHHHHHHHHHHHHHHC
T ss_pred             CCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999799999847342889989799997389999999999999999998


No 3  
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae}
Probab=100.00  E-value=0  Score=513.66  Aligned_cols=359  Identities=16%  Similarity=0.269  Sum_probs=318.7

Q ss_pred             CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHH
Q ss_conf             83341567867887888999999999980878888788889889999999999864886788670788248727899999
Q T0591            39 RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAV  118 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~  118 (406)
                      +.|+|++|+||+.+ ++.+++++.+++..+..++|++..|.++||++|++|+++++|.++++ ++|++|+|++++|++++
T Consensus        58 ~vi~L~~G~pd~~~-p~~~~~a~~~a~~~~~~~~Y~~~~G~~~lr~aia~~~~~~~g~~~~~-e~I~vt~G~~~al~~~~  135 (447)
T 3b46_A           58 ELINLGQGFFSYSP-PQFAIKEAQKALDIPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKA-ENVTVTTGANEGILSCL  135 (447)
T ss_dssp             CCEECCCCSCSSCC-CHHHHHHHHHHTTSGGGGSCCCTTCCHHHHHHHHHHHTTTTTSCCCG-GGEEEESHHHHHHHHHH
T ss_pred             CEEECCCCCCCCCC-CHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCH-HHEEEECCHHHHHHHHH
T ss_conf             86889999899999-99999999999758877888998476999999999998986889885-43999479999999999


Q ss_pred             HHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCC------CCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9997200101013105513899999829969998604466------6776667788999998502540342156664323
Q T0591           119 AATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVS------ADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAG  192 (406)
Q Consensus       119 ~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~------~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG  192 (406)
                      .++++|||+|++++|+|+.|...++.+|++++.||++...      ...++|++|++++++++++++++++++|||||||
T Consensus       136 ~~l~~pGd~Vlv~~P~y~~~~~~~~~~G~~~v~vpl~~~~~~~~~~~~~~~~~~d~e~le~~i~~~~~~ii~~~p~NPtG  215 (447)
T 3b46_A          136 MGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIG  215 (447)
T ss_dssp             HHHCCTTCEEEEEESCCTTHHHHHHHTTCEEEEEEEECCGGGGTSCBCSTTSEECHHHHHTTCCTTEEEEEEESSCTTTC
T ss_pred             HHHCCCCCEEEECCCCCHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCCCCCC
T ss_conf             99739969899868984899999998099589995675322332234333458799999975236882899689989888


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHH-HHHH
Q ss_conf             344378999999998637875784175023556888765223321026786899850400104631121143325-8999
Q T0591           193 VVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS-RAII  271 (406)
Q Consensus       193 ~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~-~~~i  271 (406)
                      .+++.+++++|+++|++||++||+||+|+++.|++.. .++........+++|+++||||.|++||||+||++++ .+++
T Consensus       216 ~~~~~~~~~~l~~~a~~~~~~vi~De~Y~~l~~~~~~-~~~~~~~~~~~~~~i~~~S~SK~~~~~G~RiG~ii~~~~~~~  294 (447)
T 3b46_A          216 KVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSF-TRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAELL  294 (447)
T ss_dssp             CCCCHHHHHHHHHHHHHTTCEEEEECTTTTCBCSSCC-CCGGGSCHHHHTTEEEEEEHHHHTTCTTSCCEEEECSCHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCCEEEEECHHHHHHCCCCCC-CCHHHHCCCCCEEEEEECCCCCCCCCCCCCCEEEEECCHHHH
T ss_conf             5432999999999752041254200123442148755-312653345521699985574345688622137896689999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCC--
Q ss_conf             99998752036761245799999998565--25899999999999999999997279945535887307877668878--
Q T0591           272 ARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLA--  347 (406)
Q Consensus       272 ~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~--  347 (406)
                      +.+.+.+.....+++++.|.+++.++.+.  ..++++.++.|+++++.+.+.|.++ |+++..|+||||+|+++++..  
T Consensus       295 ~~~~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~r~~~~~r~~~l~~~L~~~-g~~~~~p~gg~~~~~d~~~~~~~  373 (447)
T 3b46_A          295 SYAAKAHTRICFASPSPLQEACANSINDALKIGYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIP  373 (447)
T ss_dssp             HHHHHHHHHHTSSCCHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHH-TCCEECCSBSSEEEEECTTCCCC
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCEEECCCCCEEEEEECCCCCCC
T ss_conf             99999987513578789999999999752254699999999999999999999868-98465588324998866345886


Q ss_pred             ------------CCHHHHHHHHHHHCCEEEEECCCCCC-----CCCCEEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             ------------89899999999868918961610267-----9998589985099799999999999999
Q T0591           348 ------------VAPAEFVKILRLQAGVVVTPGTEFSP-----HTADSVRLNFSQDHEAAVAAARRIVTLV  401 (406)
Q Consensus       348 ------------~~~~~~~~~Ll~~~gV~v~pG~~Fg~-----~~~~~iRis~~~~~e~l~~al~rl~~~~  401 (406)
                                  .++.+|+.+|++++||+++||+.|+.     .+++|||+||+.++|+|++|++||+++-
T Consensus       374 ~~~~~~~~~~~~~~~~~~~~~Ll~e~gV~v~PGs~F~~~~~~~~~~~~iRis~~~~~e~l~~a~~rL~~l~  444 (447)
T 3b46_A          374 EDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKEHEKAAENLLRFAVCKDDAYLENAVERLKLLK  444 (447)
T ss_dssp             TTCCCCGGGSSSCHHHHHHHHHHHHTCEECBCGGGGSCGGGGGGGTTEEEEECCSCHHHHHHHHHHGGGGG
T ss_pred             CCHHHHHHHHCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             31135777612354899999999968999974355167887777799899996598999999999999999


No 4  
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1
Probab=100.00  E-value=0  Score=501.02  Aligned_cols=360  Identities=19%  Similarity=0.282  Sum_probs=309.8

Q ss_pred             CCEEECCCCCCCCCC---CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC------CCCCCCCCEEEEECC
Q ss_conf             833415678678878---88999999999980878888788889889999999999864------886788670788248
Q T0591            39 RPVDFSHGDVDAHEP---TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFT------GAPVDARDGLIITPG  109 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p---~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~------g~~~~~~~~I~it~G  109 (406)
                      ..|+|++|+||+..|   ++.+++++.+++.....++|++..|+++||++||+|+++++      |..+++ ++|++|+|
T Consensus        34 ~vi~l~~G~p~~~~~~~~~~~~~~a~~~~~~~~~~~~Y~~~~G~~~LR~aia~~~~~~~~~~~~~~~~~~~-~~I~it~G  112 (416)
T 1bw0_A           34 PIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVK-DNVVLCSG  112 (416)
T ss_dssp             CCEECCCCCTTTTSCSCCCHHHHHHHHHHHHTTCSSSCCCTTCCHHHHHHHHHHHHHHHCCSTTTGGGCCG-GGEEEESH
T ss_pred             CCEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCC-CCEEECCC
T ss_conf             82688588799999853209999999998628877788998578999999999998744754356888880-41898766


Q ss_pred             CCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             72789999999972001010131055138999998299699986044666776667788999998502540342156664
Q T0591           110 TQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNN  189 (406)
Q Consensus       110 ~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~N  189 (406)
                      ++++|.++++++++|||.|++++|+|+.|...++.+|+++++++++.    +++|.++++++++...+++|++++|||||
T Consensus       113 ~~~al~~~~~~l~~~gd~Vlv~~P~y~~~~~~~~~~g~~~~~~~~~~----~~~~~~~~~~l~~~~~~~~~~~~~~~p~N  188 (416)
T 1bw0_A          113 GSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRP----ENDWEADLDEIRRLKDDKTKLLIVTNPSN  188 (416)
T ss_dssp             HHHHHHHHHHHHCCTTCEEEEEESCCTHHHHHHHHTTCEEEEEEEEG----GGTTEECHHHHHHHCCTTEEEEEEESSCT
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCEEEEECCCC----CCCCCCCHHHHHHHCCCCCCEEEECCCCC
T ss_conf             99999999999728999899804887403666642695667632554----44542259999985045566788689969


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHH--CCCCCCEEEEEECCHHCCCCCCCCHHHHHH
Q ss_conf             323344378999999998637875784175023556888765223321--026786899850400104631121143325
Q T0591           190 PAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEA--AVDAENVVTIMGPSKTESLSGYRLGVAFGS  267 (406)
Q Consensus       190 PTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~--~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~  267 (406)
                      |||.+++.+++++|+++|++|+++||+||+|.+|.|++..+.+.....  .....+++++.|+||.|++||||+||++++
T Consensus       189 PtG~~~~~e~~~~i~~~a~~~~~~ii~De~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~SK~~~~~GlRvG~~v~~  268 (416)
T 1bw0_A          189 PCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYV  268 (416)
T ss_dssp             TTCCCCCHHHHHHHHHHHHHHTCCEEEECTTTTCBCCSSCTTCCCCCTTSSCCSCCEEEEEESTTTTSCGGGCCEEEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEEHHHHHHHCCCCCCCCHHHHHCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEC
T ss_conf             88746409999998756764196477401013330278788714432011234431113457766677786587999953


Q ss_pred             H------HHHHHHHHHHHHCCCCHHHHHHHHHHH-HHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEE
Q ss_conf             8------999999987520367612457999999-985652589999999999999999999727994553588730787
Q T0591           268 R------AIIARMEKLQAIVSLRAAGYSQAVLRG-WFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLF  340 (406)
Q Consensus       268 ~------~~i~~l~~~~~~~~~~~~~~~q~a~~~-~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w  340 (406)
                      +      +++.....+... ..++++..|..+.. +..+.++++.+.++.++++|+.+.+.|.+..|+.+..|+||||+|
T Consensus       269 ~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~yl~  347 (416)
T 1bw0_A          269 DPHGNGPSFLEGLKRVGML-VCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLM  347 (416)
T ss_dssp             CTTCSCHHHHHHHHHHHHH-HTCSCHHHHHHHHHHHHSSCHHHHHHHHHHHHHHHHHHHHHHTTSTTEEECCCCBTTEEE
T ss_pred             CHHHHHHHHHHHHHHHHCC-CCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCEEEEE
T ss_conf             2566678999988764222-347727888889998750222211035689999999999999865895751789515998


Q ss_pred             EECCC----CCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             76688----7889899999999868918961610267999858998509979999999999999998569
Q T0591           341 PRLPK----LAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       341 ~~~~~----~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      ++++.    ...++.+|+++|++++||.++||+.||  +++|+||||+.++|++++|++||+++++||.|
T Consensus       348 ~~~~~~~~~~~~~~~e~~~~ll~~~gV~v~PG~~F~--~~g~~Ris~~~~~e~l~eai~Rl~~~~~r~~a  415 (416)
T 1bw0_A          348 SRIDLEKYRDIKTDVEFFEKLLEEENVQVLPGTIFH--APGFTRLTTTRPVEVYREAVERIKAFCQRHAA  415 (416)
T ss_dssp             EEECGGGBSSCCSHHHHHHHHHHHHCEECEEGGGGT--CTTEEEEECCSCHHHHHHHHHHHHHHHHHHBC
T ss_pred             EECCHHHCCCCCCHHHHHHHHHHHCCEEEEECCCCC--CCCEEEEEECCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             957824447888999999999996999999662148--99949999648999999999999999996279


No 5  
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, lyase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A*
Probab=100.00  E-value=0  Score=504.65  Aligned_cols=365  Identities=24%  Similarity=0.345  Sum_probs=324.3

Q ss_pred             CCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCC-CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             898334156786788788899999999998087-8888788889889999999999864886788670788248727899
Q T0591            37 EGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGG-VQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~-~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      +.+.|+|++|+||+++ ++.+.+++.+++..+. .++|++..|+++||++||+|+++++|.+++|.++|++|+|++++|.
T Consensus        27 ~~dvI~l~~G~pd~~~-p~~v~~a~~~a~~~~~~~~~Y~~~~G~~~lr~aia~~~~~~~g~~~~p~~~I~it~G~~~al~  105 (422)
T 3fvs_A           27 EHDVVNLGQGFPDFPP-PDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALF  105 (422)
T ss_dssp             TSCCEECCCSSCSSCC-CHHHHHHHHHHHHSCGGGGSCCCTTCCHHHHHHHHHHHHHHHTCCCCHHHHEEEESHHHHHHH
T ss_pred             CCCCEECCCCCCCCCC-CHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCHHHH
T ss_conf             9998888898899988-999999999998579744688998678999999999999985899881011664358604530


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCC------CCCCCCCCCHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             9999997200101013105513899999829969998604466------6776667788999998502540342156664
Q T0591           116 LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVS------ADETRAGLDLTGLEEAFKAGARVFLFSNPNN  189 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~------~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~N  189 (406)
                      +++.++++|||.|++++|+|+.|...+...|++++.++++...      ..+++|.+|.+++.+...++++++++|||||
T Consensus       106 ~~~~~l~~~gd~vl~~~p~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~i~l~~p~N  185 (422)
T 3fvs_A          106 TAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNN  185 (422)
T ss_dssp             HHHHHHCCTTCEEEEEESCCTTHHHHHHHTTCEEEEEECBCCCCCSSSCCBGGGSBCCHHHHHTTCCTTEEEEEEESSCT
T ss_pred             CCHHHCCCCCCEEECCCCCCHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCC
T ss_conf             31121047997364045554016899997498750135665422234433112102234431010001344124057776


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHH
Q ss_conf             32334437899999999863787578417502355688876522332102678689985040010463112114332589
Q T0591           190 PAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRA  269 (406)
Q Consensus       190 PTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~  269 (406)
                      |||.+++.+++++|+++|++||++||+||+|+++.|++..+.++.... ...+++|+++||||.|++||+|+||++++++
T Consensus       186 PtG~~~s~~~~~~i~~~a~~~~~~ii~De~Y~~~~~~~~~~~~~~~~~-~~~~~~i~~~S~SK~~~~~GlRvG~~i~~~~  264 (422)
T 3fvs_A          186 PLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLP-GMWERTLTIGSAGKTFSATGWKVGWVLGPDH  264 (422)
T ss_dssp             TTCCCCCHHHHHHHHHHHHHHTCEEEEECTTTTCBCTTCCCCCGGGST-TTGGGEEEEEEHHHHHTCGGGCCEEEECCHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCEEHHHHHHHHHCCCCCCCCHHHCC-CCCCCCEECCCCCCCCCCCCCCEECCCCCCC
T ss_conf             545668999999999998864975222335677615898987853355-6546612325578078899775402124444


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHC-------CCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEE
Q ss_conf             999999875203676124579999999856-------5258999999999999999999972799455358873078776
Q T0591           270 IIARMEKLQAIVSLRAAGYSQAVLRGWFDE-------APGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPR  342 (406)
Q Consensus       270 ~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~-------~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~  342 (406)
                      ++..+..++.....+++++.|.++..++..       ...++...+..++++|+.+.+.|++. |+++..|+||||+|++
T Consensus       265 ~i~~~~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~-g~~~~~p~gg~f~~~~  343 (422)
T 3fvs_A          265 IMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITD  343 (422)
T ss_dssp             HHHHHHHHHHTTTCCCCHHHHHHHHHHHHHHHHTTTCTTCHHHHHHHHHHHHHHHHHHHHHTT-TCEEEBCSBSSEEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHCCHHHHHHHHHH-CCCCCCCCCCEEEEEE
T ss_conf             222223233333233221003678998762223333343322331011000110355555552-2644489832399897


Q ss_pred             CCCC------------CCCHHHHHHHHHHHCCEEEEECCCCCC-----CCCCEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             6887------------889899999999868918961610267-----9998589985099799999999999999985
Q T0591           343 LPKL------------AVAPAEFVKILRLQAGVVVTPGTEFSP-----HTADSVRLNFSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       343 ~~~~------------~~~~~~~~~~Ll~~~gV~v~pG~~Fg~-----~~~~~iRis~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      +++.            ..++.+|+++|++++||.++||+.|+.     .+++|+|+||+.++|++++|++||+++..++
T Consensus       344 ~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~gV~v~PG~~F~~~~~~~~~~~~iRis~~~~~e~l~~a~~rL~~~~~~l  422 (422)
T 3fvs_A          344 ISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL  422 (422)
T ss_dssp             CHHHHHHCCCCCCCTTCCHHHHHHHHHHHHHCEECEEGGGGSCHHHHTTSCSEEEEECCCCHHHHHHHHHHHHHHHHCC
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHC
T ss_conf             7331233200013455535999999999979999984545257877677799799996489999999999999999759


No 6  
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus HB8} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A*
Probab=100.00  E-value=0  Score=501.34  Aligned_cols=378  Identities=24%  Similarity=0.362  Sum_probs=324.3

Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             44688871466661578998878899999630378983341567867887888999999999980878888788889889
Q T0591             3 IEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGI   82 (406)
Q Consensus         3 i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~L   82 (406)
                      ++.|...+  ...+...+.+.++++.  .+    ..+.|+|++|+||+.. +|.+.+++.+++.++ .++|++..|.++|
T Consensus         4 ~s~r~~~~--~ps~~~~i~~~a~~~~--~~----G~~vi~l~~g~p~~~~-p~~i~ea~~~~~~~~-~~~Y~~~~G~~~l   73 (385)
T 1b5p_A            4 LSRRVQAM--KPSATVAVNAKALELR--RQ----GVDLVALTAGEPDFDT-PEHVKEAARRALAQG-KTKYAPPAGIPEL   73 (385)
T ss_dssp             CCHHHHHC--CCCHHHHHHHHHHHHH--HT----TCCCEECCCSSCSSCC-CHHHHHHHHHHHHTT-CCSCCCTTCCHHH
T ss_pred             HHHHHHHC--CCCHHHHHHHHHHHHH--HC----CCCEEECCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCCCCCCHHH
T ss_conf             77998738--9888999999999999--77----9981899999899998-899999999998568-8789999888999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCC
Q ss_conf             99999999986488678867078824872789999999972001010131055138999998299699986044666776
Q T0591            83 RDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADET  162 (406)
Q Consensus        83 r~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~  162 (406)
                      |++|++|+.+++|+.+++ ++|++|+|+++++..+++++++|||.|++++|+|+.|...+..+|+++++++++    +++
T Consensus        74 r~~ia~~~~~~~~~~~~~-~~i~it~G~~~~l~~~~~~l~~~gd~vl~~~P~y~~~~~~~~~~g~~~~~~~~~----~~~  148 (385)
T 1b5p_A           74 REALAEKFRRENGLSVTP-EETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETL----PEE  148 (385)
T ss_dssp             HHHHHHHHHHTTCCCCCG-GGEEEESHHHHHHHHHHHHHCCTTCEEEEEESCCTHHHHHHHHTTCEEEEEECC----GGG
T ss_pred             HHHHHHHHHHCCCCCCCC-CEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCEEEEEECC----CCC
T ss_conf             999987543214545683-318987877999999999957996989986898477999999809878999613----211


Q ss_pred             CCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCC
Q ss_conf             66778899999850254034215666432334437899999999863787578417502355688876522332102678
Q T0591           163 RAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAE  242 (406)
Q Consensus       163 ~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~  242 (406)
                      +|.+|+++++++++++++++++||||||||.++|.+++++|+++|++||++||+||+|.++.|++.+.++...    ..+
T Consensus       149 ~~~~d~~~l~~~~~~~~~~~~i~~P~NPtG~~~s~~~l~~l~~~~~~~~~~ii~De~y~~~~~~~~~~~~~~~----~~~  224 (385)
T 1b5p_A          149 GFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRV----APE  224 (385)
T ss_dssp             TTCCCHHHHHTTCCTTEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTTTCBSSSCCCCGGGT----CTT
T ss_pred             CCCCCHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHCCCCCCCCHHHC----CCC
T ss_conf             4578999999737889769998999897561179999999999999859289996757862279988997781----899


Q ss_pred             CEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC---CHHHHHHHHHHHHHHHHHH
Q ss_conf             6899850400104631121143325899999998752036761245799999998565---2589999999999999999
Q T0591           243 NVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA---PGWMEDRIARHQAIRDELL  319 (406)
Q Consensus       243 ~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~---~~~~~~~~~~~~~~r~~l~  319 (406)
                      ++|+++||||.|++||+|+||+++|+++++.+..++.....+++.+.|.++..++...   ..+..+.+..++++++.+.
T Consensus       225 ~~i~~~s~SK~~~~~GlR~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~  304 (385)
T 1b5p_A          225 HTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLL  304 (385)
T ss_dssp             TEEEEEESTTTTTCGGGCCEEEECCHHHHHHHHHHHHTTTCSCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CEEEEECCHHHCCCHHHHEEEEEECHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             77999564464338185759999899999999999886046896788888888763122005789999999987447788


Q ss_pred             HHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHH
Q ss_conf             99972799455358873078776688788989999999986891896161026799985899850997999999999999
Q T0591           320 HVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVT  399 (406)
Q Consensus       320 ~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~  399 (406)
                      +.+... |+.+..|+||||+|+++++...++.++.+.| .++||+++||+.|+.  ++|+|++|+.++|++++|++||++
T Consensus       305 ~~l~~~-g~~~~~p~gg~f~~~~~~~~~~d~~~~~~~L-~e~gV~v~PG~~F~~--~g~iRis~a~~~e~l~~al~rL~~  380 (385)
T 1b5p_A          305 EGLTAL-GLKAVRPSGAFYVLMDTSPIAPDEVRAAERL-LEAGVAVVPGTDFAA--FGHVRLSYATSEENLRKALERFAR  380 (385)
T ss_dssp             HHHHHH-TCCBCCCSBTTEEEEECTTTCSSHHHHHHHH-HHTTEECEESGGGTC--TTEEEEECCSCHHHHHHHHHHGGG
T ss_pred             HHHCCC-CCEEECCCCEEEEEEECCCCCCCHHHHHHHH-HHCCEEEEECCCCCC--CCEEEEEECCCHHHHHHHHHHHHH
T ss_conf             751147-8557568950799684689999999999999-978979994722589--997999975999999999999999


Q ss_pred             HHHH
Q ss_conf             9998
Q T0591           400 LVER  403 (406)
Q Consensus       400 ~~~~  403 (406)
                      +++|
T Consensus       381 ~L~~  384 (385)
T 1b5p_A          381 VLGR  384 (385)
T ss_dssp             GC--
T ss_pred             HHHC
T ss_conf             9843


No 7  
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus}
Probab=100.00  E-value=0  Score=507.61  Aligned_cols=361  Identities=20%  Similarity=0.317  Sum_probs=324.5

Q ss_pred             CCCCCC-EEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             378983-3415678678878889999999999808788887888898899999999998648867886707882487278
Q T0591            35 PIEGRP-VDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        35 ~~~~~~-i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      ...+.+ |||++|+||+++| +.+.+++.+++..+..++|++..|+++||++||+|+++++|++++++++|++|+|++++
T Consensus        43 ~~~~~~vI~l~~G~p~~p~p-~~i~eal~~a~~~~~~~~Y~~~~G~~~LR~aia~~~~~~~~~~~~~~~~I~it~Gs~~a  121 (404)
T 2o1b_A           43 EHGPLPLINMAVGIPDGPTP-QGIIDHFQKALTIPENQKYGAFHGKEAFKQAIVDFYQRQYNVTLDKEDEVCILYGTKNG  121 (404)
T ss_dssp             CCCSSCCEECCCCSCSSCCC-HHHHHHHHHHTTCHHHHSCCCTTCCHHHHHHHHHHHHHHHCCCCCTTTSEEEESSHHHH
T ss_pred             HCCCCCEEEEECCCCCCCCC-HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCHHHH
T ss_conf             62999779831888999878-99999999997487657889874789999999999998649999965579992698999


Q ss_pred             HHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             99999999720010101310551389999982996999860446667766677889999985025403421566643233
Q T0591           114 LFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGV  193 (406)
Q Consensus       114 l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~  193 (406)
                      |++++.++++|||.|++++|+|+.|...+..+|+++++++++     ++++.+|.++++....+++++++++|||||||.
T Consensus       122 l~~~~~~l~~~gd~Vl~~~P~y~~~~~~~~~~g~~~v~~~~~-----~~~~~~d~~~~~~~~~~~~~~i~~~~p~NPtG~  196 (404)
T 2o1b_A          122 LVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLE-----PPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGS  196 (404)
T ss_dssp             HHHHHHHHCCTTCEEEEEESCCSSHHHHHHHTTCEEEEEECC-----TTTCCCCGGGSCHHHHHHEEEEEECSSCTTTCC
T ss_pred             HHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCEEEEEECC-----CCCCCCCHHHHHHHHCCCCEEEEECCCCCCCCE
T ss_conf             999999972899989985687632578999759789852025-----876667889985320247549997899799871


Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHH
Q ss_conf             44378999999998637875784175023556888765223321026786899850400104631121143325899999
Q T0591           194 VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIAR  273 (406)
Q Consensus       194 ~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~  273 (406)
                      +++.+++++|+++|++++++|++||+|.++.|++..+......  ...+++|+++||||.|++||||+||+++++++++.
T Consensus       197 ~~s~~~~~~l~~~~~~~~~~ii~D~~y~~~~~~~~~~~~~~~~--~~~~~~I~~~S~SK~~~~~G~RiG~~~~~~~~~~~  274 (404)
T 2o1b_A          197 TATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASE--NGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQA  274 (404)
T ss_dssp             CCCHHHHHHHHHHHTTSSCEEEEECTTTTCBSSSCCCCGGGST--THHHHEEEEEESTTTTTCGGGCCEEEEECHHHHHH
T ss_pred             EEECHHHHHHHHHCCCCCCEEEEEEEEECCCCCCCCCCHHHCC--CCCCCEEEEECCCCCCCCCCCCEEEEEEHHHHHHH
T ss_conf             2212133433321145671477653100103478887753335--67687799836855666876752222202156678


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHH
Q ss_conf             99875203676124579999999856525899999999999999999997279945535887307877668878898999
Q T0591           274 MEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEF  353 (406)
Q Consensus       274 l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~  353 (406)
                      +.+++.....+.+...|.+....+...++++++.++.++++|+.+.+.|++. |+.+..|+||||+|+++++ +.++.+|
T Consensus       275 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~-g~~~~~p~gg~f~~~~~~~-~~d~~~~  352 (404)
T 2o1b_A          275 LKKYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPP-GYDSEQF  352 (404)
T ss_dssp             HHHHHHHHCCCCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHT-TCCEECCCBSSEEEEECCT-TCCHHHH
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHC-CCCEECCCCEEEEEEECCC-CCCHHHH
T ss_conf             8876401345775699999998640203567899998998999999999748-9956757942699998999-9899999


Q ss_pred             HHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999986891896161026799985899850997999999999999999856
Q T0591           354 VKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       354 ~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      +++|++++||.++||+.||..+++|+||||+.++|++++|++||++++++||
T Consensus       353 ~~~ll~e~gV~v~PG~~F~~~g~~~iRis~~~~~e~l~~a~~RL~~~~~~y~  404 (404)
T 2o1b_A          353 EQFLVQEKSILVAPGKPFGENGNRYVRISLALDDQKLDEAAIRLTELAYLYE  404 (404)
T ss_dssp             HHHHHHHHCEECEESGGGCGGGTTEEEEECCSCTTHHHHHHHHHHGGGGGGC
T ss_pred             HHHHHHHCCEEEEECHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9999973999999265548899987999971999999999999999999649


No 8  
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransferase); PLP-binding enzyme, lysine biosynthesis, structural genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis H37RV}
Probab=100.00  E-value=0  Score=503.44  Aligned_cols=362  Identities=25%  Similarity=0.341  Sum_probs=327.9

Q ss_pred             CCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             89833415678678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            37 EGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +...|||++|+||+++| +.+.+++.+++.. ..++|++..|.++||++||+|+++++|++++++++|++|+|+++++.+
T Consensus        24 ~~~~I~l~~G~Pd~~~p-~~i~~al~~a~~~-~~~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~~~~I~vt~G~~~~l~~  101 (411)
T 2o0r_A           24 RIGAVNLGQGFPDEDGP-PKMLQAAQDAIAG-GVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAA  101 (411)
T ss_dssp             TTTCEESSCSSCSSCCC-HHHHHHHHHHHHT-TCCSCCCTTCCHHHHHHHHHHHHHHHCCCCCTTTSEEEEEHHHHHHHH
T ss_pred             CCCEEEECCCCCCCCCC-HHHHHHHHHHHHC-CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHH
T ss_conf             79927803989999888-9999999999856-998989997889999999999999858999977779983780999999


Q ss_pred             HHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCC
Q ss_conf             99999720010101310551389999982996999860446667766677889999985025403421566643233443
Q T0591           117 AVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYS  196 (406)
Q Consensus       117 ~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s  196 (406)
                      +++++++|||.|++++|+|+.|...+..+|.+++.++++.   +++.+.+|++++++++++++|++++||||||||.+++
T Consensus       102 ~~~~l~~~gd~Vlv~~P~y~~~~~~~~~~g~~~~~v~~~~---~~~~~~~d~~~l~~~~~~~~~~i~l~nP~NPtG~~~s  178 (411)
T 2o0r_A          102 AVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVP---DGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLS  178 (411)
T ss_dssp             HHHHHCCTTCEEEEEESCCTTHHHHHHHTTCEEEEEECEE---ETTEEECCHHHHHHHCCTTEEEEEEESSCTTTCCCCC
T ss_pred             HHHHHCCCCCEEEECCCCCCCHHHHHHHCCCCCCCCCCCC---CCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCCCCCC
T ss_conf             9997448999799788877306899998499544565563---1246678899999727899749998999598774555


Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             78999999998637875784175023556888765223321026786899850400104631121143325899999998
Q T0591           197 AEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEK  276 (406)
Q Consensus       197 ~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~  276 (406)
                      .+++++|+++|++++++||+||+|.++.+++...++.... ..+.++++++.|+||.+++||+|+||+++++++++.+.+
T Consensus       179 ~~~~~~l~~~~~~~~~~ii~De~y~~~~~~~~~~~~~~~~-~~~~~~~i~~~s~sK~~~~~GlRiG~~~~~~~~~~~~~~  257 (411)
T 2o0r_A          179 ATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGF-DGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRA  257 (411)
T ss_dssp             HHHHHHHHHHHHHTTCEEEEECTTTTCBCTTCCCCCGGGS-TTTGGGEEEEEEHHHHTTCTTTCEEEEECCHHHHHHHHH
T ss_pred             HHHCCCHHHHCCCCEEEEEEECCCCHHCCCCCCCCCHHHH-CCCCCCCCCCCCCCCCCCCCCCCEEHHHCCCHHHHHHHH
T ss_conf             5540211431255425898441210111578777755552-144445444557620246874453644302347999999


Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCC-CCHHHHHH
Q ss_conf             75203676124579999999856525899999999999999999997279945535887307877668878-89899999
Q T0591           277 LQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLA-VAPAEFVK  355 (406)
Q Consensus       277 ~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~-~~~~~~~~  355 (406)
                      .+...+.+++.+.|.+++.++.+.++++++.+..++++|+.+.+.|+++ |+.+..|+||||+|+++...+ .++.+|++
T Consensus       258 ~~~~~~~~~~~~~q~a~~~~l~~~~~~l~~~r~~~~~~r~~l~~~L~~~-g~~~~~p~g~~~~~~~~~~~~~~~~~~~~~  336 (411)
T 2o0r_A          258 AKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRPLGYDDSTEFCA  336 (411)
T ss_dssp             HHHHHTSCCCTTHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHH-TCEECCCCBSSEEEEECGGGTCCCHHHHHH
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHC-CCEEECCCEEEEEEEECCCCCCCCHHHHHH
T ss_conf             9864365554699999999984861779999999999999999988862-978717980699988457789999999999


Q ss_pred             HHHHHCCEEEEECCCCCCCCC-----------CEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             999868918961610267999-----------85899850997999999999999999856
Q T0591           356 ILRLQAGVVVTPGTEFSPHTA-----------DSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       356 ~Ll~~~gV~v~pG~~Fg~~~~-----------~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      +|++++||+++||+.|+..++           +|+||||+.++|++++|++||+++++|+.
T Consensus       337 ~Ll~e~gV~v~PG~~F~~~~~~~~~~~~~~~~~~iRis~~~~~~~l~ea~~rl~~~ler~a  397 (411)
T 2o0r_A          337 ALPEKVGVAAIPMSAFCDPAAGQASQQADVWNHLVRFTFCKRDDTLDEAIRRLSVLAERPA  397 (411)
T ss_dssp             HHHHHHSEECEEGGGGSCCC--------CCGGGCEEEECCSCHHHHHHHHHHHGGGGC---
T ss_pred             HHHHHCCEEEECCHHHCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9998689999724575888777555554567887999964999999999999999985126


No 9  
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C- terminal domain, open alpha-beta structure.; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3
Probab=100.00  E-value=0  Score=496.89  Aligned_cols=381  Identities=16%  Similarity=0.203  Sum_probs=321.4

Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             46888714666615789988788999996303789833415678678878889999999999808788887888898899
Q T0591             4 EAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIR   83 (406)
Q Consensus         4 ~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr   83 (406)
                      ++-+.|.++...++..+...           ....+.|+|++|+||+++ +|.+.+++.+++..+ .++|++..| ++||
T Consensus         5 ~~~~~r~~~~s~kwd~~~~~-----------~~~~dvi~l~igd~df~~-p~~i~~al~~a~~~~-~~~Y~~~~g-~~lr   70 (390)
T 1d2f_A            5 SKVVDRHGTWCTQWDYVADR-----------FGTADLLPFTISDMDFAT-APCIIEALNQRLMHG-VFGYSRWKN-DEFL   70 (390)
T ss_dssp             ------------------------------------CEECCSSSCSSCC-CHHHHHHHHHHHTTC-CCCCCCSCC-HHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHH-----------CCCCCEEECCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCCCCC-HHHH
T ss_conf             98766799984778778876-----------699987872588969999-899999999999679-989989989-8999


Q ss_pred             HHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCC
Q ss_conf             99999999864886788670788248727899999999720010101310551389999982996999860446667766
Q T0591            84 DLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETR  163 (406)
Q Consensus        84 ~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~  163 (406)
                      ++||+|+++++|+++++ ++|++|+|++++|+++++++++|||.|++++|+|+.|...+...|.++++++++.   .+++
T Consensus        71 ~aia~~~~~~~g~~~~~-e~i~vt~G~~~al~~~~~~l~~~gd~vlv~~P~y~~~~~~~~~~g~~~v~v~~~~---~~~~  146 (390)
T 1d2f_A           71 AAIAHWFSTQHYTAIDS-QTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEK---QADG  146 (390)
T ss_dssp             HHHHHHHHHHSCCCCCG-GGEEEESCHHHHHHHHHHHSSCTTCEEEEEESCCHHHHHHHHHTTCEEEEEECEE---CSSS
T ss_pred             HHHHHHHHHHHCCCCCH-HEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHCCCEEEEECCCC---CCCC
T ss_conf             99999999986889882-1399874499999999999808998788668885025899997187588400136---7887


Q ss_pred             CCCCHHHHHHHHC-CCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCC
Q ss_conf             6778899999850-254034215666432334437899999999863787578417502355688876522332102678
Q T0591           164 AGLDLTGLEEAFK-AGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAE  242 (406)
Q Consensus       164 ~~~d~~~l~~~~~-~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~  242 (406)
                      |.+|++++++.++ +++|++++||||||||.++|.+++++|+++|+++|++||+||+|.+|.|++...+++...   ..+
T Consensus       147 ~~~d~~~~~~~~~~~~~k~i~l~~P~NPTG~v~s~~~l~~l~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~---~~~  223 (390)
T 1d2f_A          147 WFCDMGKLEAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNV---ARG  223 (390)
T ss_dssp             EECCHHHHHHHHTSTTEEEEEEESSCTTTCCCCCTTHHHHHHHHHHHTTCEEEEECTTTTCBCSSSCCCCGGGT---CCS
T ss_pred             CCCCHHHHHHHHCCCCCEEEEECCCCCCCCEECCHHHHHHHHHCCCCCEEEEEEECCCCEEECCCCCCCHHHHH---HCC
T ss_conf             65798999998617896699989987987665069999986420000223676305533000057764514442---014


Q ss_pred             CEEEEEECCHHCCCCCCCCHHHHHH-HH-HHHHHHHHHHHCCCCHHH-HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             6899850400104631121143325-89-999999875203676124-57999999985652589999999999999999
Q T0591           243 NVVTIMGPSKTESLSGYRLGVAFGS-RA-IIARMEKLQAIVSLRAAG-YSQAVLRGWFDEAPGWMEDRIARHQAIRDELL  319 (406)
Q Consensus       243 ~~i~~~S~SK~~~~~GlRiG~~~~~-~~-~i~~l~~~~~~~~~~~~~-~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~  319 (406)
                      +++++.|+||.|++||+|+||++.+ +. ....+..++.....+.+. ..|.++..++...+.+.++.++.++++++.+.
T Consensus       224 ~~i~~~s~SK~~~~~GlR~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~  303 (390)
T 1d2f_A          224 DWALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIA  303 (390)
T ss_dssp             SEEEEECSHHHHTCGGGCCEEEEECSHHHHHHHHHHHHTTSCCCSCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHH
T ss_pred             CEEEECCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             31430466655565756530278528689999999876504677753899999999873441122235677999999999


Q ss_pred             HHHHH-CCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHH
Q ss_conf             99972-79945535887307877668878898999999998689189616102679998589985099799999999999
Q T0591           320 HVLRG-CEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIV  398 (406)
Q Consensus       320 ~~L~~-~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~  398 (406)
                      +.|.. ++++.+..|+||||+|+++++.+.++.+|+++|++++||+++||+.||..+++|+||||+.++|++++|++||+
T Consensus       304 ~~l~~~~~~~~~~~p~gg~~~~~~l~~~~~d~~~~~~~ll~~~gV~v~PG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~  383 (390)
T 1d2f_A          304 DKMNAAFPELNWQIPQSTYLAWLDLRPLNIDDNALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGVAGLI  383 (390)
T ss_dssp             HHHHHHCSSCCCCCCSBCSEEEEECGGGCCCHHHHHHHHHHTTCEECEEGGGGCGGGTTEEEEECCSCHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECHHHCCCCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             99996489872635884139989777899999999999998699999836231889998799997388999999999999


Q ss_pred             HHHHHHC
Q ss_conf             9999856
Q T0591           399 TLVERYR  405 (406)
Q Consensus       399 ~~~~~~r  405 (406)
                      ++++++|
T Consensus       384 ~~l~~lr  390 (390)
T 1d2f_A          384 NAIRAVR  390 (390)
T ss_dssp             HHHHHHC
T ss_pred             HHHHHCC
T ss_conf             9999639


No 10 
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A*
Probab=100.00  E-value=0  Score=497.73  Aligned_cols=360  Identities=21%  Similarity=0.316  Sum_probs=322.4

Q ss_pred             CCEEECCCCCCCCCCCHHHHHHHHHHHHCCC--CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             8334156786788788899999999998087--88887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGG--VQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~--~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      ..|||++|+||+.+ ++.+++++.+++.+..  .++|++..|.++||++||+|+++++|++++|.++|++|+|++++|.+
T Consensus        38 ~~I~L~~G~Pd~~~-p~~v~~a~~~a~~~~~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~~p~~~I~it~G~~~al~~  116 (429)
T 1yiz_A           38 KPLNLGQGFPDYHA-PKYALNALAAAANSPDPLANQYTRGFGHPRLVQALSKLYSQLVDRTINPMTEVLVTVGAYEALYA  116 (429)
T ss_dssp             CCEECCSSSCSSCC-CHHHHHHHHHHHTCSCGGGGSCCCSSCCHHHHHHHHHHHHHHHTSCCCTTTSEEEESHHHHHHHH
T ss_pred             CCEECCCCCCCCCC-CHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHEEEECCCCCHHHCC
T ss_conf             96876687998988-99999999999838996676899997899999999998899849988814608986787154223


Q ss_pred             HHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCC----CCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9999972001010131055138999998299699986044666----776667788999998502540342156664323
Q T0591           117 AVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSA----DETRAGLDLTGLEEAFKAGARVFLFSNPNNPAG  192 (406)
Q Consensus       117 ~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~----~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG  192 (406)
                      +++++++|||.|++++|+|+.|...+...|++++.++++....    ++..|.++.+++.+...++++++++||||||||
T Consensus       117 ~~~~l~~~gd~vl~~~P~y~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~p~NPtG  196 (429)
T 1yiz_A          117 TIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTISSADWVLDNNELEALFNEKTKMIIINTPHNPLG  196 (429)
T ss_dssp             HHHHHCCTTCEEEEEESCCTTHHHHHHHTTCEEEEEECBCCCSSSSEEGGGCBCCHHHHHHHCCTTEEEEEEESSCTTTC
T ss_pred             CHHHHCCCCCCEEECCCCCCCHHHHHHHCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCC
T ss_conf             01320023320110123342036789863977999872035566630566666658876555403554221165022454


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHH
Q ss_conf             34437899999999863787578417502355688876522332102678689985040010463112114332589999
Q T0591           193 VVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIA  272 (406)
Q Consensus       193 ~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~  272 (406)
                      .+++.+++++|+++|++++++||+||+|.++.|++.+..++.... ...+++|+++|+||.+++||+|+||+++++++++
T Consensus       197 ~~~s~e~~~~l~~~~~~~~i~ii~De~y~~~~~~~~~~~~~~~~~-~~~~~~i~~~S~SK~~~~~GlRvG~~~~~~~~i~  275 (429)
T 1yiz_A          197 KVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLP-GMWERTITIGSAGKTFSLTGWKIGWAYGPEALLK  275 (429)
T ss_dssp             CCCCHHHHHHHHHHHHHHTCEEEEECTTTTCBCTTSCCCCGGGST-TTGGGEEEEEEHHHHHTCGGGCCEEEESCHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCC-CCCCEEECCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             331388888887640201335124544444330134553001576-5554021121577531688775453223202444


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHH-------CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCC
Q ss_conf             99987520367612457999999985-------65258999999999999999999972799455358873078776688
Q T0591           273 RMEKLQAIVSLRAAGYSQAVLRGWFD-------EAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPK  345 (406)
Q Consensus       273 ~l~~~~~~~~~~~~~~~q~a~~~~l~-------~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~  345 (406)
                      .+.+.+.....+++++.|.+++.++.       ..+.++++.+..|+++|+.+.+.|++. |+.+..|+||||+|+++++
T Consensus       276 ~~~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~-g~~~~~p~gg~fl~~~~~~  354 (429)
T 1yiz_A          276 NLQMVHQNCVYTCATPIQEAIAVGFETELKRLKSPECYFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSS  354 (429)
T ss_dssp             HHHHHHHTTTCCCCHHHHHHHHHHHHHHHTTTTSTTSHHHHHHHHHHHHHHHHHHHHHHH-TCEEEECSBSSEEEEECCS
T ss_pred             HHHHCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCEEEEEEECCC
T ss_conf             443102223244554566541003322333333301356778899999888888889973-9813479930399886244


Q ss_pred             C-----------CCCHHHHHHHHHHHCCEEEEECCCCCCC-----CCCEEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             7-----------8898999999998689189616102679-----998589985099799999999999999
Q T0591           346 L-----------AVAPAEFVKILRLQAGVVVTPGTEFSPH-----TADSVRLNFSQDHEAAVAAARRIVTLV  401 (406)
Q Consensus       346 ~-----------~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~-----~~~~iRis~~~~~e~l~~al~rl~~~~  401 (406)
                      .           ..++.+|+.+|++++||.++||+.|+..     +++|+|+||+.++|++++|++||++++
T Consensus       355 ~~~~~~~~~~~~~~~~~~~~~~ll~~~gV~v~PGs~F~~~~~~~~g~~~iRi~~~~~~e~l~~a~~rl~~~~  426 (429)
T 1yiz_A          355 LDSKVDLTQETDARKDYRFTKWMTKSVGLQGIPPSAFYSEPNKHLGEDFVRYCFFKKDENLQKAAEILRKWK  426 (429)
T ss_dssp             SCTTTTCCSSSSSCHHHHHHHHHHHHTSEECBCGGGGSCGGGGGGTTTEEEEECCSCHHHHHHHHHHHHHHS
T ss_pred             CCCCCCCHHHCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             664111012034467899999999978999977356488877667899899996489999999999999987


No 11 
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalanine catabolism; HET: PLP; 2.30A {Homo sapiens}
Probab=100.00  E-value=0  Score=495.24  Aligned_cols=356  Identities=22%  Similarity=0.301  Sum_probs=312.1

Q ss_pred             CCEEECCCCCCC---CCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             833415678678---87888999999999980878888788889889999999999864886788670788248727899
Q T0591            39 RPVDFSHGDVDA---HEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        39 ~~i~ls~G~pd~---~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      ..|+|++|+|+.   ..|+|.+.+++.+++.++..++|++..|.++||++||+|++++ +.++++ ++|++|+|++++|.
T Consensus        55 ~iI~l~~G~P~~~~d~~~~~~v~~a~~~a~~~~~~~~Y~~~~G~~~lR~aia~~~~~~-~~~~~~-~~I~it~G~~~al~  132 (427)
T 3dyd_A           55 TMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCP-EAPLEA-KDVILTSGCSQAID  132 (427)
T ss_dssp             CCEECCCSCTTTTSSSCCCHHHHHHHHHHHHHCCSSSCCCTTCCHHHHHHHHHHHCBT-TBCCCG-GGEEEESSHHHHHH
T ss_pred             CEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCCCCH-HHEEEECCHHHHHH
T ss_conf             8578948888987899999999999999973898788899867099999999997343-899884-34999489999999


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCC
Q ss_conf             99999972001010131055138999998299699986044666776667788999998502540342156664323344
Q T0591           116 LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVY  195 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~  195 (406)
                      ++++++++|||+|++++|+|+.|...++.+|++++.++++    ++++|.+|++++++.+++++|+++++|||||||.++
T Consensus       133 ~~~~~l~~pGd~Vlv~~P~y~~~~~~~~~~G~~~~~~~~~----~~~~~~~d~~~l~~~~~~~~~~iil~~p~NPtG~~~  208 (427)
T 3dyd_A          133 LCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLL----PEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVF  208 (427)
T ss_dssp             HHHHHHCCTTCEEEEEESCCTHHHHHHHHTTCEEEEEEEE----GGGTTEECHHHHHSSCCTTEEEEEEESSCTTTCCCC
T ss_pred             HHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCEEEEEECC----CCCCCCCCHHHHHHHHCCCCEEEEECCCCCCCCCCC
T ss_conf             9999967896989991897389999999839857885156----666767699999974225825886268889877433


Q ss_pred             CHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHH-------
Q ss_conf             3789999999986378757841750235568887652233210267868998504001046311211433258-------
Q T0591           196 SAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSR-------  268 (406)
Q Consensus       196 s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~-------  268 (406)
                      +.+++++|+++|++||++||+||+|++|.|++..++++....  ..+++|+++||||.|++||||+||+++++       
T Consensus       209 s~~~l~~i~~la~~~~~~iI~De~y~~~~~~~~~~~~~~~~~--~~~~vi~~~s~SK~~~~~G~R~G~~~~~~~~~~~~~  286 (427)
T 3dyd_A          209 SKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLS--TDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGN  286 (427)
T ss_dssp             CHHHHHHHHHHHHHTTCCEEEECTTTTCBCSSCCCCCGGGGC--SSCCEEEEEESTTTSSCGGGCCEEEEEECSTTSSHH
T ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHEEEECCCCCCCCHHHHC--CCCCCCEEECCCCCCCCCCCCEEEEEECCHHHHHHH
T ss_conf             078899999987521565001322111112898767078743--346741782365565683508599997547888899


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCC--
Q ss_conf             999999987520367612457999999985-65258999999999999999999972799455358873078776688--
Q T0591           269 AIIARMEKLQAIVSLRAAGYSQAVLRGWFD-EAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPK--  345 (406)
Q Consensus       269 ~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~-~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~--  345 (406)
                      .+...+.++... ..+++.+.|.++..++. ...+++++.++.++++|+.+.+.|++++|+++..|+||||+|++++.  
T Consensus       287 ~~~~~~~~~~~~-~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~~r~~~~~~L~~~~g~~~~~P~g~~~~~~~i~~~~  365 (427)
T 3dyd_A          287 EIRDGLVKLSQR-ILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEH  365 (427)
T ss_dssp             HHHHHHHHHHHH-HCCSCHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHSTTEEEECCSBTTEEEEEECGGG
T ss_pred             HHHHHHHHHHHC-CCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCC
T ss_conf             999999998642-2687469999999998658199999999999999999999997389967706897359988677444


Q ss_pred             --CCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             --788989999999986891896161026799985899850997999999999999999856
Q T0591           346 --LAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       346 --~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                        ...++.+|+++|++++||.++||+.|+  +++|+|+||+.++|++++|++||++++++|-
T Consensus       366 ~~~~~~~~~~~~~ll~~~gV~v~PG~~F~--~~~~iRis~~~~~e~l~eal~rl~~~~~~~~  425 (427)
T 3dyd_A          366 FPEFENDVEFTERLVAEQSVHCLPATCFE--YPNFIRVVITVPEVMMLEACSRIQEFCEQHY  425 (427)
T ss_dssp             CTTCSSHHHHHHHHHHHHCEECEEGGGGT--CTTEEEEESCSCHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCCCCHHHHHHHHHHHCCEEEEECCCCC--CCCEEEEEECCCHHHHHHHHHHHHHHHHHCC
T ss_conf             78888999999999996999998177579--9897999964899999999999999999706


No 12 
>3kax_A Aminotransferase, classes I and II; PLP, C-S lyase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: LLP MSE PLP; 1.70A {Bacillus anthracis str}
Probab=100.00  E-value=0  Score=494.23  Aligned_cols=376  Identities=16%  Similarity=0.256  Sum_probs=321.7

Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             44688871466661578998878899999630378983341567867887888999999999980878888788889889
Q T0591             3 IEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGI   82 (406)
Q Consensus         3 i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~L   82 (406)
                      +++.+.|.++...++.               .....+.|.|++|++|+++| +.+.+++.+++.+ +.++|+  .|.++|
T Consensus         4 f~~~~~r~~~~s~kw~---------------~~~~~dvi~l~v~d~Df~~p-~~i~~al~~~~~~-~~~gY~--~g~~~L   64 (383)
T 3kax_A            4 FHKTVNRRGTHSIKWD---------------TYKNEELIHAWIADMDFEVP-QPIQTALKKRIEH-PIFGYT--LPPENI   64 (383)
T ss_dssp             ---------------C---------------CCSSSCCEECCCSSCSSCCC-HHHHHHHHHHHHS-CCCCCC--CCCTTH
T ss_pred             CCCCCCCCCCCCHHHH---------------HCCCCCCEECCCCCCCCCCC-HHHHHHHHHHHHC-CCCCCC--CCCHHH
T ss_conf             7986666999856551---------------05899806588879899988-9999999999968-896898--996899


Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCC
Q ss_conf             99999999986488678867078824872789999999972001010131055138999998299699986044666776
Q T0591            83 RDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADET  162 (406)
Q Consensus        83 r~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~  162 (406)
                      |++||+|+++++|+++++ ++|++|+|++++|.+++.++++|||.|++++|+|+.|...+...|+..+.++++.   +++
T Consensus        65 R~aia~~~~~~~g~~~~~-~~I~it~G~~~al~~~~~~l~~pGd~vlv~~p~y~~~~~~~~~~g~~~~~~~~~~---~~~  140 (383)
T 3kax_A           65 GDIICNWTKKQYNWDIQK-EWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQK---QND  140 (383)
T ss_dssp             HHHHHHHHHHHHCCCCCG-GGEEEESCHHHHHHHHHHHHCCTTCEEEECSSCCHHHHHHHHHTTCEEEECCCEE---ETT
T ss_pred             HHHHHHHHHHHCCCCCCC-CEEEEECCCCHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCCEECCC---CCC
T ss_conf             999999999970999997-7899936863267899987623354266226677608899988630331000011---110


Q ss_pred             CCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCC
Q ss_conf             66778899999850254034215666432334437899999999863787578417502355688876522332102678
Q T0591           163 RAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAE  242 (406)
Q Consensus       163 ~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~  242 (406)
                      +|.+|++.+++.++++++++++||||||||.++|.+++++|+++|++|+++||+||+|.++.|++...+++........+
T Consensus       141 ~~~~~~~~l~~~~~~~~~~i~~~~P~NPTG~v~s~e~~~~l~~~a~~~~i~ii~De~Y~~~~~~~~~~~~~~~~~~~~~~  220 (383)
T 3kax_A          141 TYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLSEELAA  220 (383)
T ss_dssp             EEECCHHHHHHHHTTTCCEEEEESSBTTTTBCCCHHHHHHHHHHHHHHTCEEEEECTTTTCBCTTCCCCCGGGSCHHHHT
T ss_pred             CCCCCHHHHHHHHCCCCCEEEECCCCCCCCCEEEHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             23235999753431323136632565665411107764444312456245599977644434589877873111234542


Q ss_pred             CEEEEEECCHHCCCCCCCCHHHHHHH-HHHHHHHHHHHHCCCCHHHHHH-HHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998504001046311211433258-9999999875203676124579-999999856525899999999999999999
Q T0591           243 NVVTIMGPSKTESLSGYRLGVAFGSR-AIIARMEKLQAIVSLRAAGYSQ-AVLRGWFDEAPGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       243 ~~i~~~S~SK~~~~~GlRiG~~~~~~-~~i~~l~~~~~~~~~~~~~~~q-~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      ++|+++||||.|++||+|+||++++. .+.+.+..++.....+.+...| .++..++.+...++.+.+..++++++.+.+
T Consensus       221 ~~i~~~S~SK~~~~~G~R~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~  300 (383)
T 3kax_A          221 RTITCMAPSKTFNIAGLQASIIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACE  300 (383)
T ss_dssp             TEEEEECSHHHHTCGGGCCEEEECCCHHHHHHHHHHHHHTTCCCCCHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             17998505455666632322100111344455677764124343322025778887640322344556666688999999


Q ss_pred             HHHH-CCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHH
Q ss_conf             9972-799455358873078776688788989999999986891896161026799985899850997999999999999
Q T0591           321 VLRG-CEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVT  399 (406)
Q Consensus       321 ~L~~-~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~  399 (406)
                      .+.. .+++.+..|+||||+|+++++.+.++.++++.|++++||++.||+.||..+++|+||||+.+++++++|++||++
T Consensus       301 ~~~~~~~~~~~~~p~gg~f~w~~~~~~~~~~~~~~~~L~e~~~V~v~PG~~Fg~~~~~~iRis~a~~~e~l~eal~RL~~  380 (383)
T 3kax_A          301 YIKDHIPTLSVMKPEGSFLLWIDCSALNLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRH  380 (383)
T ss_dssp             HHHHHCTTCEECCCSBSSEEEEECGGGCCCHHHHHHHHHHTSCEECEESGGGCTTCTTEEEEECSSCHHHHHHHHHHHHH
T ss_pred             HHHCCCCCCEEECCCEEEEEEEECCCCCCCHHHHHHHHHHCCCEEEECCHHHCCCCCCEEEEEECCCHHHHHHHHHHHHH
T ss_conf             86344787167068805799998888899999999999974999997665428899996999973899999999999999


Q ss_pred             HH
Q ss_conf             99
Q T0591           400 LV  401 (406)
Q Consensus       400 ~~  401 (406)
                      ++
T Consensus       381 ~f  382 (383)
T 3kax_A          381 TF  382 (383)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             85


No 13 
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S lyase; YP_813084.1, structural genomics, joint center for structural genomics; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp}
Probab=100.00  E-value=0  Score=492.69  Aligned_cols=361  Identities=18%  Similarity=0.236  Sum_probs=310.8

Q ss_pred             CCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             89833415678678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            37 EGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      .++.|.|++|++|++. +|.+.+++.+++..+ .++|++  |.++||++||+|+++++|+++++ ++|++|+|+++++.+
T Consensus        26 ~~~~i~~~v~d~dfp~-p~~v~~al~~~~~~~-~~gY~~--~~~elReaia~~~~~~~g~~~~~-e~I~it~G~~~al~~  100 (391)
T 3dzz_A           26 KEKELPMWIAEMDFKI-APEIMASMEEKLKVA-AFGYES--VPAEYYKAVADWEEIEHRARPKE-DWCVFASGVVPAISA  100 (391)
T ss_dssp             CTTCEECCSSCCSSCC-CHHHHHHHHHHHTTC-CCCCBC--CCHHHHHHHHHHHHHHHSCCCCG-GGEEEESCHHHHHHH
T ss_pred             CCCEECCCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCC--CCHHHHHHHHHHHHHHHCCCCCC-CEEEECCCHHHHHHH
T ss_conf             9884305777889999-999999999998579-979789--59899999999999986899994-769988889999999


Q ss_pred             HHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHH-HCCCCEEEECCCCCCCCCCCC
Q ss_conf             9999972001010131055138999998299699986044666776667788999998-502540342156664323344
Q T0591           117 AVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEA-FKAGARVFLFSNPNNPAGVVY  195 (406)
Q Consensus       117 ~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~-~~~~~k~i~l~~P~NPTG~~~  195 (406)
                      +++++++|||.|++++|+|+.|...+..+|.++++++++.+   .++|.+|.+++++. .++++|++++||||||||.++
T Consensus       101 ~~~~l~~pgd~vlv~~P~y~~~~~~~~~~g~~~v~~~~~~e---~~~~~~~~~~~~~~~~~~~~~~i~l~nP~NPTG~~~  177 (391)
T 3dzz_A          101 MVRQFTSPGDQILVQEPVYNMFYSVIEGNGRRVISSDLIYE---NSKYSVNWADLEEKLATPSVRMMVFCNPHNPIGYAW  177 (391)
T ss_dssp             HHHHHSCTTCEEEECSSCCHHHHHHHHHTTCEEEECCCEEE---TTEEECCHHHHHHHHTSTTEEEEEEESSBTTTTBCC
T ss_pred             HHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEEECCC---CCCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCCCC
T ss_conf             99995799898998278717789999861773254321477---888889999999971789966999789969877654


Q ss_pred             CHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHH-
Q ss_conf             3789999999986378757841750235568887652233210267868998504001046311211433258999999-
Q T0591           196 SAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARM-  274 (406)
Q Consensus       196 s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l-  274 (406)
                      |.+++++|+++|++|+++||+||+|.++.|++.++.+.........+++|+++|+||.|++||+|+||++++...+... 
T Consensus       178 s~e~~~~l~~~~~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~s~SK~~~~~G~RiG~~~~~~~~~~~~~  257 (391)
T 3dzz_A          178 SEEEVKRIAELCAKHQVLLISDEIHGDLVLTDEDITPAFTVDWDAKNWVVSLISPSKTFNLAALHAACAIIPNPDLRARA  257 (391)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEECTTTTCBCSSCCCCCGGGSCTTTGGGEEEEECSHHHHTCTTTCCEEEECCSHHHHHHH
T ss_pred             CHHHHHHHHHHHHHCEEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCEEEECCCCCHHHHCCCCEEEEEECCCHHHHHHH
T ss_conf             18999999999886607999943643210258766706654312432045404673031101131689980869999998


Q ss_pred             HHHHHHCCC-CHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH-HHCCCCEEECCCCCEEEEEECCCCCCCHHH
Q ss_conf             987520367-612457999999985652589999999999999999999-727994553588730787766887889899
Q T0591           275 EKLQAIVSL-RAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVL-RGCEGVFARTPQAGSYLFPRLPKLAVAPAE  352 (406)
Q Consensus       275 ~~~~~~~~~-~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L-~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~  352 (406)
                      ......... +++...|.++..++++...+.++.++.++++++.+.+.+ ...+++.+..|+||||+|++++..+.++.+
T Consensus       258 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~gg~~~~~~l~~~~~~~~~  337 (391)
T 3dzz_A          258 EESFFLAGIGEPNLLAIPAAIAAYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEVKVLDSNASYLAWVDISALGMNAED  337 (391)
T ss_dssp             HHHHHHHTCSSCCTTHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHCTTSEECCCCBSSEEEEECGGGCSCHHH
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCEEEEEECCCCCCCHHH
T ss_conf             64222036875578999999999750256789999999999999999753337884682689724999978888989999


Q ss_pred             HHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999986891896161026799985899850997999999999999999856
Q T0591           353 FVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       353 ~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      |+++|++++||+++||+.|+..+++|+||||+.++|++++|++||++++++++
T Consensus       338 ~~~~Ll~~~gV~v~pG~~F~~~~~~~iRis~~~~~e~l~eal~rl~~~l~~l~  390 (391)
T 3dzz_A          338 FCKYLREKTGLIISAGNGYRGNGHEFVRINLACPKELVIDGMQRLKQGVLNLN  390 (391)
T ss_dssp             HHHHHHHHHCEECEESGGGCTTGGGEEEEECCSCHHHHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHCCEEEECCHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99999984999996642218899997999970899999999999999999736


No 14 
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, alternative splicing, aminotransferase, lyase; HET: GLN PMP; 2.26A {Mus musculus} PDB: 2zjg_A* 3e2f_A* 3e2z_A*
Probab=100.00  E-value=0  Score=491.61  Aligned_cols=362  Identities=21%  Similarity=0.307  Sum_probs=323.2

Q ss_pred             CCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             78983341567867887888999999999980878888788889889999999999864886788670788248727899
Q T0591            36 IEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        36 ~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      .++..|+|++|+||+.+ ++.+.+++.+++.....++|++..|.++||++||+|+++++|.+++++++|++|+|++++|.
T Consensus        21 ~~~~~I~L~~G~P~~~~-~~~v~~a~~~~a~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~~~~~~~~~~I~it~G~~~al~   99 (410)
T 3e2y_A           21 ADPSVVNLGQGFPDISP-PSYVKEELSKAAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLF   99 (410)
T ss_dssp             TSTTSEECSSCCCCSCC-CHHHHHHHHHHHTCGGGGSCCCTTCCHHHHHHHHHHHHHHHTSCCCTTTSEEEESHHHHHHH
T ss_pred             CCCCCEECCCCCCCCCC-CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHH
T ss_conf             89995887288899977-99999999999717687888999789999999999999996899998766999178699999


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCC-----CCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             999999720010101310551389999982996999860446-----667766677889999985025403421566643
Q T0591           116 LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYV-----SADETRAGLDLTGLEEAFKAGARVFLFSNPNNP  190 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~-----~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NP  190 (406)
                      ++++++++|||.|++++|+|+.|...+..+|.+++.||++..     ....+.+..|++++++.+++++++++++|||||
T Consensus       100 ~~~~~l~~~gd~v~~~~p~y~~~~~~~~~~g~~~v~vp~~~~~~~~~~~~~~~~~~d~~~l~~~~~~~~~~~~l~~p~NP  179 (410)
T 3e2y_A          100 NSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKTKAIILNTPHNP  179 (410)
T ss_dssp             HHHHHHCCTTCEEEEEESCCTTHHHHHHHTTCEEEEEECEECCCCSSCCBGGGEECCHHHHHTTCCTTEEEEEEESSCTT
T ss_pred             HHHHHHHCCCCEEEEECCCCCCHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCCCC
T ss_conf             99999838897487622555117899997276479814543443333455534468999999754568866874899598


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHH
Q ss_conf             23344378999999998637875784175023556888765223321026786899850400104631121143325899
Q T0591           191 AGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAI  270 (406)
Q Consensus       191 TG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~  270 (406)
                      ||.+++.+++++|+++|++|+++||+||+|.++.|++...+++.... ...++++++.|+||.+++||+|+||+++++++
T Consensus       180 tG~~~s~~~~~~i~~~a~~~~~~ii~De~y~~~~~~~~~~~~~~~~~-~~~~~~i~~~s~SK~~~~~G~RiG~~v~~~~~  258 (410)
T 3e2y_A          180 LGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLP-GMWERTITIGSAGKTFSVTGWKLGWSIGPAHL  258 (410)
T ss_dssp             TCCCCCHHHHHHHHHHHHHHTCEEEEECTTTTCBCTTCCCCCGGGST-TCGGGEEEEEEHHHHSSCGGGCCEEEECCHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCCCHHHCC-CCCCCEECCCCCCCCCCCCCEEEECCHHHHHH
T ss_conf             77564099999999999986981202124655533885435375544-43452010345765345662553520315899


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHH-------CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEEC
Q ss_conf             9999987520367612457999999985-------652589999999999999999999727994553588730787766
Q T0591           271 IARMEKLQAIVSLRAAGYSQAVLRGWFD-------EAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRL  343 (406)
Q Consensus       271 i~~l~~~~~~~~~~~~~~~q~a~~~~l~-------~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~  343 (406)
                      ++.+.+++.....+++++.|.+++.++.       +.+.++.+.+++|+++++.+.+.|+++ |+++..|+||||+|+++
T Consensus       259 i~~~~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~~~~~~~r~~~l~~~L~~~-g~~~~~P~gg~fiw~~l  337 (410)
T 3e2y_A          259 IKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADV  337 (410)
T ss_dssp             HHHHHHHHHTTTCCCCHHHHHHHHHHHHHHHTTTTSTTSHHHHHHHHHHHHHHHHHHHHHTT-TCEEEBCSBSSEEEEEC
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCEEECCCCCEEEEEEC
T ss_conf             99999998750256898999999999998788875313678999999999988999999867-96763688011997988


Q ss_pred             CCCC----------CCHHHHHHHHHHHCCEEEEECCCCCCCC-----CCEEEEEECCCHHHHHHHHHHHHHH
Q ss_conf             8878----------8989999999986891896161026799-----9858998509979999999999999
Q T0591           344 PKLA----------VAPAEFVKILRLQAGVVVTPGTEFSPHT-----ADSVRLNFSQDHEAAVAAARRIVTL  400 (406)
Q Consensus       344 ~~~~----------~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~-----~~~iRis~~~~~e~l~~al~rl~~~  400 (406)
                      +..+          .++.+|+++|++++||+|+||+.|+...     ++|+||||+.++|++++|++||+.+
T Consensus       338 ~~~~~~~~~~~~~~~~~~~f~~~ll~~~gV~v~PG~~F~~~~~~~~~~~~iRls~a~~~e~l~~a~~~l~a~  409 (410)
T 3e2y_A          338 SSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDSTLDAAEEIFRAW  409 (410)
T ss_dssp             GGGCCCCTTCCSSCCHHHHHHHHHHHHHSEECEEGGGGSCTTTHHHHTTEEEEECCCCHHHHHHHHHHHHTC
T ss_pred             CCCCCCHHHCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHH
T ss_conf             122676011024445699999999996999998064546788877879979999659999999999999851


No 15 
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; NP_940074.1, structural genomics, joint center for structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae}
Probab=100.00  E-value=0  Score=492.02  Aligned_cols=353  Identities=20%  Similarity=0.278  Sum_probs=313.1

Q ss_pred             CCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             89833415678678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            37 EGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      ..+.|+|++|+||+++ +|.+.+++.+++.+ +.++|++..|.  ||++||+|+++++|+++++ ++|++|+|++++|.+
T Consensus        22 ~~~ii~l~igd~df~~-p~~v~~al~~~~~~-~~~gY~~~~g~--Lr~aia~~~~~~~g~~~~~-~~I~it~G~~~al~~   96 (377)
T 3fdb_A           22 GQGVLPLWVAESDFST-CPAVLQAITDAVQR-EAFGYQPDGSL--LSQATAEFYADRYGYQARP-EWIFPIPDVVRGLYI   96 (377)
T ss_dssp             CTTSEECCSSCCCSCC-CHHHHHHHHHHHHT-TCCSSCCSSCC--HHHHHHHHHHHHHCCCCCG-GGEEEESCHHHHHHH
T ss_pred             CCCEEEECCCCCCCCC-CHHHHHHHHHHHHC-CCCCCCCCCCH--HHHHHHHHHHHHCCCCCCC-CEEEECCCHHHHHHH
T ss_conf             9982751137989987-89999999999867-99789998409--9999999999872999996-557752540344424


Q ss_pred             HHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCC
Q ss_conf             99999720010101310551389999982996999860446667766677889999985025403421566643233443
Q T0591           117 AVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYS  196 (406)
Q Consensus       117 ~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s  196 (406)
                      +++++++|||+|++++|+|+.|...++..|.+.++++.+        +++|++++++++++++|+++++|||||||.++|
T Consensus        97 ~~~~l~~~gd~Vl~~~P~y~~~~~~~~~~g~~~~~v~~~--------~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~v~s  168 (377)
T 3fdb_A           97 AIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT--------GGINLHDVEKGFQAGARSILLCNPYNPLGMVFA  168 (377)
T ss_dssp             HHHHHSCTTCCEEEEESCCTHHHHHHHHHTCCEEEEECT--------TSCCHHHHHHHHHTTCCEEEEESSBTTTTBCCC
T ss_pred             HHHHCCCCCCCCCCCHHHCCHHHHHHHHCCCCCCCCCCC--------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEH
T ss_conf             443024543323210100001233332101232111222--------455531000122334331012235574430312


Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHH-HHHHHHHHH
Q ss_conf             7899999999863787578417502355688876522332102678689985040010463112114332-589999999
Q T0591           197 AEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFG-SRAIIARME  275 (406)
Q Consensus       197 ~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~-~~~~i~~l~  275 (406)
                      .+++++|+++|++++++||+||+|.++.|++..+++.... ....+++|+++||||.|+++|||+||++. ++.++..+.
T Consensus       169 ~~~~~~l~~~~~~~~~~ii~De~Y~~~~~~~~~~~~~~~~-~~~~~~~i~~~s~SK~~~~~G~R~G~~~~~~~~~~~~~~  247 (377)
T 3fdb_A          169 PEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTVAAGVS-DTAASVCITITAPSKAWNIAGLKCAQIIFSNPSDAEHWQ  247 (377)
T ss_dssp             HHHHHHHHHHHHHTTCEEEEECTTGGGBSSSCCCCGGGSC-HHHHHHEEEEECSTTTTTCGGGCCEEEECCSHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCEECCCCCCCCCCCCCCCCCCCCCHHHHHHCC
T ss_conf             5443233202233455420403444323443322111222-222333321024554444554332223453011111011


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH-HHCCCCEEECCCCCEEEEEECCCCCCCHHHHH
Q ss_conf             87520367612457999999985652589999999999999999999-72799455358873078776688788989999
Q T0591           276 KLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVL-RGCEGVFARTPQAGSYLFPRLPKLAVAPAEFV  354 (406)
Q Consensus       276 ~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L-~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~  354 (406)
                      ++......+++.+.|.++..++...+.+..+.+..++++|+.+.+.+ +...|+++..|+||||+|+++++.. ++.+++
T Consensus       248 ~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~r~~l~~~~~~~~~g~~~~~~~g~~~~~~~~~~~~-~~~~~~  326 (377)
T 3fdb_A          248 QLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKRIPGAKITPMQATYLMWIDFRDTT-IEGSPS  326 (377)
T ss_dssp             HSCHHHHCCCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHSTTCEECCCSBCSEEEEECTTSC-CCSCHH
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEECCCCCEEEEEEECCCCC-CCHHHH
T ss_conf             3221112321102267899986402122233322221023332012322344425417981589999788888-868999


Q ss_pred             HHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99998689189616102679998589985099799999999999999985
Q T0591           355 KILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       355 ~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      +.|++++||.++||+.||..+++|+|+||+.++|++++|++||++++++|
T Consensus       327 ~~ll~~~gV~v~pG~~Fg~~~~~~iRls~~~~~e~l~~al~rL~~~l~~~  376 (377)
T 3fdb_A          327 EFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAKAVSHH  376 (377)
T ss_dssp             HHHHHHHCEECEEGGGGCGGGTTEEEEECCSCHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHCCEEEECCHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHC
T ss_conf             99998599999766443889988699997189999999999999999865


No 16 
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence of substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A*
Probab=100.00  E-value=0  Score=482.74  Aligned_cols=385  Identities=21%  Similarity=0.349  Sum_probs=337.0

Q ss_pred             CCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCH
Q ss_conf             97446888714666615789988788999996303789833415678678878889999999999808788887888898
Q T0591             1 MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDL   80 (406)
Q Consensus         1 m~i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~   80 (406)
                      |..++|+++..     ..+++    ++..+.++   .++.|||++|+|++++ ++.+.+++.+++..+ .++|++..|.+
T Consensus         1 ~~~~~~~~~~~-----~~~i~----~~~~~~~~---~~~vI~l~~g~p~~~~-p~~v~~a~~~~~~~~-~~~Y~~~~G~~   66 (389)
T 1gd9_A            1 MALSDRLELVS-----ASEIR----KLFDIAAG---MKDVISLGIGEPDFDT-PQHIKEYAKEALDKG-LTHYGPNIGLL   66 (389)
T ss_dssp             -CHHHHHHHSC-----CCHHH----HHHHHHHT---CSSCEECCCCSCSSCC-CHHHHHHHHHHHHTT-CCSCCCTTCCH
T ss_pred             CCHHHHHHHCC-----CCHHH----HHHHHHHC---CCCCEECCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCCCCCCH
T ss_conf             96404421189-----65899----99999867---9993899998899987-899999999998468-87999986799


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCC
Q ss_conf             89999999999864886788670788248727899999999720010101310551389999982996999860446667
Q T0591            81 GIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSAD  160 (406)
Q Consensus        81 ~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~  160 (406)
                      +||++||+|++.+++..+.++++|++|+|+++++.+++.+++++||.|++++|+|+.|...++..|+.++.++++    +
T Consensus        67 ~lr~aia~~~~~~~~~~~~~~~~i~~~~g~~~~~~~~~~~~~~~gd~vl~~~P~y~~~~~~~~~~g~~~v~~~~~----~  142 (389)
T 1gd9_A           67 ELREAIAEKLKKQNGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTY----E  142 (389)
T ss_dssp             HHHHHHHHHHHHHHCCCCCTTTSEEEESSTTHHHHHHHTTTCCTTCEEEEEESCCTTHHHHHHHHTCEEEEEECC----G
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEECCCHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHCCCEEEEEECC----C
T ss_conf             999999999998729988983269984858999999999841499989805886047899999849989996345----0


Q ss_pred             CCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCC
Q ss_conf             76667788999998502540342156664323344378999999998637875784175023556888765223321026
Q T0591           161 ETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVD  240 (406)
Q Consensus       161 ~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~  240 (406)
                      ++++.+|++.+++..++++|++++||||||||.++|.+++++|+++|++|+++||.||+|.++.+++.....+... ...
T Consensus       143 ~~~~~~~~~~l~~~~~~~~~~i~l~~p~NPtG~~~s~~~~~~i~~~~~~~~i~vidD~~~~~~~~~~~~~~~~~~~-~~~  221 (389)
T 1gd9_A          143 EDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASL-DGM  221 (389)
T ss_dssp             GGTTCCCHHHHHHHCCTTEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTTTCBCTTCCCCCGGGS-TTC
T ss_pred             CCCCCCCHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEHHHHHHHHCCCCCCCCHHHH-CCC
T ss_conf             0154457999962468784899978999987826789999999988877698995045443220256677656764-488


Q ss_pred             CCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHH
Q ss_conf             786899850400104631121143325899999998752036761245799999998565--258999999999999999
Q T0591           241 AENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDEL  318 (406)
Q Consensus       241 ~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l  318 (406)
                      .+++|+++||||.|++||+|+||++++++++..+...+.....+.+...|.+++..+.+.  .+++++.+..++++++.+
T Consensus       222 ~~~~i~~~S~SK~~~~~G~R~G~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (389)
T 1gd9_A          222 FERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLV  301 (389)
T ss_dssp             GGGEEEEEESTTTTTCGGGCCEEEECCHHHHHHHHHHHTTTTCSCCHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             88879997775024442422105566666666666655302321015899999999867742489999999999999999


Q ss_pred             HHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHH
Q ss_conf             99997279945535887307877668878898999999998689189616102679998589985099799999999999
Q T0591           319 LHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIV  398 (406)
Q Consensus       319 ~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~  398 (406)
                      .+.|... ++.+..|+||+|+|+++++.+.++.+++++|++++||.++||+.||..+++|+|+||+.++|++++|++||+
T Consensus       302 ~~~l~~~-~~~~~~p~g~~~~~~~~~~~~~~~~~~~~~ll~e~gV~v~pG~~Fg~~~~~~iRis~~~~~e~i~~a~~rl~  380 (389)
T 1gd9_A          302 WKRLNEM-GLPTVKPKGAFYIFPRIRDTGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAMDRME  380 (389)
T ss_dssp             HHHHHHT-TCCCCCCCBTTEECCBCGGGTCCHHHHHHHHHHHTCEECEEGGGGCGGGTTBEEEECCSCHHHHHHHHHHHH
T ss_pred             HHHHHCC-CCCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECHHHCCCCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             9997411-356538996069999888889999999999998599999833330889999799997288999999999999


Q ss_pred             HHHHHHC
Q ss_conf             9999856
Q T0591           399 TLVERYR  405 (406)
Q Consensus       399 ~~~~~~r  405 (406)
                      ++++++|
T Consensus       381 ~~l~e~k  387 (389)
T 1gd9_A          381 RVLKERK  387 (389)
T ss_dssp             HHHHHTT
T ss_pred             HHHHHCC
T ss_conf             9999778


No 17 
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A*
Probab=100.00  E-value=0  Score=490.39  Aligned_cols=383  Identities=17%  Similarity=0.213  Sum_probs=317.2

Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCC-CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             6888714666615789988788999996303789-833415678678878889999999999808788887888898899
Q T0591             5 AKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEG-RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIR   83 (406)
Q Consensus         5 ~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr   83 (406)
                      ++.+|.++...++          +.+....+..+ +.|+|++|+||+++| +.+++++.+++.++ .++|+  .|.++||
T Consensus         7 ~~~~r~~~~s~kw----------~~~~~~~~~~g~~vi~l~ig~pdf~~p-~~v~~al~~~~~~~-~~~Y~--~g~~~lR   72 (399)
T 1c7n_A            7 TKISRKNLGSLKW----------DLMYSQNPEVGNEVVPLSVADMEFKNP-PELIEGLKKYLDET-VLGYT--GPTEEYK   72 (399)
T ss_dssp             CCCCCTTTTBHHH----------HHHHHHCTTCCTTCCCCCSSSCSSCCC-HHHHHHHHHHHHHC-CCSSB--CCCHHHH
T ss_pred             CCCCCCCCCCHHH----------HHHHHHHHHCCCCEEEEECCCCCCCCC-HHHHHHHHHHHHCC-CCCCC--CCCHHHH
T ss_conf             8777899977769----------999987675499868830789899988-99999999998589-86899--9879999


Q ss_pred             HHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCC
Q ss_conf             99999999864886788670788248727899999999720010101310551389999982996999860446667766
Q T0591            84 DLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETR  163 (406)
Q Consensus        84 ~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~  163 (406)
                      ++||+|+++++|+++++ ++|++|+|+++++.++++++++|||.|++++|+|+.|...+..+|.+.+.++...   .+..
T Consensus        73 ~aia~~~~~~~g~~~~~-~~I~it~G~~~al~~~~~a~~~~gd~vlv~~p~~~~~~~~~~~~~~~~v~~~~~~---~~~~  148 (399)
T 1c7n_A           73 KTVKKWMKDRHQWDIQT-DWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELLE---KDGY  148 (399)
T ss_dssp             HHHHHHHHHHHCCCCCG-GGEEEESSHHHHHHHHHHHHCCTTCEEEECSSCCTHHHHHHHTTTCEEEECCCEE---ETTE
T ss_pred             HHHHHHHHHHHCCCCCC-CEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHCCCEEEECCCC---CCCC
T ss_conf             99999999984899992-5599868889999999999827897799970563358999997178136520455---4444


Q ss_pred             CCCCHHHHHHHH-CCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCC
Q ss_conf             677889999985-0254034215666432334437899999999863787578417502355688876522332102678
Q T0591           164 AGLDLTGLEEAF-KAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAE  242 (406)
Q Consensus       164 ~~~d~~~l~~~~-~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~  242 (406)
                      +.+|.+.++... .+++|++++||||||||.++|.+++++|+++|++||++||+||+|.+|.|++...++.........+
T Consensus       149 ~~~~~~~~~~~~~~~~~k~i~l~~P~NPTG~v~s~e~~~~i~~~a~~~~~~iI~De~Y~~l~~~~~~~~~~~~~~~~~~~  228 (399)
T 1c7n_A          149 YTIDFQKLEKLSKDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHTVFQSIDEQLAD  228 (399)
T ss_dssp             EECCHHHHHHHHTCTTEEEEEEESSBTTTTBCCCHHHHHHHHHHHHHSSCEEEEECTTTTCBCTTCCCCCGGGSCHHHHT
T ss_pred             CCCCHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCCEEEEECCCCCCEEEECCCCCCCHHHCCCCCCC
T ss_conf             57789999997128896599979997997800879999987504455236886134532033037887732220455541


Q ss_pred             CEEEEEECCHHCCCCCCCCHHHHHHHH-HHHHHHHHHHHCCCCHHHHHH-HHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             689985040010463112114332589-999999875203676124579-999999856525899999999999999999
Q T0591           243 NVVTIMGPSKTESLSGYRLGVAFGSRA-IIARMEKLQAIVSLRAAGYSQ-AVLRGWFDEAPGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       243 ~~i~~~S~SK~~~~~GlRiG~~~~~~~-~i~~l~~~~~~~~~~~~~~~q-~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      +++++.|+||.|++||||+||++++++ +.+.+.+.+.....++....+ .++.......+.+..+.++.++++++.+.+
T Consensus       229 ~~i~~~S~SK~~~~~G~RiG~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~  308 (399)
T 1c7n_A          229 KTITFTAPSKTFNIAGMGMSNIIIKNPDIRERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKD  308 (399)
T ss_dssp             TEEEEECSHHHHTCGGGCCEEEECCCHHHHHHHHHHHHHTTCCCCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCCEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             36854676433006775634641680999999999840102332102689999997643022100024678899999999


Q ss_pred             HHHH-CCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHH
Q ss_conf             9972-799455358873078776688788989999999986891896161026799985899850997999999999999
Q T0591           321 VLRG-CEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVT  399 (406)
Q Consensus       321 ~L~~-~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~  399 (406)
                      .|.. ..++.+..|+||||+|+++++...++.+|+.+|++++||++.||+.||..+++|+|+||+.++|++++|++||++
T Consensus       309 ~l~~~~~~~~~~~p~g~~~~~~~~~~~~~~~~~~~~~ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~eal~ri~~  388 (399)
T 1c7n_A          309 FFEVNHPEIKAPLIEGTYLQWIDFRALKMDHKAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAAPSSVIQESLERLNK  388 (399)
T ss_dssp             HHHHHCTTSBCCCCSBSSEEEEECGGGCCCHHHHHHHHHHTTCCCCEEGGGGCGGGTTEEEEECCSCHHHHHHHHHHHHH
T ss_pred             HHHHCCCCEEEECCCCEEEEEEECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEEEECCHHHHHHHHHHHHH
T ss_conf             99850997034078852589897778899999999999986999996523428899987999982899999999999999


Q ss_pred             HHHHHC
Q ss_conf             999856
Q T0591           400 LVERYR  405 (406)
Q Consensus       400 ~~~~~r  405 (406)
                      +++++|
T Consensus       389 ~l~~lk  394 (399)
T 1c7n_A          389 ALKDLK  394 (399)
T ss_dssp             HHHHHC
T ss_pred             HHHHHH
T ss_conf             999988


No 18 
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1
Probab=100.00  E-value=0  Score=479.02  Aligned_cols=353  Identities=20%  Similarity=0.315  Sum_probs=317.4

Q ss_pred             CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHH
Q ss_conf             83341567867887888999999999980878888788889889999999999864886788670788248727899999
Q T0591            39 RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAV  118 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~  118 (406)
                      ..|||++|+||+++ ++.+.+++.+++.++ .++|++..|.++||++||+|+++++|++++++++|++|+|+++++.+++
T Consensus        31 ~~i~L~~G~Pd~~~-p~~l~~al~~~~~~~-~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~~~~~I~it~G~~~al~~~~  108 (386)
T 1u08_A           31 QAINLSQGFPDFDG-PRYLQERLAHHVAQG-ANQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEALYAAI  108 (386)
T ss_dssp             TCEECCCSSCSSCC-CHHHHHHHHHHHHTT-CCSCCCTTCCHHHHHHHHHHHHHHHSCCCCTTTTEEEESSHHHHHHHHH
T ss_pred             CCEECCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHH
T ss_conf             97886488899977-899999999998549-9889898788999999999999972999998776998266167788998


Q ss_pred             HHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHH
Q ss_conf             99972001010131055138999998299699986044666776667788999998502540342156664323344378
Q T0591           119 AATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAE  198 (406)
Q Consensus       119 ~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~  198 (406)
                      +++++|||.|+++.|+|+.+.......+...+.++++     ++++.+|++++++..++++|++++||||||||++++.+
T Consensus       109 ~~l~~~gd~vl~~~p~y~~~~~~~~~~~~~~~~~~~~-----~~~~~~d~~~l~~~~~~~~~~i~l~~P~NPtG~~~~~~  183 (386)
T 1u08_A          109 TALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ-----PPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQA  183 (386)
T ss_dssp             HHHCCTTCEEEEEESCCTTHHHHHHHTTCEEEEEECC-----TTTCCCCHHHHHHHCCTTEEEEEEESSCTTTCCCCCHH
T ss_pred             HHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCC-----CCCCCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCC
T ss_conf             8762468559860354301567887641223333321-----32246899997322125731899878987885455542


Q ss_pred             HHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999863787578417502355688876522332102678689985040010463112114332589999999875
Q T0591           199 EIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQ  278 (406)
Q Consensus       199 ~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~  278 (406)
                      ++++|+++|++++++++.|+.|..+.+++......... ....+++|++.|+||.+++||+|+||+++|+++++++...+
T Consensus       184 ~~~~l~~~~~~~~~~ii~d~~~~~~~~~~~~~~~~~~~-~~~~~~~i~~~s~SK~~~~~GlRiG~~v~p~~~~~~~~~~~  262 (386)
T 1u08_A          184 DFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAH-PQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVH  262 (386)
T ss_dssp             HHHHHHHHHTTSCCEEEEECTTTTCBCCSSCCCCGGGS-HHHHTTEEEEEEHHHHTTCGGGCCEEEECCHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCEEEEECCHHHCCCCCCCCCCCCCC-CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             12333221034432024302202102433455432234-54567438974145654577665322023304678887520


Q ss_pred             HHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCC-CCCHHHHHHHH
Q ss_conf             20367612457999999985652589999999999999999999727994553588730787766887-88989999999
Q T0591           279 AIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL-AVAPAEFVKIL  357 (406)
Q Consensus       279 ~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~-~~~~~~~~~~L  357 (406)
                      ...+++++.+.|.++..++.++++++.+.++.++++|+.+.+.+.+ .|+++..|+||||+|++++.. ..++.+|+++|
T Consensus       263 ~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~~~~l~~~l~~-~g~~~~~p~Gg~~lwv~~~~~~~~~~~~~~~~l  341 (386)
T 1u08_A          263 QYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNE-SRLEILPCEGTYFLLVDYSAVSTLDDVEFCQWL  341 (386)
T ss_dssp             HHHTSSCCHHHHHHHHHHHHHCTHHHHTHHHHHHHHHHHHHHHTTS-SSCEECCCCBSSEEEEECTTTCCSCHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-CCCEEECCCCEEEEEEECCCCCCCCHHHHHHHH
T ss_conf             2232345643332233222230677778999876533667888876-386683689457998956888999999999999


Q ss_pred             HHHCCEEEEECCCCCCC--CCCEEEEEECCCHHHHHHHHHHHHHH
Q ss_conf             98689189616102679--99858998509979999999999999
Q T0591           358 RLQAGVVVTPGTEFSPH--TADSVRLNFSQDHEAAVAAARRIVTL  400 (406)
Q Consensus       358 l~~~gV~v~pG~~Fg~~--~~~~iRis~~~~~e~l~~al~rl~~~  400 (406)
                      ++++||.++||+.||..  +++|+|+||+.++|+++||++||+++
T Consensus       342 l~e~gV~v~PG~~Fg~~~~~~~~iRls~a~~~e~l~eai~Rl~~l  386 (386)
T 1u08_A          342 TQEHGVAAIPLSVFCADPFPHKLIRLCFAKKESTLLAAAERLRQL  386 (386)
T ss_dssp             HHHSCEECEEGGGGCSSCCCSCEEEEECCSCHHHHHHHHHHHTTC
T ss_pred             HHHCCEEEECCHHHCCCCCCCCEEEEEECCCHHHHHHHHHHHCCC
T ss_conf             997999998215637899989889999819999999999997089


No 19 
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1
Probab=100.00  E-value=0  Score=478.98  Aligned_cols=375  Identities=22%  Similarity=0.318  Sum_probs=319.8

Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             44688871466661578998878899999630378983341567867887888999999999980878888788889889
Q T0591             3 IEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGI   82 (406)
Q Consensus         3 i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~L   82 (406)
                      |+.|.+++..  .+..++.+.++..  ..+    ..+.|+|++|+||+++ ++.+.+++.+++.++ .++|++..|.++|
T Consensus        14 ~s~r~~~~~~--~~~~~~~~~a~~~--~~~----G~dvI~l~~g~p~~~~-p~~v~~a~~~~~~~~-~~~Y~~~~G~~~l   83 (389)
T 1o4s_A           14 VSRRISEIPI--SKTMELDAKAKAL--IKK----GEDVINLTAGEPDFPT-PEPVVEEAVRFLQKG-EVKYTDPRGIYEL   83 (389)
T ss_dssp             CCHHHHHSCC--CSSHHHHHHHHHH--HHT----TCCCEECCCSSCSSCC-CHHHHHHHHHHHTTC-CCCCCCTTCCHHH
T ss_pred             HHHHHHHCCC--CHHHHHHHHHHHH--HHC----CCCEEECCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCCCCCCHHH
T ss_conf             9999876896--7899999999999--977----9985899999899998-899999999998558-8688998477999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCC
Q ss_conf             99999999986488678867078824872789999999972001010131055138999998299699986044666776
Q T0591            83 RDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADET  162 (406)
Q Consensus        83 r~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~  162 (406)
                      |++||+|+.+++|+++++ ++|++|+|+++++.++++++++|||.|++++|+|+.|...+...|...+.++++    +++
T Consensus        84 r~aia~~~~~~~~~~~~~-~~i~it~G~~~ai~~~~~~l~~~gd~Vlv~~P~y~~~~~~~~~~~~~~~~~~~~----~~~  158 (389)
T 1o4s_A           84 REGIAKRIGERYKKDISP-DQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETF----MSK  158 (389)
T ss_dssp             HHHHHHHHHHHHTCCCCG-GGEEEESHHHHHHHHHHHHHCCTTCEEEEEESCCTTHHHHHHHTTCEEEEEECC----GGG
T ss_pred             HHHHHHHHHHHHCCCCCH-HHEEEECCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCC----CCC
T ss_conf             999999999984899984-438993677999999999981998989986897366899999817850024544----222


Q ss_pred             CCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCC
Q ss_conf             66778899999850254034215666432334437899999999863787578417502355688876522332102678
Q T0591           163 RAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAE  242 (406)
Q Consensus       163 ~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~  242 (406)
                      ++.++.+.+++..+++++++++||||||||.++|.+++++|+++|++++++||+||+|+++.|++...+.+...  ...+
T Consensus       159 ~~~~~~~~~~~~~~~~~~~~~l~nP~NPtG~~~s~~~l~~i~~~a~~~~~~vi~De~y~~~~~~~~~~~~~~~~--~~~~  236 (389)
T 1o4s_A          159 NFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVS--EGFD  236 (389)
T ss_dssp             TTCCCHHHHHHTCCTTEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTTTSBCSSCCCCHHHHC--SSST
T ss_pred             CCCCHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHHC--CCCC
T ss_conf             35616887765303564278835998988887899999999998998292999730033101367777754524--7678


Q ss_pred             CEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998504001046311211433258999999987520367612457999999985652589999999999999999999
Q T0591           243 NVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVL  322 (406)
Q Consensus       243 ~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L  322 (406)
                      |+|+++||||+|++||+|+||+++++++++.+...+.....+.+...|.++.......   ....++.++++++.+.+.|
T Consensus       237 ~~i~~~S~SK~~~l~GlRiG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~L  313 (389)
T 1o4s_A          237 RIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVD---NSYMVQTFKERKNFVVERL  313 (389)
T ss_dssp             TEEEEEESTTTTTCGGGCCEEEECCHHHHHHHHHHHHHHTCSCCHHHHHHHHHHTTCC---CHHHHHHHHHHHHHHHHHH
T ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHH
T ss_conf             6899941420106886766532231167999999860355113389999999864200---8899999999999999999


Q ss_pred             HHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             72799455358873078776688788989999999986891896161026799985899850997999999999999999
Q T0591           323 RGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       323 ~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~  402 (406)
                      .+. |+++..|+||||+|++++.   ++.+++.+|++++||.++||+.|+.  ++|+|++|+.++|++++|++||+++++
T Consensus       314 ~~~-g~~~~~p~gg~fl~~~~~~---~~~~~~~~ll~~~gV~v~pG~~F~~--~g~iRis~~~~~e~l~~al~rL~~~l~  387 (389)
T 1o4s_A          314 KKM-GVKFVEPEGAFYLFFKVRG---DDVKFCERLLEEKKVALVPGSAFLK--PGFVRLSFATSIERLTEALDRIEDFLN  387 (389)
T ss_dssp             HHT-TCCCCCCSBSSEEEEECSS---CHHHHHHHHHHHHCEECEEGGGGTC--TTEEEEECCSCHHHHHHHHHHHHHHHT
T ss_pred             HHC-CCEEECCCCCEEEEEECCC---CHHHHHHHHHHHCCEEEEECCCCCC--CCEEEEEECCCHHHHHHHHHHHHHHHH
T ss_conf             977-9768458940799997999---9799999999969999996732589--997999964989999999999999985


Q ss_pred             H
Q ss_conf             8
Q T0591           403 R  403 (406)
Q Consensus       403 ~  403 (406)
                      .
T Consensus       388 ~  388 (389)
T 1o4s_A          388 S  388 (389)
T ss_dssp             C
T ss_pred             C
T ss_conf             6


No 20 
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO2589, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3}
Probab=100.00  E-value=0  Score=477.44  Aligned_cols=372  Identities=21%  Similarity=0.304  Sum_probs=318.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             66661578998878899999630378983341567867887888999999999980878888788889889999999999
Q T0591            12 TDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLA   91 (406)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~   91 (406)
                      .......++.+.+++..+      ...+.|||++|+||+++ ++.+.+++.+++..+ .++|++..|.++||++||+|++
T Consensus        11 ~~p~~~~~v~~~~~~~~~------~g~~vi~l~~G~p~~~~-p~~i~~a~~~al~~~-~~~Y~~~~G~~~LR~aia~~~~   82 (391)
T 3h14_A           11 VDPFIVMDVMEAARRAEE------AGRRIIHMEVGQPGTGA-PRGAVEALAKSLETD-ALGYTVALGLPALRQRIARLYG   82 (391)
T ss_dssp             CCCCTTHHHHHHHHHHHH------TTCCCEECCCSSCSSCS-CHHHHHHHHHHHC-----------CCHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHH------CCCCEEECCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCCCCCCHHHHHHHHHHHH
T ss_conf             998389999999999997------79975889998899997-899999999997469-8799898589999999997554


Q ss_pred             HHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHH
Q ss_conf             86488678867078824872789999999972001010131055138999998299699986044666776667788999
Q T0591            92 AFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGL  171 (406)
Q Consensus        92 ~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l  171 (406)
                      +.+|+++++ ++|++|+|+++++.+++.++++|||+|++++|+|+.|...++.+|++++.++++..    +.+..+... 
T Consensus        83 ~~~g~~v~~-~~iiit~G~~~al~~~~~~l~~~Gd~Vii~~P~y~~y~~~~~~~g~~~~~v~~~~~----~~~~~~~~~-  156 (391)
T 3h14_A           83 EWYGVDLDP-GRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPE----NRLQPVPAD-  156 (391)
T ss_dssp             HHHCCCCCG-GGEEEESSHHHHHHHHHHHHCCTTCEEEEEESCCHHHHHHHHHTTCEEEEEECCGG----GTTSCCHHH-
T ss_pred             HHCCCCCCC-CCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCEEEEEECCCC----CCCCCCCCC-
T ss_conf             314856667-73599741200688889986089988999825316899999985998977640333----231001222-


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECC
Q ss_conf             99850254034215666432334437899999999863787578417502355688876522332102678689985040
Q T0591           172 EEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPS  251 (406)
Q Consensus       172 ~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~S  251 (406)
                        ..+.+++++++||||||||.+++.+++++++++|++++++||+||+|.++.|++..++.+.     ..+++|+++|+|
T Consensus       157 --~~~~~~~~l~l~~P~NPtG~~~~~~~~~~l~~~~~~~~~~ii~De~y~~~~~~~~~~~~~~-----~~~~~i~i~s~S  229 (391)
T 3h14_A          157 --FAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALE-----LTDECYVINSFS  229 (391)
T ss_dssp             --HTTSCCSEEEEESSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTTTCBSSSCCCCGGG-----TCSSSEEEEESS
T ss_pred             --CCCCCCEEEEECCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCHHHHHHCCCCCCCCCCHH-----HHCEEEEEECCC
T ss_conf             --2333213897336676544322212101220122346864310022310123675434523-----304268984677


Q ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             01046311211433258999999987520367612457999999985652589999999999999999999727994553
Q T0591           252 KTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFAR  331 (406)
Q Consensus       252 K~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~  331 (406)
                      |.+++||+|+||++++++++..+.+++.....+++.+.|.++...++. ..+..+.+..+.++++.+.+.+.+..++.+.
T Consensus       230 K~~~~~GlRiG~~i~~~~~i~~~~~~~~~~~~~~~~~~~~aa~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  308 (391)
T 3h14_A          230 KYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDC-DAELQANLDVYKANRKLMLERLPKAGFTRIA  308 (391)
T ss_dssp             STTCCTTSCCEEEECCGGGHHHHHHHHHHTTCCCCHHHHHHHHHHTTC-HHHHHHHHHHHHHHHHHHHHHHHHHTCCCBC
T ss_pred             CCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHCCCCCEEEC
T ss_conf             678877666641124604556666654100000001789999987303-2025789998765444444431112431755


Q ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC-CCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             5887307877668878898999999998689189616102679-9985899850997999999999999999856
Q T0591           332 TPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH-TADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       332 ~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~-~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      .|+||||+|+++++...++.+|+++|++++||.++||+.||.. +++|+||||+.++|++++|++||++++++.+
T Consensus       309 ~p~gg~f~~~~l~~~~~~~~~~~~~Ll~~~gV~v~PG~~Fg~~~~~~~iRis~~~~~e~l~ea~~rL~~~l~~~~  383 (391)
T 3h14_A          309 PPDGAFYVYADVSDLTDDSRAFAAEILEKAGVAVTPGLDFDPERGAGTLRFSYARATADIEEGLDRLEAFMQARG  383 (391)
T ss_dssp             CCCBTTEEEEECTTTCSCHHHHHHHHHHHHCEECEEGGGTCTTTGGGEEEEECCSCHHHHHHHHHHHHHHHHHC-
T ss_pred             CCCEEEEEEEECCCCCCCHHHHHHHHHHHCCEEEECCHHCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             888347998989888889999999999849999984221199889998999973999999999999999999858


No 21 
>2dou_A Probable N-succinyldiaminopimelate aminotransferase; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus HB8}
Probab=100.00  E-value=0  Score=475.62  Aligned_cols=352  Identities=23%  Similarity=0.282  Sum_probs=317.8

Q ss_pred             CCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHH
Q ss_conf             98334156786788788899999999998087888878888988999999999986488678867078824872789999
Q T0591            38 GRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLA  117 (406)
Q Consensus        38 ~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~  117 (406)
                      ...||||+|+||+++ ++.+.+++.+++.+...++|++..|.+++|++|++|+.+++|....+.++|++|+|++++|..+
T Consensus        25 ~~ii~l~~G~p~~~~-p~~v~~a~~~al~~~~~~~Y~~~~G~~~~r~aia~~~~~~~~~~~~~~~~i~~t~G~~~al~~~  103 (376)
T 2dou_A           25 VGLIDLSIGSTDLPP-PEAPLKALAEALNDPTTYGYCLKSCTLPFLEEAARWYEGRYGVGLDPRREALALIGSQEGLAHL  103 (376)
T ss_dssp             CCCEECSSCCCCCCC-CHHHHHHHHHHTTCGGGSSCCCHHHHHHHHHHHHHHHHHHHSCCCCTTTSEEEESSHHHHHHHH
T ss_pred             CCEEECCCCCCCCCC-CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCHHHHH
T ss_conf             983988899999998-9999999999985877668799879989999999756775186534673079950321014445


Q ss_pred             HHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCH
Q ss_conf             99997200101013105513899999829969998604466677666778899999850254034215666432334437
Q T0591           118 VAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSA  197 (406)
Q Consensus       118 ~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~  197 (406)
                      +++++++||.|++++|+|+.|...+...|.+.++++.+      ..+.+|++.+++.++++++++++||||||||.+++.
T Consensus       104 ~~~l~~~gd~vl~~~P~y~~~~~~~~~~~~~~~~~~~~------~~~~~d~~~~~~~~~~~~~~l~l~nP~NPtG~~~s~  177 (376)
T 2dou_A          104 LLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLR------EDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADW  177 (376)
T ss_dssp             HHHHCCTTCEEEEESSCCHHHHHHHHHTTCEEEEECBC------TTSSBCGGGSCHHHHHHEEEEEECSSCTTTCCCCCH
T ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCH
T ss_conf             56632554435576422222222331100012222222------333563788888753355258841445651244658


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             89999999986378757841750235568887652233210267868998504001046311211433258999999987
Q T0591           198 EEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKL  277 (406)
Q Consensus       198 ~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~  277 (406)
                      +++++|+++|++++++||+||+|.++.|++..++.+...  ...+++|+++||||.|++||+|+||++++++++..+.+.
T Consensus       178 ~~~~~l~~~~~~~~~~ii~De~y~~~~~~~~~~~~~~~~--~~~~~~i~~~S~SK~~~~~G~RiG~~~~~~~~~~~~~~~  255 (376)
T 2dou_A          178 GYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALP--GAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERV  255 (376)
T ss_dssp             HHHHHHHHHHHHTTCEEEEECTTGGGBSSSCCCCGGGST--TGGGTEEEEEEHHHHHTCGGGCCEEEEECHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCEEEEEECCHHHHCCCCCCCCCHHHHC--CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             889999998764427887520011113345677455431--666768998269752648764544233432222210111


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHH
Q ss_conf             52036761245799999998565258999999999999999999972799455358873078776688788989999999
Q T0591           278 QAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKIL  357 (406)
Q Consensus       278 ~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~L  357 (406)
                      +.....+.++..|.++...+.....+.++.+..++++++.+.+.|.+  ++.+..|+||||+|+++++ +.++.+|+++|
T Consensus       256 ~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~--~~~~~~p~gg~~~~~~~~~-~~~~~~~~~~l  332 (376)
T 2dou_A          256 KGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKG--VLSLLPPRATMYLWGRLPE-GVDDLEFGLRL  332 (376)
T ss_dssp             HHHHCCCSCHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHHTT--TSEECCCCBSSEEEEECCT-TCCHHHHHHHH
T ss_pred             HCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHCC--CEEEECCCCEEEEEEECCC-CCCHHHHHHHH
T ss_conf             10122332232023444302455433222222223221023455337--4268579812799898999-97999999999


Q ss_pred             HHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             986891896161026799985899850997999999999999999
Q T0591           358 RLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       358 l~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~  402 (406)
                      + ++||.++||+.|+..+++|+|+||+.++|++++|++||+++++
T Consensus       333 ~-e~gV~v~pg~~F~~~~~~~~Ris~~~~~e~l~~ai~rL~~~le  376 (376)
T 2dou_A          333 V-ERGVALAPGRGFGPGGKGFVRIALVRPLEELLEAAKRIREALD  376 (376)
T ss_dssp             H-HTTEECEEGGGGCGGGTTEEEEECCSCHHHHHHHHHHHHHTC-
T ss_pred             H-HCCEEEEECHHCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHC
T ss_conf             9-7998998341208999997999973899999999999999869


No 22 
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, SGC, alternative splicing, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens}
Probab=100.00  E-value=0  Score=469.95  Aligned_cols=380  Identities=19%  Similarity=0.240  Sum_probs=298.8

Q ss_pred             HHHHHHHHHHHHHH-HHCCC-CCCEEECCCCCCCC--CC----------------------CHHHHHHHHHHHHC---CC
Q ss_conf             89988788999996-30378-98334156786788--78----------------------88999999999980---87
Q T0591            19 EVRQSAAGLEALIR-GAPIE-GRPVDFSHGDVDAH--EP----------------------TPGAFDLFSAGVQS---GG   69 (406)
Q Consensus        19 ~~~~~~~~~~~~~~-~~~~~-~~~i~ls~G~pd~~--~p----------------------~~~~~~~~~~~~~~---~~   69 (406)
                      .+...+..++...+ +.+.. ...|.+++|+|...  .|                      +.++++++.+.+..   .+
T Consensus        42 ~~~~~a~~l~~~~~~~~~~p~~~ii~~~iG~P~~~g~~p~~f~r~v~~~~~~p~l~~~~~~P~~~~~~a~~~l~~~~~~~  121 (498)
T 3ihj_A           42 PIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNS  121 (498)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSSSSCBCCC----------CCHHHHHHHHHHHCGGGGGCSSSCHHHHHHHHHHHHHC----
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             79999999999615034787561678348785101799507999999861375557877898999999999998536999


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHH-CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHH----HHHHHCCCHHHHHHHHH
Q ss_conf             888878888988999999999986-4886788670788248727899999999720010----10131055138999998
Q T0591            70 VQAYTEYRGDLGIRDLLAPRLAAF-TGAPVDARDGLIITPGTQGALFLAVAATVARGDK----VAIVQPDYFANRKLVEF  144 (406)
Q Consensus        70 ~~~Y~~~~G~~~Lr~aia~~~~~~-~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~----Vl~~~P~y~~~~~~~~~  144 (406)
                      ..+|+++.|.++||++||+|++++ +|++++| ++|++|+|++++|.++++++++|||+    |++++|+|+.|...+..
T Consensus       122 ~~~Y~~s~G~~~lReaIA~~~~~r~~g~~~~p-d~I~iT~Ga~~al~~~~~~l~~pGD~~~~~Vlvp~P~Y~~y~~~~~~  200 (498)
T 3ihj_A          122 LGSYSASQGVNCIREDVAAYITRRDGGVPADP-DNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISE  200 (498)
T ss_dssp             ------CCSCHHHHHHHHHHHHHHTTTCCCCG-GGEEEESSHHHHHHHHHHHHCCCCGGGSEEEEEEESCCTHHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCH-HHEEECCCHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             89759970429999999999998518999864-53999288899999999972589976665699945871669999998


Q ss_pred             HCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCC-----CCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCC
Q ss_conf             299699986044666776667788999998502-----540342156664323344378999999998637875784175
Q T0591           145 FEGEMVPVQLDYVSADETRAGLDLTGLEEAFKA-----GARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQL  219 (406)
Q Consensus       145 ~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~-----~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~  219 (406)
                      +|++.++++++    .+++|.+|++++++.+++     ++|+++++|||||||.++|.+++++|+++|++++++||+||+
T Consensus       201 ~g~~~v~v~l~----~e~~~~~d~~~l~~~~~~~~~~~~~k~lvl~nP~NPTG~v~s~e~l~~i~~~a~~~~i~iI~DEi  276 (498)
T 3ihj_A          201 LDAIQVNYYLD----EENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEV  276 (498)
T ss_dssp             TTCEEEEEECB----GGGTTBCCHHHHHHHHHHHTTTSEEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECT
T ss_pred             CCCEEEEEECC----HHCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             59889984025----12076779999987888765047825999779958645432289999997630154799997315


Q ss_pred             CCCCCCCCC-CCCCHHHHH------CCCCCCEEEEEECCHHC-CCCCCCCHHHHHH---HHHHHHHHHHHHHCCCCHHHH
Q ss_conf             023556888-765223321------02678689985040010-4631121143325---899999998752036761245
Q T0591           220 YSRLRYAGA-SYTHLRAEA------AVDAENVVTIMGPSKTE-SLSGYRLGVAFGS---RAIIARMEKLQAIVSLRAAGY  288 (406)
Q Consensus       220 Y~~l~~~~~-~~~~~~~~~------~~~~~~~i~~~S~SK~~-~~~GlRiG~~~~~---~~~i~~l~~~~~~~~~~~~~~  288 (406)
                      |.++.|++. ++.++....      .....++++++|+||.| +++|||+||++.+   .+.+..+.+..+  ....+..
T Consensus       277 Y~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~vi~~~S~SK~~~~~~G~R~G~~~~~~~~~~~~~~~~~~~~--~~~~~~~  354 (498)
T 3ihj_A          277 YQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLS--VRLCPPV  354 (498)
T ss_dssp             TTTCBCCTTCCCCCHHHHHHHTCHHHHTTCCEEEEEESSSSTTCCSSSCCEEEEEESCCHHHHHHHHHHHH--HSCCCCH
T ss_pred             CEEEEECCCCCCCCHHHHHHHHCCHHCCCCEEEECCCCCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHCC--CCCCCCH
T ss_conf             63441078877775777544413000256346522455423345775611023312112899999997414--4456638


Q ss_pred             HHHHHHHHHHCC-----------CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCC-----------
Q ss_conf             799999998565-----------2589999999999999999999727994553588730787766887-----------
Q T0591           289 SQAVLRGWFDEA-----------PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL-----------  346 (406)
Q Consensus       289 ~q~a~~~~l~~~-----------~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~-----------  346 (406)
                      .|.++..++...           .+..+..+..++++++.+.+.|++++|+++..|+||||+|++++..           
T Consensus       355 ~~~~a~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~r~~~~~~~l~~i~g~~~~~p~Ga~y~~~~l~~~~~~~~~~~~~~  434 (498)
T 3ihj_A          355 SGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQ  434 (498)
T ss_dssp             HHHHHHHHHTCCCCTTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTEECCCCCBSSEECCEECCCHHHHHHHHHTT
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCEEEEEEEECCCCCCCHHHHHHCC
T ss_conf             99999999865667689999999999888779999999999999974899686278816899896677644112444225


Q ss_pred             CCCHHHHHHHHHHHCCEEEEECCCCCCC-CCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8898999999998689189616102679-9985899850997999999999999999856
Q T0591           347 AVAPAEFVKILRLQAGVVVTPGTEFSPH-TADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       347 ~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~-~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      ..++.+|+.+|++++||+++||+.||.. +++|+|++|+.++|++++|++||++|+++|.
T Consensus       435 ~~~d~~f~~~LL~~~gV~v~PGs~Fg~~~g~~~~Ris~~~~~e~l~eal~Ri~~f~~~~~  494 (498)
T 3ihj_A          435 MAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFL  494 (498)
T ss_dssp             SCHHHHHHHHHHHHHCBCCEEGGGTCCCTTCCBEEEECCSCHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHH
T ss_conf             787799999999869999974023099999986999974899999999999999999999


No 23 
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1
Probab=100.00  E-value=0  Score=471.02  Aligned_cols=354  Identities=19%  Similarity=0.260  Sum_probs=304.7

Q ss_pred             CCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHH
Q ss_conf             98334156786788788899999999998087888878888988999999999986488678867078824872789999
Q T0591            38 GRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLA  117 (406)
Q Consensus        38 ~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~  117 (406)
                      .+.|+|++|+||++.| +.+.+++.++  .....+|++..|.++||++||+|+++++|+++++ ++|++|+|+++++.++
T Consensus        43 ~~vi~l~~G~P~~~~p-~~i~~al~~~--~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~~-d~Ivit~Gs~~~l~~~  118 (409)
T 2gb3_A           43 VRIHHLNIGQPDLKTP-EVFFERIYEN--KPEVVYYSHSAGIWELREAFASYYKRRQRVDVKP-ENVLVTNGGSEAILFS  118 (409)
T ss_dssp             CEEEECSSCCCCSCCC-THHHHHHHHT--CCSSCCCCCTTCCHHHHHHHHHHHHHTSCCCCCG-GGEEEESHHHHHHHHH
T ss_pred             CCEEECCCCCCCCCCC-HHHHHHHHHC--CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCC-CEEEEECCHHHHHHHH
T ss_conf             9878898988899987-9999999960--7778789998678999999999999985899881-0199938804888999


Q ss_pred             HHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCH
Q ss_conf             99997200101013105513899999829969998604466677666778899999850254034215666432334437
Q T0591           118 VAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSA  197 (406)
Q Consensus       118 ~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~  197 (406)
                      +++++++||.|+++.|+|+.|...+...|...++++.+..     ++..+.+.+++....+++++++||||||||.+++.
T Consensus       119 ~~~~~~~gd~Vl~~~p~~~~~~~~~~~~g~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~l~~p~NPtG~~~s~  193 (409)
T 2gb3_A          119 FAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRME-----EGFAIPQNLESFINERTKGIVLSNPCNPTGVVYGK  193 (409)
T ss_dssp             HHHHCCTTCEEEEEESCCTHHHHHHHHHTCEEEEEECCGG-----GTSCCCTTGGGGCCTTEEEEEEESSCTTTCCCCCH
T ss_pred             HHHCCCCCCEEEECCCCCCCCCCEEECCCCEECCCCCCCC-----CCCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCH
T ss_conf             8741689998997787653200000026841103453445-----55466799998631485299988998998744228


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             89999999986378757841750235568887652233210267868998504001046311211433258999999987
Q T0591           198 EEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKL  277 (406)
Q Consensus       198 ~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~  277 (406)
                      +++++|+++|++|+++||+||+|.++.|++...+...    ...+++++++|+||.|++||||+||++++++.+......
T Consensus       194 ~~l~~l~~~a~~~~~~iI~De~Y~~~~~~~~~~~~~~----~~~~~~ivi~s~sK~~~~pGlRiG~~~~~~~~i~~~~~~  269 (409)
T 2gb3_A          194 DEMRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALS----IESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMK  269 (409)
T ss_dssp             HHHHHHHHHHHHTTCEEEEECTTTTCBCSSCCCCGGG----SCCTTEEEEEESTTTTTCGGGCCEEEECSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHH----HCCCCCEEEECCCCCCCCCCCCEEEEECCCHHHHHHHHH
T ss_conf             9999999999988918999678542246898777555----425751797057766668886479994487999999987


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHH
Q ss_conf             52036761245799999998565258999999999999999999972799455358873078776688788989999999
Q T0591           278 QAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKIL  357 (406)
Q Consensus       278 ~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~L  357 (406)
                      ......+.+.+.|.++..++...+.+++..+..++++|+.+.+.|+++.+..+..|+||||+|+++|.  .++.+|+++|
T Consensus       270 ~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~rr~~l~~~L~~~~~~~~~~p~gg~fl~~~lp~--~~~~~~~~~l  347 (409)
T 2gb3_A          270 LAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPV--EDAEEFARWM  347 (409)
T ss_dssp             HHHHSCCCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCCBCCCSBSSEEEEECSS--SCHHHHHHHH
T ss_pred             HCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCEEEEEEEECCC--CCHHHHHHHH
T ss_conf             51267775189999999998588367999999999999999999986699552588812699995899--9999999999


Q ss_pred             HHH-----CCEEEEECCCCCCC---CCCEEEEEECCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             986-----89189616102679---99858998509979999999999999998569
Q T0591           358 RLQ-----AGVVVTPGTEFSPH---TADSVRLNFSQDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       358 l~~-----~gV~v~pG~~Fg~~---~~~~iRis~~~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      +++     +||.++||+.|+..   +++|+||||+.++|++++|++||++++++|.+
T Consensus       348 l~e~~l~~~~v~v~pg~~f~~~~~~g~~~iRis~~~~~e~l~~a~~rL~~~lk~~~~  404 (409)
T 2gb3_A          348 LTDFNMDGETTMVAPLRGFYLTPGLGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCS  404 (409)
T ss_dssp             HHSCCBTTEEEECEEGGGGCSSTTTTSSEEEEECCSCHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHCCEEEEECCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             986036429789994750156898889989999638999999999999999999998


No 24 
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii}
Probab=100.00  E-value=0  Score=470.20  Aligned_cols=367  Identities=24%  Similarity=0.383  Sum_probs=314.2

Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCC-CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHH
Q ss_conf             446888714666615789988788999996303789-8334156786788788899999999998087888878888988
Q T0591             3 IEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEG-RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLG   81 (406)
Q Consensus         3 i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~   81 (406)
                      ++.|+.++  ..++-.++...+.++++       +| +.|+|++|+||++. ++.+.+++.+++.++ .++|++..|.++
T Consensus         2 ~~~~~~~~--~~~~~~~~~~~a~~l~~-------~G~~vi~l~~g~p~~~~-p~~i~~a~~~~l~~~-~~~Y~~~~G~~~   70 (370)
T 2z61_A            2 LSKRLLNF--ESFEVMDILALAQKLES-------EGKKVIHLEIGEPDFNT-PKPIVDEGIKSLKEG-KTHYTDSRGILE   70 (370)
T ss_dssp             CCHHHHHC--CCCTTHHHHHHHHHHHH-------TTCCCEECCCCSCSSCC-CHHHHHHHHHHHHTT-CCSCCCTTCCHH
T ss_pred             HHHHHHCC--CCCHHHHHHHHHHHHHH-------CCCCEEECCCCCCCCCC-CHHHHHHHHHHHHCC-CCCCCCCCCCHH
T ss_conf             50263139--96199999999999996-------69982899999899988-899999999998548-878999978899


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCC
Q ss_conf             99999999998648867886707882487278999999997200101013105513899999829969998604466677
Q T0591            82 IRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADE  161 (406)
Q Consensus        82 Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~  161 (406)
                      ||+++++|+.++++.++++ ++|++|+|++++|..+++++++|||+|++++|+|+.|...++..|.+.+.++        
T Consensus        71 lR~~ia~~~~~~~~~~~~~-~~i~~t~G~~~al~~~~~~l~~pGd~vl~~~P~y~~~~~~~~~~g~~~~~~~--------  141 (370)
T 2z61_A           71 LREKISELYKDKYKADIIP-DNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCD--------  141 (370)
T ss_dssp             HHHHHHHHHHHHSSCCCCG-GGEEEESSHHHHHHHHHHHHCCTTCEEEEESSCCTHHHHHHHHTTCEEEEEC--------
T ss_pred             HHHHHHHHHHHHCCCCCCC-CCEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCC--------
T ss_conf             9999999888745988994-5168657889999999998579939899888982779999997087146567--------


Q ss_pred             CCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCC
Q ss_conf             66677889999985025403421566643233443789999999986378757841750235568887652233210267
Q T0591           162 TRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDA  241 (406)
Q Consensus       162 ~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~  241 (406)
                          +|+++|++++++++|++++||||||||.+++.    +++++|+++++++|+||+|.++.+++....++...  ...
T Consensus       142 ----~d~e~l~~~l~~~~~~v~l~nP~NPtG~~~s~----e~~~~a~~~~~~ii~De~y~~~~~~~~~~~~~~~~--~~~  211 (370)
T 2z61_A          142 ----FTVESLEEALSDKTKAIIINSPSNPLGEVIDR----EIYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFD--ENL  211 (370)
T ss_dssp             ----SSHHHHHHHCCSSEEEEEEESSCTTTCCCCCH----HHHHHHHHHCSEEEEECTTTTCBSSSCCCCGGGTC--TTC
T ss_pred             ----CCHHHHHHHHCCCCCEEEECCCCCCCCCCCHH----HHHHHHHHHCCCEEEEEEEEHHCCCCCCCCEEEEC--CCC
T ss_conf             ----99999998610388389982998999876628----99999985048679986311001378876502305--777


Q ss_pred             CCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC-CCHHHHHHHHHHHHHHHHHHH
Q ss_conf             8689985040010463112114332589999999875203676124579999999856-525899999999999999999
Q T0591           242 ENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDE-APGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       242 ~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~-~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      +++|+++||||+|++||+|+||+++++++++.+.+.+.....+.+...|.++..++.. ...+..+.++.++++++.+.+
T Consensus       212 ~~~i~~~S~SK~~~~~GlR~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~  291 (370)
T 2z61_A          212 EKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETEREINSMIKEFDRRRRLVLK  291 (370)
T ss_dssp             SSEEEEEESTTTTTCGGGCCEEEECCHHHHHHHHHHHHHHTSSSCHHHHHHHGGGGSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCHHCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             81899945803244660224323253577899999874123331159999999998706589999999999865678999


Q ss_pred             HHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHH
Q ss_conf             99727994553588730787766887889899999999868918961610267999858998509979999999999999
Q T0591           321 VLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTL  400 (406)
Q Consensus       321 ~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~  400 (406)
                      .|++. |+.+..|+||||+|++++   .++.+++.+|++++||.++||+.|+..+++|+|+||+.++|++++|++||+++
T Consensus       292 ~L~~~-g~~~~~p~gg~f~~~~~~---~~~~~~~~~ll~~~gV~v~pG~~F~~~~~~~iRis~~~~~e~l~~al~rL~~~  367 (370)
T 2z61_A          292 YVKDF-GWEVNNPIGAYYVFPNIG---EDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYENIKEGLERIKEF  367 (370)
T ss_dssp             HHHHT-TCBCCCCCBTTEECCBCS---SCHHHHHHHHHHHHCEECEEGGGGCGGGSSBEEEECCSCHHHHHHHHHHHHHH
T ss_pred             HHHHC-CCEECCCCCEEEEEEECC---CCHHHHHHHHHHHCCEEEEECHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHH
T ss_conf             99865-957626880389998589---99999999999859999981522088998979999729899999999999999


Q ss_pred             HHH
Q ss_conf             998
Q T0591           401 VER  403 (406)
Q Consensus       401 ~~~  403 (406)
                      ++|
T Consensus       368 l~k  370 (370)
T 2z61_A          368 LNK  370 (370)
T ss_dssp             HC-
T ss_pred             HCC
T ss_conf             776


No 25 
>1wst_A MSAT, multiple substrate aminotransferase; alpha and beta; HET: PLP; 1.95A {Thermococcus profundus} SCOP: c.67.1.1 PDB: 1x0m_A
Probab=100.00  E-value=0  Score=469.88  Aligned_cols=362  Identities=22%  Similarity=0.325  Sum_probs=302.8

Q ss_pred             CCCCEEECCCCCCCCC-CCHHHHHHHHHHHHCC--CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             8983341567867887-8889999999999808--788887888898899999999998648867886707882487278
Q T0591            37 EGRPVDFSHGDVDAHE-PTPGAFDLFSAGVQSG--GVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~-p~~~~~~~~~~~~~~~--~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      .++.|+|+.|+||+.. |...+.+++.+.+...  ...+|++..|.++||++||+|+++++|+++++ ++|++|+|++++
T Consensus        40 ~~~~i~l~~G~P~~~~~P~~~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~-~~I~it~G~~~a  118 (417)
T 1wst_A           40 TSDVISLAGGLPAPETFPVETIKKIAVEVLEEHADKALQYGTTKGFTPLRLALARWMEKRYDIPMSK-VEIMTVAGSQQA  118 (417)
T ss_dssp             SSSCEECCCCCCCGGGSCHHHHHHHHHHHHHHSHHHHHSCCCSSCCHHHHHHHHHHHHHHHCCCCTT-CEEEEESSHHHH
T ss_pred             CCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCC-CEEEECCCHHHH
T ss_conf             9997889886789410699999999999997376002588998674999999999999984898764-058853640278


Q ss_pred             HHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             99999999720010101310551389999982996999860446667766677889999985025403421566643233
Q T0591           114 LFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGV  193 (406)
Q Consensus       114 l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~  193 (406)
                      +++++.++++|||.|++++|+|+.|...+...|+++++|+++....+........++..+..+....+++++|||||||.
T Consensus       119 l~~~~~~l~~~gd~Vl~~~P~y~~~~~~~~~~g~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~NPtG~  198 (417)
T 1wst_A          119 LDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDKGMRVDLLEEKLEELRKQGKRVKIVYTVSTFQNPAGV  198 (417)
T ss_dssp             HHHHHHHHCCTTCEEEEEESCCHHHHHHHHTTCCEEEEEEEETTEECHHHHHHHHHHHHHTTCCCCEEEECCSSCTTTCC
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             88999998631234556688711335676412553025631533233200000122221223333222332456888787


Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHH
Q ss_conf             44378999999998637875784175023556888765223321026786899850400104631121143325899999
Q T0591           194 VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIAR  273 (406)
Q Consensus       194 ~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~  273 (406)
                      ++|.+++++|+++|++||++||+||+|.+|.|++.+.+++...  ...+++++++||||.++ ||||+||+++++++++.
T Consensus       199 ~~s~e~l~~i~~la~~~~~~iI~De~Y~~l~~~~~~~~~~~~~--~~~~~~i~i~S~SK~~~-~G~RiG~~~~~~~~i~~  275 (417)
T 1wst_A          199 TMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHF--DDYGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRK  275 (417)
T ss_dssp             CCCHHHHHHHHHHHHHTTCEEEEECTTTTCBCSSCCCCCGGGG--CSSSCEEEEEESTTTTC-GGGCCEEEEECHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHCCEEECCCCCHHHHCCCCCCCCCCCCC--CCCCEEEEECCCCCCCC-CCCCEECCCCHHHHHHH
T ss_conf             7889999999987650585774454413310588988710136--77863999876435638-87860001113889999


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHC--CCCEEECCCCCEEEEEECCCCCCC
Q ss_conf             998752036761245799999998565--2589999999999999999999727--994553588730787766887889
Q T0591           274 MEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGC--EGVFARTPQAGSYLFPRLPKLAVA  349 (406)
Q Consensus       274 l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~--~g~~~~~p~gg~~~w~~~~~~~~~  349 (406)
                      +...+.....+.+.+.|.+++.++...  +.++++.+..|+++++.+.+.+.+.  .|+.+..|+||+|+|+++|+ +.+
T Consensus       276 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~l~~~~~~g~~~~~p~gg~f~~~~l~~-~~d  354 (417)
T 1wst_A          276 MEIAKQSIDLCTNTFGQAIAWKYVENGYLDEHIPKIIEFYKPRRDAMLEALEEYMPEGVEWTKPEGGMFVRVTLPE-GID  354 (417)
T ss_dssp             HHHHHHHHHSSCCHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHCCTTCEECCCSBSSEEEEECCT-TCC
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCEEEEEEECCC-CCC
T ss_conf             9999753012334302344554302442047788889999999999999987636687288168813699998999-999


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCC--CCCEEEEEEC-CCHHHHHHHHHHHHHHHHHH
Q ss_conf             8999999998689189616102679--9985899850-99799999999999999985
Q T0591           350 PAEFVKILRLQAGVVVTPGTEFSPH--TADSVRLNFS-QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       350 ~~~~~~~Ll~~~gV~v~pG~~Fg~~--~~~~iRis~~-~~~e~l~~al~rl~~~~~~~  404 (406)
                      +.++.+.| .++||+++||+.|+..  +++|+||||+ .++|++++|++||+++++++
T Consensus       355 ~~~~~~~l-~~~gV~v~pG~~F~~~~~~~~~iRls~~~~~~e~l~~a~~rl~~~l~e~  411 (417)
T 1wst_A          355 TKLMMERA-VAKGVAYVPGEAFFVHRDKKNTMRLNFTYVPEETIREGVRRLAETIKEE  411 (417)
T ss_dssp             TTTTHHHH-HHTTEECEEGGGGSTTCCCCSEEEEECSSSCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHH-HHCCEEEEECHHHCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHH
T ss_conf             99999999-9789799933674789998997999956699999999999999999999


No 26 
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491}
Probab=100.00  E-value=0  Score=463.07  Aligned_cols=354  Identities=20%  Similarity=0.267  Sum_probs=307.5

Q ss_pred             CCC-CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC-CCCCCCCCEEEEECCCCHH
Q ss_conf             789-83341567867887888999999999980878888788889889999999999864-8867886707882487278
Q T0591            36 IEG-RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFT-GAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        36 ~~~-~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~-g~~~~~~~~I~it~G~~~~  113 (406)
                      .++ +.|+|++|+||++.| +.+.+++.+++.+  .++|++..|.++||++||+|+++++ |...+++++|++|+|++++
T Consensus        27 ~~g~~vi~l~~g~p~~~~p-~~i~~al~~~~~~--~~~Y~~~~G~~~lR~aia~~~~~~~~~~~~~~~~~i~~t~G~~~~  103 (396)
T 3jtx_A           27 PEGMEAVPLHIGEPKHPTP-KVITDALTASLHE--LEKYPLTAGLPELRQACANWLKRRYDGLTVDADNEILPVLGSREA  103 (396)
T ss_dssp             CTTCCCEECSCCSCCSCCC-HHHHHHHHHTGGG--GGSCCCTTCCHHHHHHHHHHHHHHTTTCCCCTTTSEEEESSHHHH
T ss_pred             CCCCCEEECCCCCCCCCCC-HHHHHHHHHHHHC--CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCHHHH
T ss_conf             4899868788988999878-9999999998751--789999878999999999999986079879987779982787999


Q ss_pred             HHHHHHHHHHCCHH-----HHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             99999999720010-----1013105513899999829969998604466677666778899999850254034215666
Q T0591           114 LFLAVAATVARGDK-----VAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPN  188 (406)
Q Consensus       114 l~~~~~~l~~pGd~-----Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~  188 (406)
                      +.+++.++++|||.     |+++.|+|+.+.......+.+...++.     +++++.+|++++++++.+++|++++||||
T Consensus       104 l~~~~~~~~~pgd~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~d~~~l~~~~~~~~k~~~l~~P~  178 (396)
T 3jtx_A          104 LFSFVQTVLNPVSDGIKPAIVSPNPFYQIYEGATLLGGGEIHFANC-----PAPSFNPDWRSISEEVWKRTKLVFVCSPN  178 (396)
T ss_dssp             HHHHHHHHCCC---CCCCEEEEEESCCHHHHHHHHHTTCEEEEEEC-----CTTTCCCCGGGSCHHHHHTEEEEEEESSC
T ss_pred             HHHHHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCC-----CCCCCCCCHHHHHHHHCCCCEEEEECCCC
T ss_conf             9999986235666665205973586443000002212663334677-----77677879999975421475599808986


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHH---HHCCCCCCEEEEEECCHHCCCCCCCCHHHH
Q ss_conf             43233443789999999986378757841750235568887652233---210267868998504001046311211433
Q T0591           189 NPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRA---EAAVDAENVVTIMGPSKTESLSGYRLGVAF  265 (406)
Q Consensus       189 NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~---~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~  265 (406)
                      ||||.+++.+++++|+++|++|+++||+||+|.++.|++..+.+...   ......++++++.|+||.|++||||+||++
T Consensus       179 NPtG~~~s~e~~~~i~~~a~~~~~~ii~De~y~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~s~sK~~~~~GlR~G~~i  258 (396)
T 3jtx_A          179 NPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVA  258 (396)
T ss_dssp             TTTCCCCCHHHHHHHHHHHHHHCCEEEEECTTTTCCSTTCCCCCHHHHHHHTTCCCTTEEEEEESTTTSSCGGGCCEEEE
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCEEEEEECCHHHHCCCCCCCCCHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCEEEEE
T ss_conf             98877156899999999987536435762021002047887760443111035665126999157522068773116676


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCC
Q ss_conf             25899999998752036761245799999998565258999999999999999999972799455358873078776688
Q T0591           266 GSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPK  345 (406)
Q Consensus       266 ~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~  345 (406)
                      +++++++++...+.....+.+...|.++...... ..+....++.++++++.+.+.|++.  +.+..|+||||+|+++|+
T Consensus       259 ~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~-~~~~~~~~~~~~~~~~~~~~~L~~~--~~~~~p~gg~~lw~~~~~  335 (396)
T 3jtx_A          259 GDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDD-EQHVIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVPD  335 (396)
T ss_dssp             ECHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHHHHHTTT--SCCCCCSSSSEEEEECTT
T ss_pred             CCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHC--CCCCCCCCCEEEEEECCC
T ss_conf             4999999999975530245559999999997422-2113333577799999999999865--885588832189998999


Q ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCCCCC------CCCEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             78898999999998689189616102679------9985899850997999999999999999
Q T0591           346 LAVAPAEFVKILRLQAGVVVTPGTEFSPH------TADSVRLNFSQDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       346 ~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~------~~~~iRis~~~~~e~l~~al~rl~~~~~  402 (406)
                        .++.+|+++|++++||.++||+.|+..      +++|+||||+.++|++++|++||+++++
T Consensus       336 --~~~~~~~~~ll~~~gV~v~PG~~F~~~~~~g~~g~~~iRls~~~~~e~l~ea~~Ri~~~~r  396 (396)
T 3jtx_A          336 --GDDLAFARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADVATCVKAAEDIVSLYR  396 (396)
T ss_dssp             --SCHHHHHHHHHHHHCEECEEGGGGCCCCTTCCTTTTEEEEECCSCHHHHHHHHHHHHHHCC
T ss_pred             --CCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHC
T ss_conf             --9999999999997899997645526776668888997999974889999999999999739


No 27 
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphate, external aldimine, chloroplast, plastid; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A*
Probab=100.00  E-value=0  Score=467.52  Aligned_cols=387  Identities=16%  Similarity=0.185  Sum_probs=295.2

Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCC----CCCCCCCCCCC
Q ss_conf             46888714666615789988788999996303789833415678678878889999999999808----78888788889
Q T0591             4 EAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSG----GVQAYTEYRGD   79 (406)
Q Consensus         4 ~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~----~~~~Y~~~~G~   79 (406)
                      +.++++|.. +.+..++.+....   .. ....+...|+|++|+||++.| +.+.+++.+++.+.    +.++|++..|.
T Consensus        27 n~~~~~l~~-~y~f~~i~~~~~~---~~-~~~~~~~vI~l~~G~p~~p~P-~~i~~al~~~~~~~~~~~g~~~Y~~~~G~  100 (432)
T 3ei9_A           27 NSNMSKLQA-GYLFPEIARRRSA---HL-LKYPDAQVISLGIGDTTEPIP-EVITSAMAKKAHELSTIEGYSGYGAEQGA  100 (432)
T ss_dssp             CHHHHHCCS-SCHHHHHHHHHHH---HH-HHCTTCCCEECSSCCCCSCCC-HHHHHHHHHHHHHTTSTTTCCCCCCTTCC
T ss_pred             CCCHHHCCC-CCCCHHHHHHHHH---HH-HHCCCCCEEECCCCCCCCCCC-HHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             637133564-5885899999999---99-868999879793888989999-99999999998534654587799975148


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCC
Q ss_conf             88999999999986488678867078824872789999999972001010131055138999998299699986044666
Q T0591            80 LGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSA  159 (406)
Q Consensus        80 ~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~  159 (406)
                      ++||++||+|+++.++  +++ ++|++|+|++++|.++ ..+++|||.|++++|+|+.|...+...|...+.++......
T Consensus       101 ~~LR~aia~~~~~~~~--v~~-e~I~it~Ga~~al~~l-~~l~~~gd~Vlv~~P~y~~y~~~~~~~g~~~~~~~~~~~~~  176 (432)
T 3ei9_A          101 KPLRAAIAKTFYGGLG--IGD-DDVFVSDGAKCDISRL-QVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYG  176 (432)
T ss_dssp             HHHHHHHHHHHHTTTT--CCG-GGEEEESCHHHHHHHH-HHHHCTTCCEEEEESCCTHHHHHHHHHTCSCCEETTTTEET
T ss_pred             HHHHHHHHHHHHCCCC--CCC-CEEEECCCCHHHHHHH-HCCCCCCCCEEEEECCCCCHHHHHHHCCCCCEEEECCCCCC
T ss_conf             9999999999965899--894-3377557730423100-00146897405642142415899997178522630210022


Q ss_pred             CCCCCCCCHHH---HHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHH
Q ss_conf             77666778899---999850254034215666432334437899999999863787578417502355688876522332
Q T0591           160 DETRAGLDLTG---LEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAE  236 (406)
Q Consensus       160 ~~~~~~~d~~~---l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~  236 (406)
                      ....+..+.+.   .+....+++|++++||||||||.++|.+++++|+++|++|+++||+||+|.++.|++.+.+.....
T Consensus       177 ~~~~~~~~~e~~~~~~~~~~~~~~~i~l~nP~NPTG~~~s~~~l~~l~~~a~~~~~~Ii~De~y~~~~~~~~~~~~~~~~  256 (432)
T 3ei9_A          177 NIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIP  256 (432)
T ss_dssp             TCEEEECCGGGTTSCCGGGCCCCSEEEEESSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTGGGCCSSCCSSGGGST
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCEECCCCCCCCCCCH
T ss_conf             34224579667200234541465589978987545545432002332233332212553032343100146655621000


Q ss_pred             HCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHH--------HHHHHHHCCCCHHHHHHHHHHHHH-HCCCHHHHHH
Q ss_conf             1026786899850400104631121143325899999--------998752036761245799999998-5652589999
Q T0591           237 AAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIAR--------MEKLQAIVSLRAAGYSQAVLRGWF-DEAPGWMEDR  307 (406)
Q Consensus       237 ~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~--------l~~~~~~~~~~~~~~~q~a~~~~l-~~~~~~~~~~  307 (406)
                        ...+++++++||||.|++||+|+||++++++++..        ..........+.+.+.|..+..+. .+..+++++.
T Consensus       257 --~~~~~~i~~~S~SK~~~~~GlRiG~~i~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~  334 (432)
T 3ei9_A          257 --GAEEVAMETASFSNYAGFTGVRLGWTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKV  334 (432)
T ss_dssp             --TGGGTEEEEEESHHHHCTTTTCCEEEECCTTCBCTTSCBHHHHHHHHHHHSCCCSCHHHHHHHHHHSSHHHHHHHHHH
T ss_pred             --HHCCCCCCCCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             --000233234565423365544413598189999976311334444202122356514554432200102445579999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCH
Q ss_conf             99999999999999972799455358873078776688788989999999986891896161026799985899850997
Q T0591           308 IARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDH  387 (406)
Q Consensus       308 ~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~  387 (406)
                      ++.++++++.+.+.|.+. |+++..|+||||+|+++|+  .++.+++.+|++++||.++||+.||..+++|+||||+.++
T Consensus       335 ~~~~~~~~~~l~~~L~~~-g~~~~~p~gg~f~w~~~p~--~~~~e~~~~ll~~~gV~v~PG~~F~~~~~~~iRis~~~~~  411 (432)
T 3ei9_A          335 IGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFPN--QSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHR  411 (432)
T ss_dssp             HHHHHHHHHHHHHHHHHT-TCCEEECSSSSEEEEECTT--SCHHHHHHHHHHHHCEECEEGGGGCGGGTTEEEEECCSCH
T ss_pred             HHHHHHHHHHHHHHHHHC-CCEEECCCCCEEEEEECCC--CCHHHHHHHHHHHCCEEEEECHHHCCCCCCEEEEEEECCH
T ss_conf             999999999999999987-9777369971499998999--9989999999985999999352208999896999970899


Q ss_pred             HHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999999856
Q T0591           388 EAAVAAARRIVTLVERYR  405 (406)
Q Consensus       388 e~l~~al~rl~~~~~~~r  405 (406)
                      |++++|++||+++++.+.
T Consensus       412 e~l~eal~Rl~~~~k~~~  429 (432)
T 3ei9_A          412 ENILEACRRFKQLYKHHH  429 (432)
T ss_dssp             HHHHHHHHHHHHHHTTSC
T ss_pred             HHHHHHHHHHHHHHCCCC
T ss_conf             999999999999824325


No 28 
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea; HET: PMP; 2.30A {Thermococcus litoralis}
Probab=100.00  E-value=0  Score=458.33  Aligned_cols=393  Identities=22%  Similarity=0.296  Sum_probs=315.0

Q ss_pred             CCHHHHHHHHCC--CCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHH-H-CCCCCCCCCC
Q ss_conf             974468887146--66615789988788999996303789833415678678878889999999999-8-0878888788
Q T0591             1 MSIEAKFKKLGT--DNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGV-Q-SGGVQAYTEY   76 (406)
Q Consensus         1 m~i~~~~~r~g~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~-~-~~~~~~Y~~~   76 (406)
                      |-++..+++.-.  ...+..++.+.+.+   +..   ...+.|||++|+||+..++...++++.+.+ . .+..++|++.
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~i~~~a~~---~~~---~G~~vi~l~~G~P~~~~~p~~~~~~~~~~~~~~~~~~~~Y~~~   74 (407)
T 2zc0_A            1 MDYTKYLAGRANWIKGSALADVMKKASE---LQK---KGVKLISLAAGDPDPELIPRAVLGEIAKEVLEKEPKSVMYTPA   74 (407)
T ss_dssp             CCGGGGSCGGGGGCCCCHHHHHHHHHHH---HHH---SSCCCEECCSCCCCTTTSCHHHHHHHHHHHHHHCGGGGSCCCT
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHH---HHH---CCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             9766899999820785899999999999---996---7998187889458962168999999999998559666776998


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECC
Q ss_conf             88988999999999986488678867078824872789999999972001010131055138999998299699986044
Q T0591            77 RGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDY  156 (406)
Q Consensus        77 ~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~  156 (406)
                      .|.++||++||+|+++++|..+++ ++|++|+|+++++..++++++++||.|+++.|+|+.+.......|++++.+|++.
T Consensus        75 ~G~~~lr~aia~~~~~~~~~~~~~-~~I~~~~G~~~~~~~~~~~~~~~g~~v~v~~p~~~~~~~~~~~~~~~~~~vp~~~  153 (407)
T 2zc0_A           75 NGIPELREELAAFLKKYDHLEVSP-ENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDN  153 (407)
T ss_dssp             TCCHHHHHHHHHHHHHHSCCCCCG-GGEEEESHHHHHHHHHHHHHCCTTCEEEEEESCCHHHHHHHHTTTCEEEEEEEET
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCH-HHEEEECCHHHHHHHHHHHHCCCCCCCEECCCCCCCHHHHHHHCCCCEEEEEECC
T ss_conf             561999999999999972999786-6889927899999999998458998421258876414566652376303465146


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHH
Q ss_conf             66677666778899999850254034215666432334437899999999863787578417502355688876522332
Q T0591           157 VSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAE  236 (406)
Q Consensus       157 ~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~  236 (406)
                      ...+...+..+...+.....+.+++++++|||||||.++|.+++++|+++|+++|++||+||+|+++.|++....+....
T Consensus       154 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~NPtG~~~s~e~~~~l~~~a~~~~i~iI~De~Y~~l~~~~~~~~~~~~~  233 (407)
T 2zc0_A          154 DGMRVDLLEEKIKELKAKGQKVKLIYTIPTGQNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKAL  233 (407)
T ss_dssp             TEECHHHHHHHHHHHHHTTCCEEEEEECCSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTTTSBSSCSSCCCGGGG
T ss_pred             CCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEECCHHHCCCCCCCCCCCCCC
T ss_conf             65542001346777764156644999768999986730689999999999997691899835312203588876641013


Q ss_pred             HCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCC---HHHHHHHHHHHH
Q ss_conf             10267868998504001046311211433258999999987520367612457999999985652---589999999999
Q T0591           237 AAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAP---GWMEDRIARHQA  313 (406)
Q Consensus       237 ~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~---~~~~~~~~~~~~  313 (406)
                         +.++.+++.|+||.+++||+|+||+++++++++++.++......+++.+.|.+++.++.++.   .+.+..+..+++
T Consensus       234 ---~~~~~i~~~s~sK~~~~~GlR~G~~v~~~~~i~~~~~~~~~~~~~~~~~~q~~a~~~l~~~~~~~~~~~~~~~~~~~  310 (407)
T 2zc0_A          234 ---DNEGRVIVAGTLSKVLGTGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKRGYFEKYHLEGALLGYKE  310 (407)
T ss_dssp             ---CSSCCEEEEEESTTTTCTTSCCEEEECCHHHHHHHHHHHTTTTSSSCHHHHHHHHHHHHTTHHHHHTTTTHHHHHHH
T ss_pred             ---CCCCCCCCCCCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             ---62125455687778868987632253589999999999776503688499999999997363356788888889999


Q ss_pred             HHHHHHHHHHH-CCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCC--CCCCEEEEEEC-CCHHH
Q ss_conf             99999999972-7994553588730787766887889899999999868918961610267--99985899850-99799
Q T0591           314 IRDELLHVLRG-CEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSP--HTADSVRLNFS-QDHEA  389 (406)
Q Consensus       314 ~r~~l~~~L~~-~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~--~~~~~iRis~~-~~~e~  389 (406)
                      +++.+.+.|.+ ..++.+..|+||+|+|+++|+ +.++.+++++|++++||.++||+.|+.  .+++|+|+||+ .++|+
T Consensus       311 r~~~~~~~l~~~~~~~~~~~p~gg~f~~~~l~~-~~~~~~~~~~ll~~~gV~v~PGs~F~~~~~~~~~iRis~~~~~~e~  389 (407)
T 2zc0_A          311 KRDIMLKALENHLPNAEFTKPIAGMFVMFFLPE-GADGISFANELMEREGVVVVPGKPFYTDESGKNAIRLNFSRPSKEE  389 (407)
T ss_dssp             HHHHHHHHHHHHCTTSCBCCCSBSSEEEEECST-TCCHHHHHHHHHHHTCEECBCSGGGCSSSCCTTEEEEECSSSCTTH
T ss_pred             HHHHHHHHHHHCCCCCEECCCCCCEEEEEECCC-CCCHHHHHHHHHHHCCEEEEECHHHCCCCCCCCEEEEEECCCCHHH
T ss_conf             999999999833898567279973599998999-9899999999999799999923552789998997999958799999


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999985
Q T0591           390 AVAAARRIVTLVERY  404 (406)
Q Consensus       390 l~~al~rl~~~~~~~  404 (406)
                      +++|++||++++++.
T Consensus       390 l~~al~rl~~~~~e~  404 (407)
T 2zc0_A          390 IPIGIKKLAKLYKEK  404 (407)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999998


No 29 
>1m7y_A ACC synthase, 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, pyridoxal phosphate, lyase; HET: PPG; 1.60A {Malus x domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1ynu_A* 1b8g_A*
Probab=100.00  E-value=0  Score=461.33  Aligned_cols=388  Identities=17%  Similarity=0.260  Sum_probs=303.0

Q ss_pred             HHHHCCCCCCHHHHHH-HHHHHHHHHHHHCCC---CCCEEECCCCCCCCCCCHHHHH-HHHHHHH-----CC------CC
Q ss_conf             8871466661578998-878899999630378---9833415678678878889999-9999998-----08------78
Q T0591             7 FKKLGTDNAPGQEVRQ-SAAGLEALIRGAPIE---GRPVDFSHGDVDAHEPTPGAFD-LFSAGVQ-----SG------GV   70 (406)
Q Consensus         7 ~~r~g~~~~~~~~~~~-~~~~~~~~~~~~~~~---~~~i~ls~G~pd~~~p~~~~~~-~~~~~~~-----~~------~~   70 (406)
                      ++|.|+.+...++... .+.+... .+.....   ...|+|++++..+-   .+.++ .+.+...     ..      ..
T Consensus         4 ~~~~~~~~~~~~~s~y~~g~~~~~-~~~y~~~~np~G~I~l~~aen~l~---~d~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (435)
T 1m7y_A            4 LSRNATFNSHGQDSSYFLGWQEYE-KNPYHEVHNTNGIIQMGLAENQLC---FDLLESWLAKNPEAAAFKKNGESIFAEL   79 (435)
T ss_dssp             CCSTTC-------CHHHHHHHHHH-HSBCCSSSCTTSBEECSSCCCCSC---HHHHHHHHHHCCTGGGTEETTEECHHHH
T ss_pred             HHHHHCCCCCCCCCCCHHHHHHHH-CCCCCCCCCCCCEEEECCCCCCCC---HHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             212222588777885043023553-599886669986799436767423---6778998861997666665455530886


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCC--CCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHH-HCC
Q ss_conf             88878888988999999999986488--678867078824872789999999972001010131055138999998-299
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGA--PVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEF-FEG  147 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~--~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~-~g~  147 (406)
                      .+|++..|.++||++||+|+++++|.  +++| ++|++|+|++++|++++.++++|||.|++++|+|+.|...+.. .|.
T Consensus        80 ~~Y~~~~G~~~LR~aiA~~~~~~~g~~~~~~p-e~I~it~G~~~al~~~~~~l~~pGd~Vlv~~P~y~~~~~~~~~~~g~  158 (435)
T 1m7y_A           80 ALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDP-NHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGV  158 (435)
T ss_dssp             HHCCCTTCCHHHHHHHHHHHHHHTTTSSCCCG-GGEEEEEHHHHHHHHHHHHHCCTTCEEEEEESCCTTHHHHTTTTTCC
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCH-HHEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHCCC
T ss_conf             17949816299999999999998589999884-21998489999999999997389898999089861078999995896


Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHHHC------CCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC
Q ss_conf             69998604466677666778899999850------254034215666432334437899999999863787578417502
Q T0591           148 EMVPVQLDYVSADETRAGLDLTGLEEAFK------AGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYS  221 (406)
Q Consensus       148 ~~v~v~~~~~~~~~~~~~~d~~~l~~~~~------~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~  221 (406)
                      +.++|+++    .+++|.+|++++++.+.      .+++++++||||||||.+++.+++++|+++|++++++||+||+|.
T Consensus       159 ~~v~v~~~----~~~~~~~d~~~l~~~~~~~~~~~~~~~~i~l~nP~NPtG~~~s~~~l~~i~~~a~~~~i~vI~De~Y~  234 (435)
T 1m7y_A          159 EIVPIHCT----SSNGFQITETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYS  234 (435)
T ss_dssp             EEEEEECC----GGGTSCCCHHHHHHHHHHHHHTTCCEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTG
T ss_pred             EEEEECCC----HHHCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             69985156----14214689999999988887615875899978999984412009999999752211787999972233


Q ss_pred             CCCCCCCCCCCHHHHHC--------CCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             35568887652233210--------2678689985040010463112114332589999999875203676124579999
Q T0591           222 RLRYAGASYTHLRAEAA--------VDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVL  293 (406)
Q Consensus       222 ~l~~~~~~~~~~~~~~~--------~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~  293 (406)
                      ++.|++.++.++.....        ...+++++++||||.|+++|+|+||++++++++........ ....+++..|.++
T Consensus       235 ~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~vi~l~s~SK~~~~~G~R~G~i~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  313 (435)
T 1m7y_A          235 GTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMS-SFGLVSSQTQHLL  313 (435)
T ss_dssp             GGCCSSSCCCCHHHHTTTTTCSSSSSGGGGEEEEEESSSSSCCGGGCEEEEEESCHHHHHHHHHHG-GGSCCCHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECCCHHHHCCCCEEEEEECCHHHHHHHHHHHH-CCCCCCCHHHHHH
T ss_conf             123468887788997422264323456614999945832220457579998578899999999974-4255665579999


Q ss_pred             HHHHHCC---CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCC-----CCHHHHHHHHHHHCCEEE
Q ss_conf             9998565---25899999999999999999997279945535887307877668878-----898999999998689189
Q T0591           294 RGWFDEA---PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLA-----VAPAEFVKILRLQAGVVV  365 (406)
Q Consensus       294 ~~~l~~~---~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~-----~~~~~~~~~Ll~~~gV~v  365 (406)
                      .+.+.+.   +.++.+.+..++++++.+.+.|++ .|+++..|+||||+|++++...     .++.+|+++|++++||.+
T Consensus       314 ~a~l~~~~~~~~~~~~~~~~~~~r~~~l~~~L~~-~gi~~~~p~gg~f~w~~l~~~~~~~~~~~~~~l~~~ll~~~gV~v  392 (435)
T 1m7y_A          314 SAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQK-SGISCLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNI  392 (435)
T ss_dssp             HHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHT-TTCEECCCCSSSEEEEECGGGSSSSSHHHHHHHHHHHHHTSCEEC
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH-CCCEEECCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCEEE
T ss_conf             9999733121444567789999999999999862-797773699505998988454466764379999999999789999


Q ss_pred             EECCCCCCCCCCEEEEEECC-CHHHHHHHHHHHHHHHHHHC
Q ss_conf             61610267999858998509-97999999999999999856
Q T0591           366 TPGTEFSPHTADSVRLNFSQ-DHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       366 ~pG~~Fg~~~~~~iRis~~~-~~e~l~~al~rl~~~~~~~r  405 (406)
                      +||+.|+..+++|+|++|+. +++++++|++||++++++|+
T Consensus       393 ~PG~~F~~~~~g~iRi~~a~~~~~~l~~al~Rl~~~l~e~~  433 (435)
T 1m7y_A          393 SPGSSCHCTEPGWFRVCFANLPERTLDLAMQRLKAFVGEYY  433 (435)
T ss_dssp             EEGGGGTCSSTTEEEEECSSSCHHHHHHHHHHHHHHHHHHC
T ss_pred             ECCHHCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             80500289998979999585999999999999999999714


No 30 
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis W83}
Probab=100.00  E-value=0  Score=460.66  Aligned_cols=391  Identities=15%  Similarity=0.125  Sum_probs=314.6

Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             44688871466661578998878899999630378983341567867887888999999999980878888788889889
Q T0591             3 IEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGI   82 (406)
Q Consensus         3 i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~L   82 (406)
                      |.++++.+...+...+.+++...-...+.+.  ...+.|+|++|+||++.| +.+++++.+++.++..++|++..|.++|
T Consensus        11 ~~~~~~~~~~~~l~~~~~r~~~~~~~~~~~~--~g~~vi~l~~G~pd~~~P-~~~~~~~~~~~~~~~~~~Y~~~~G~~~l   87 (437)
T 3g0t_A           11 IREKQNELHIKDLGMASIRDLVALVTNLEKA--TGTKFCRMEMGVPGLPAP-QIGIETEIQKLREGVASIYPNLDGLPEL   87 (437)
T ss_dssp             HHHHHHHHTCSCGGGCCHHHHHHHHHHHHHH--HTCCCEECCCCSCCSCCC-HHHHHHHHHHHHHTGGGSCCCTTCCHHH
T ss_pred             HHHHCCHHHHHCCCCCHHHHHHHHHHHHHHH--CCCCEEECCCCCCCCCCC-HHHHHHHHHHHCCCCCCCCCCCCCCHHH
T ss_conf             8610002101026810589999999898983--799627789979899876-9999999999749987888997473999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHH----HCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCC
Q ss_conf             9999999998648867886707882487278999999997----200101013105513899999829969998604466
Q T0591            83 RDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATV----ARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVS  158 (406)
Q Consensus        83 r~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~----~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~  158 (406)
                      |++||+|+.+++|+++++ ++|++|+|+++++..++.+++    ++||.|++++|+|+.|...++.+|++++++++.   
T Consensus        88 r~aia~~~~~~~g~~~~~-~~I~vt~G~~~~l~~a~~~~~~~~~~~gd~vli~~P~y~~y~~~~~~~g~~~~~v~~~---  163 (437)
T 3g0t_A           88 KQEASRFAKLFVNIDIPA-RACVPTVGSMQGCFVSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLF---  163 (437)
T ss_dssp             HHHHHHHHHHHHCCCCCG-GGEEEESHHHHHHHHHHHHHTTSCTTCSCCEEEEESCCHHHHHHHHHHTCCCEEEEGG---
T ss_pred             HHHHHHHHHHHHCCCCCH-HHEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCCCCCCC---
T ss_conf             999999998986889867-8599847928999999999986178999989991697416899999817755567763---


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHH---
Q ss_conf             67766677889999985025403421566643233443789999999986378757841750235568887652233---
Q T0591           159 ADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRA---  235 (406)
Q Consensus       159 ~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~---  235 (406)
                       +++++.++.+.++...+++++++++||||||||.++|.+++++|+++|++||++||+||+|+++.|++....+...   
T Consensus       164 -~~~~~~~~~~~~~~~~~~~~~~ii~~~P~NPTG~~~s~~~~~~i~~~a~~~~~~ii~De~Y~~l~f~~~~~~~~~~~~~  242 (437)
T 3g0t_A          164 -EYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYSHPGEPLYQ  242 (437)
T ss_dssp             -GGCTTHHHHHHHHHHTTTCCCEEEEESSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTTTCCTTSCCCSTTSSCCC
T ss_pred             -CCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCHHCCCCCCCCCCCCCCCC
T ss_conf             -1001131588999851589559998699698775555441477776530234644454331000026766776432111


Q ss_pred             -HHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHH------------------HHHCCCCHHHHHHHHHHHH
Q ss_conf             -210267868998504001046311211433258999999987------------------5203676124579999999
Q T0591           236 -EAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKL------------------QAIVSLRAAGYSQAVLRGW  296 (406)
Q Consensus       236 -~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~------------------~~~~~~~~~~~~q~a~~~~  296 (406)
                       ......+++|+++||||.|++||||+||+++|+++++++...                  ......+++.+.|.++..+
T Consensus       243 ~~~~~~~~~~i~~~S~SK~~~~~G~R~G~i~~~~~~i~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~q~~~~~~  322 (437)
T 3g0t_A          243 PSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESFGRLRFGEALSSSALYALSSGATHSAQWGMAAM  322 (437)
T ss_dssp             CCGGGTCSCEEEEEESTTTTSCGGGCCEEEEECHHHHHCBCGGGHHHHSCSBHHHHHHTTHHHHHHSSSCHHHHHHHHHH
T ss_pred             HHHHCCCCEEEEEEECCHHCCCCCCCEEEEEECHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             33405577699998581422893616699998899999999999999877655401242345543126775999999999


Q ss_pred             HH---CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEE-----CCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEEC
Q ss_conf             85---652589999999999999999999727994553-----5887307877668878898999999998689189616
Q T0591           297 FD---EAPGWMEDRIARHQAIRDELLHVLRGCEGVFAR-----TPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPG  368 (406)
Q Consensus       297 l~---~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~-----~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG  368 (406)
                      ++   +...++++.+..|+++|+.+.+.|.+. |+...     .|.+|+|+|++++..+.++.+|+.+|++ +|++++|+
T Consensus       323 l~~~~~~~~~~~~~~~~y~~rr~~l~~~L~~~-g~~~~~~~~~~~~~g~~~~~~l~~~~~d~~e~~~~ll~-~g~~~vp~  400 (437)
T 3g0t_A          323 LKACNDGEYNFRDSVIEYGRKARIMKKMFLDN-GFNIVYDKDGNEPLADGFYFTVGYKGMDSSKLIEKFVR-YGMCAITL  400 (437)
T ss_dssp             HHHHHTTSCCHHHHHHHHHHHHHHHHHHHHTT-TEEESSCEETTEECCSSSEEEEEETTCCHHHHHHHHHH-TTEECEES
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCCCEEEEEEECCCCCCCHHHHHHHHHH-CCCEEECC
T ss_conf             86440239999999999999999999999975-98555677778885589999878999899999999997-09899817


Q ss_pred             CCCCCCCCCEEEEEEC-CCHHHHHHHHHHHHHHHHH
Q ss_conf             1026799985899850-9979999999999999998
Q T0591           369 TEFSPHTADSVRLNFS-QDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       369 ~~Fg~~~~~~iRis~~-~~~e~l~~al~rl~~~~~~  403 (406)
                      ..||.....++|+|++ .+++++.++.+||+.+-.+
T Consensus       401 ~~~g~~~~~~lRi~~s~~~e~~i~~l~~rL~~L~~e  436 (437)
T 3g0t_A          401 KTTGSKRNEAMRICTSLLPESQFPDLEKRLQMLNAE  436 (437)
T ss_dssp             TTTTCCCTTCEEEECSSSCGGGHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHC
T ss_conf             877888999799996789988999999999888738


No 31 
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, lyase; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A*
Probab=100.00  E-value=0  Score=465.28  Aligned_cols=354  Identities=15%  Similarity=0.283  Sum_probs=290.7

Q ss_pred             CCEEECCCCCCCCCCCHHHHH-HHHHHH---------H-CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC--CCCCCEEE
Q ss_conf             833415678678878889999-999999---------8-0878888788889889999999999864886--78867078
Q T0591            39 RPVDFSHGDVDAHEPTPGAFD-LFSAGV---------Q-SGGVQAYTEYRGDLGIRDLLAPRLAAFTGAP--VDARDGLI  105 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~-~~~~~~---------~-~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~--~~~~~~I~  105 (406)
                      ..|+++.++++...   +..+ .+....         . .....+|++.+|.++||++||+|+++++|..  +++ ++|+
T Consensus        37 ~~i~~~~~~~~~~~---~~~~~~~~~~p~~~~~~~~~~~~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~i~~~~-e~I~  112 (428)
T 1iay_A           37 GVIQMGLAENQLCL---DLIEDWIKRNPKGSICSEGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDP-ERVV  112 (428)
T ss_dssp             SBEECSSCCCCSSH---HHHHHHHHHCTTSSTTC----CHHHHHHCCCTTCCHHHHHHHHHHHHHHTTTCSCCCT-TSCE
T ss_pred             CEEEECCCCCCCCH---HHHHHHHCCCHHHHHHHHHHHCCHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCH-HHEE
T ss_conf             74771467875441---3456554048167899875417834258999837099999999999998599999875-4499


Q ss_pred             EECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHH-HCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC------CC
Q ss_conf             824872789999999972001010131055138999998-29969998604466677666778899999850------25
Q T0591           106 ITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEF-FEGEMVPVQLDYVSADETRAGLDLTGLEEAFK------AG  178 (406)
Q Consensus       106 it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~-~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~------~~  178 (406)
                      +|+|+++++.++++++++|||+|++++|+|+.|...+.. .|.++++|+++    .+++|.+|.+.+++.+.      ++
T Consensus       113 it~G~~~al~~~~~~l~~~Gd~Vlv~~P~y~~y~~~~~~~~g~~~v~v~~~----~~~~~~~~~~~l~~~~~~~~~~~~~  188 (428)
T 1iay_A          113 MAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCE----SSNNFKITSKAVKEAYENAQKSNIK  188 (428)
T ss_dssp             EEEHHHHHHHHHHHHHCCTTCEEEEESSCCTTHHHHTTTTTCCEEEEECCC----TTTTTCCCHHHHHHHHHHHHHTTCC
T ss_pred             EECCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCEEEEEECC----CCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             938999999999999759969899828981889999999679758986324----4457643510335677777523788


Q ss_pred             CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHC------CCCCCEEEEEECCH
Q ss_conf             403421566643233443789999999986378757841750235568887652233210------26786899850400
Q T0591           179 ARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAA------VDAENVVTIMGPSK  252 (406)
Q Consensus       179 ~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~------~~~~~~i~~~S~SK  252 (406)
                      +|++++||||||||.++|.+++++|+++|++|+++||+||+|+++.|++.++.++.....      ...+++|+++||||
T Consensus       189 ~k~i~l~~P~NPtG~~~s~~~~~~l~~~a~~~~~~ii~De~y~~~~~~~~~~~s~~~~~~~~~~~~~~~~~vi~~~S~SK  268 (428)
T 1iay_A          189 VKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDEQEMTYCNKDLVHIVYSLSK  268 (428)
T ss_dssp             EEEEEEESSCTTTCCCCCHHHHHHHHHHHHTTTCEEEEECTTGGGCCSSSCCCCHHHHHTSGGGTTSCTTSEEEEEESTT
T ss_pred             CEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHCHHHHHCCCCCCCEEEECCCHH
T ss_conf             26999878999986024168899987324551699998444333334665676877736043200235774799802704


Q ss_pred             HCCCCCCCCHHHHHH-HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC---CHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             104631121143325-899999998752036761245799999998565---2589999999999999999999727994
Q T0591           253 TESLSGYRLGVAFGS-RAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA---PGWMEDRIARHQAIRDELLHVLRGCEGV  328 (406)
Q Consensus       253 ~~~~~GlRiG~~~~~-~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~---~~~~~~~~~~~~~~r~~l~~~L~~~~g~  328 (406)
                      .|++||||+||++++ +.+++.+.++++.  ...+++.|.++..++...   +.++++.++.++++++.+.+.|.. .|+
T Consensus       269 ~~~~~GlRiG~~~~~~~~~~~~~~~~~~~--~~~~~~~q~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~-~gi  345 (428)
T 1iay_A          269 DMGLPGFRVGIIYSFNDDVVNCARKMSSF--GLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEV-VGI  345 (428)
T ss_dssp             TSSCGGGCEEEEEESCHHHHHHHHHHHTT--SCCCHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-TTC
T ss_pred             HCCCCCCCEEEEEEEHHHHHHHHHHHHCC--CCCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCC
T ss_conf             10796613799997059999999997156--888868999999999670327888999999999999999999861-898


Q ss_pred             EEECCCCCEEEEEECCCCC-----CCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECC-CHHHHHHHHHHHHHHHH
Q ss_conf             5535887307877668878-----89899999999868918961610267999858998509-97999999999999999
Q T0591           329 FARTPQAGSYLFPRLPKLA-----VAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQ-DHEAAVAAARRIVTLVE  402 (406)
Q Consensus       329 ~~~~p~gg~~~w~~~~~~~-----~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~-~~e~l~~al~rl~~~~~  402 (406)
                      ++..|+||||+|++++...     .++.+|++.|++++||.++||+.||..+++|+||||+. +++++++|++||++++.
T Consensus       346 ~~~~p~gg~f~w~~l~~~~~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~~~~~iRis~~~~~~~~l~~al~ri~~~lg  425 (428)
T 1iay_A          346 KCLKNNAGLFCWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDIALARIRRFVG  425 (428)
T ss_dssp             CBCCCSSSSEEEEECGGGCSSSSHHHHHHHHHHHHHTSCEECEEGGGGTCSSSSEEEEECSSSCHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCEEEEEECCCHHCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             88358963599897731004577889999999999869999982233089999979999567999999999999999967


Q ss_pred             H
Q ss_conf             8
Q T0591           403 R  403 (406)
Q Consensus       403 ~  403 (406)
                      .
T Consensus       426 ~  426 (428)
T 1iay_A          426 V  426 (428)
T ss_dssp             T
T ss_pred             C
T ss_conf             6


No 32 
>1vp4_A Aminotransferase, putative; TM1131, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima MSB8} SCOP: c.67.1.1
Probab=100.00  E-value=0  Score=457.64  Aligned_cols=382  Identities=22%  Similarity=0.325  Sum_probs=310.1

Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCH-HHHHHHHHHHHCC--CCCCCCCCCCC
Q ss_conf             44688871466661578998878899999630378983341567867887888-9999999999808--78888788889
Q T0591             3 IEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTP-GAFDLFSAGVQSG--GVQAYTEYRGD   79 (406)
Q Consensus         3 i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~-~~~~~~~~~~~~~--~~~~Y~~~~G~   79 (406)
                      ++.|+++.+....+ +.+++       +.+. ...++.|+|+.|.||+..+++ .+.+++.+.+...  ...+|++..|.
T Consensus        17 ~~~~~s~~~~~~~~-s~ir~-------~~~~-~~~~~~I~l~~G~Pd~~~~P~~~l~~~~~~~~~~~~~~~~~Y~~~~G~   87 (425)
T 1vp4_A           17 LEGKISKIGQNMKS-SIIRE-------ILKF-AADKDAISFGGGVPDPETFPRKELAEIAKEIIEKEYHYTLQYSTTEGD   87 (425)
T ss_dssp             HHHHCCHHHHTCCC-CCHHH-------HTTT-TTSTTCEECCCCSCCGGGSCHHHHHHHHHHHHHHSHHHHTSCCCTTCC
T ss_pred             HHHHHHHHHHHCCC-CHHHH-------HHHH-HCCCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             89998699873897-39999-------9998-579997889985889653898999999999985387434688998677


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCC
Q ss_conf             88999999999986488678867078824872789999999972001010131055138999998299699986044666
Q T0591            80 LGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSA  159 (406)
Q Consensus        80 ~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~  159 (406)
                      ++||++||+|+++++|++..++++|++|+|+++++.+++.++++|||.|++++|+|+.|...++.+|++++.++.+..  
T Consensus        88 ~~LR~aia~~~~~~~g~~~~~~~~I~it~G~~~al~~~~~~l~~~Gd~Vlv~~P~y~~~~~~~~~~g~~~~~v~~~~~--  165 (425)
T 1vp4_A           88 PVLKQQILKLLERMYGITGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPLEDD--  165 (425)
T ss_dssp             HHHHHHHHHHHHHHHCCCSCCGGGEEEEEHHHHHHHHHHHHHCCTTCEEEEEESCCHHHHHHHHTTTCEEEEEEEETT--
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCC--
T ss_conf             999999999999984999999315999154146677777653113442333344443201345432011223345432--


Q ss_pred             CCCCCCCCHHHHHHHH---------CCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCC
Q ss_conf             7766677889999985---------0254034215666432334437899999999863787578417502355688876
Q T0591           160 DETRAGLDLTGLEEAF---------KAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASY  230 (406)
Q Consensus       160 ~~~~~~~d~~~l~~~~---------~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~  230 (406)
                           +.+++.++...         +..+.+++++|||||||.+++.+++++++++|++|++++|+||+|.+|.|++...
T Consensus       166 -----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~NPtG~~~s~~~~~~l~~~a~~~~~~ii~De~Y~~l~~~~~~~  240 (425)
T 1vp4_A          166 -----GMDLNVLERKLSEFDKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETV  240 (425)
T ss_dssp             -----EECHHHHHHHHHHHHHTTCGGGEEEEEEECSSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEECSSTTCBCSSCCC
T ss_pred             -----CCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCCCHHHHHCCCCCC
T ss_conf             -----233102333234566776415764577606899875057740035565554330244433342102000123455


Q ss_pred             CCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHH
Q ss_conf             5223321026786899850400104631121143325899999998752036761245799999998565--25899999
Q T0591           231 THLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRI  308 (406)
Q Consensus       231 ~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~  308 (406)
                      .+....  ...+++|+++|+||.++ ||||+||+++++++++++.+.+.....+++++.|.+++.++.+.  .+++++.+
T Consensus       241 ~~~~~~--~~~~~~i~~~s~sK~~~-~G~RiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~~~a~~l~~~~~~~~~~~~~  317 (425)
T 1vp4_A          241 DPIFKI--GGPERVVLLNTFSKVLA-PGLRIGMVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYDLLEQLKPTI  317 (425)
T ss_dssp             CCHHHH--HCTTTEEEEEESTTTTC-GGGCEEEEECCHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHSCHHHHTHHHH
T ss_pred             CCCCCC--CCCCCCEEEEECCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             653222--45653138840365556-645533234553032233433231024677045677777622454214566789


Q ss_pred             HHHHHHHHHHHHHHHH----CCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCC--CCEEEEE
Q ss_conf             9999999999999972----799455358873078776688788989999999986891896161026799--9858998
Q T0591           309 ARHQAIRDELLHVLRG----CEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHT--ADSVRLN  382 (406)
Q Consensus       309 ~~~~~~r~~l~~~L~~----~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~--~~~iRis  382 (406)
                      ..|+++++.+.+.|.+    ++|+++..|+||||+|+++|+ +.++.++++.| .++||.++||+.|+..+  .+|+|+|
T Consensus       318 ~~~~~~~~~~~~~l~~~l~~~~g~~~~~p~gg~f~~~~~p~-~~d~~~~~~~l-~~~gV~v~PG~~F~~~~~~~~~iRls  395 (425)
T 1vp4_A          318 ELYRRKRTVMLNALEEYFSDIPGVKWVKSEGGLFIWLTLPE-GFDTWEMFEYA-KRKKVFYVPGRVFKVYDEPSPSMRLS  395 (425)
T ss_dssp             HHHHHHHHHHHHHHHHHSTTSTTCEECCCSBSSEEEEECCT-TCCTTTTHHHH-HHHTEECEEGGGGCTTCCCCSEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCEECCCCCEEEEEEECCC-CCCHHHHHHHH-HHCCEEEEECHHHCCCCCCCCEEEEE
T ss_conf             99888888877777654124788366179944799998999-99999999999-97996998114528899989989999


Q ss_pred             EC-CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             50-997999999999999999856
Q T0591           383 FS-QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       383 ~~-~~~e~l~~al~rl~~~~~~~r  405 (406)
                      |+ .++|++++|++||++++++|+
T Consensus       396 ~~~~~~e~l~~a~~rl~~~l~e~~  419 (425)
T 1vp4_A          396 FCLPPDEKIVEGIKRLREVVLEYG  419 (425)
T ss_dssp             CSSSCHHHHHHHHHHHHHHHHHHH
T ss_pred             ECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             584999999999999999999851


No 33 
>3if2_A Aminotransferase; YP_265399.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4}
Probab=100.00  E-value=0  Score=456.77  Aligned_cols=391  Identities=16%  Similarity=0.195  Sum_probs=305.8

Q ss_pred             CCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCC----------
Q ss_conf             9744688871466661578998878899999630378983341567867887888999999999980878----------
Q T0591             1 MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGV----------   70 (406)
Q Consensus         1 m~i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~----------   70 (406)
                      |.++..-+|+. ....   +.+...+   +..........|+|+.|+|+..+++...+.+..+.+.....          
T Consensus         2 m~~s~~~~~~~-~~~~---i~~l~~~---l~~~~~~~~~~i~l~~G~P~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~   74 (444)
T 3if2_A            2 MKFSKFGQKFT-QPTG---ISQLMDD---LGDALKSDQPVNMLGGGNPAKIDAVNELFLETYKALGNDNDTGKANSSAII   74 (444)
T ss_dssp             CCCCHHHHHHH-SCCH---HHHHHHH---HHHHHHSSSCCEECSCCCCCCCHHHHHHHHHHHHHHHSCSCTTCCCCHHHH
T ss_pred             CCHHHHHHHHH-CCCC---HHHHHHH---HHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHCCC
T ss_conf             86607888741-5453---9999999---987875799868899989888987679999999986175434555442032


Q ss_pred             --CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHH---------------CCHHHHHHHC
Q ss_conf             --88878888988999999999986488678867078824872789999999972---------------0010101310
Q T0591            71 --QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVA---------------RGDKVAIVQP  133 (406)
Q Consensus        71 --~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~---------------pGd~Vl~~~P  133 (406)
                        .+|++..|.++||++||+|+++++|+++++ ++|++|+|++++|.++++++++               +||.|++++|
T Consensus        75 ~~~~Y~~~~G~~~lr~aia~~~~~~~g~~~~~-e~I~it~G~~~al~~~~~~l~~~~~~~~~~~~~~~~~~~~~vl~~~P  153 (444)
T 3if2_A           75 SMANYSNPQGDSAFIDALVGFFNRHYDWNLTS-ENIALTNGSQNAFFYLFNLFGGAFVNEHSQDKESKSVDKSILLPLTP  153 (444)
T ss_dssp             HHHSCCCTTCCHHHHHHHHHHHHHHHCCCCCG-GGEEEESSHHHHHHHHHHHSSEEEECC-------CEEEEEEEESSSS
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCC-CCEEEECCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCC
T ss_conf             12628998679999999999999985899981-02999688899999999999742024432222234799968996787


Q ss_pred             CCHHHHHHHHHHCCEEEEEEECCCCC--C---CCCCCCCHHHHHH---HHCCCCEEEECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             55138999998299699986044666--7---7666778899999---85025403421566643233443789999999
Q T0591           134 DYFANRKLVEFFEGEMVPVQLDYVSA--D---ETRAGLDLTGLEE---AFKAGARVFLFSNPNNPAGVVYSAEEIGQIAA  205 (406)
Q Consensus       134 ~y~~~~~~~~~~g~~~v~v~~~~~~~--~---~~~~~~d~~~l~~---~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~  205 (406)
                      +|+.|...+...|...+.+|+.....  .   ...+++|++++++   ..++++|++++||||||||.++|.+++++|++
T Consensus       154 ~y~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~d~e~le~~~~~~~~~~k~i~l~nP~NPTG~~~s~~~l~~l~~  233 (444)
T 3if2_A          154 EYIGYSDVHVEGQHFAAVLPHIDEVTHDGEEGFFKYRVDFEALENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAE  233 (444)
T ss_dssp             CCGGGTTCCSSSCCEEECCCEEEEEEETTEEEEEEEECCHHHHHTCHHHHTTCEEEEEEESSCTTTCCCCCHHHHHHHHH
T ss_pred             CCHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHH
T ss_conf             65338999998698577523402456662125664326799999999716889659998999699680278999999987


Q ss_pred             HHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             98637875784175023556888765223321026786899850400104631121143325899999998752036761
Q T0591           206 LAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRA  285 (406)
Q Consensus       206 ~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~  285 (406)
                      +|++||++||+||+|+++.+++.....    .....+++|+++|+|| |++||||+||+++++++++.+.+++.....++
T Consensus       234 ~a~~~~~~iI~De~y~~~~~~~~~~~~----~~~~~~~vi~~~s~SK-~~~~G~RiG~~v~~~~~i~~~~~~~~~~~~~~  308 (444)
T 3if2_A          234 IAKRYDIPLIIDNAYGMPFPNIIYSDA----HLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAP  308 (444)
T ss_dssp             HHHHTTCCEEEECTTCTTTTCCBCSCC----CCCCCTTEEEEEESTT-TTCGGGCCEEEECCHHHHHHHHHHHHHHHSSC
T ss_pred             HHHCCCEEEEEECCCCCCCCCCCHHHH----CCCCCCEEEEECCCCC-CCCCCCCEEHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             754042168866454433455411110----0145640444125554-45677740054521999999997521036665


Q ss_pred             HHHHHHHHHHHHHCCC--HHH-HHHHHHHHHHHHHHHHHHHHCC---CCEEECCCCCEEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             2457999999985652--589-9999999999999999997279---945535887307877668878898999999998
Q T0591           286 AGYSQAVLRGWFDEAP--GWM-EDRIARHQAIRDELLHVLRGCE---GVFARTPQAGSYLFPRLPKLAVAPAEFVKILRL  359 (406)
Q Consensus       286 ~~~~q~a~~~~l~~~~--~~~-~~~~~~~~~~r~~l~~~L~~~~---g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~  359 (406)
                      +.+.|.++..++....  .+. ...+..++++++.+.+.|.+..   ++.+..|+||||+|+++++...++.+|+..| .
T Consensus       309 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~p~gg~~~~~~~~~~~~~~~~~~~~l-~  387 (444)
T 3if2_A          309 TRFGAAIATPLVANDRIKQLSDNEIKPFYQKQATLAVKLLKQALGDYPLMIHKPEGAIFLWLWFKDLPISTLDLYERL-K  387 (444)
T ss_dssp             CCHHHHHHHHHHHTSHHHHHHHHTHHHHHHHHHHHHHHHHHHHSSSSSEEEECCCBSSEEEEEETTCSSCHHHHHHHH-H
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCHHHHHHHH-H
T ss_conf             569999999975201455668888998899999999999997525168368258940799998899998999999999-9


Q ss_pred             HCCEEEEECCCCCCC--------CCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             689189616102679--------9985899850997999999999999999856
Q T0591           360 QAGVVVTPGTEFSPH--------TADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       360 ~~gV~v~pG~~Fg~~--------~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      ++||+++||+.|++.        +++|+|+||+.++|++++|++||+++++++.
T Consensus       388 ~~gv~v~pg~~f~~g~~~~~~~~~~~~vRls~~~~~e~l~~~i~~l~~~l~~l~  441 (444)
T 3if2_A          388 AKGTLIVPSEYFFPGVDVSDYQHAHECIRMSIAADEQTLIDGIKVIGEVVRELY  441 (444)
T ss_dssp             HTTEECEEGGGSCTTCCCTTCSGGGSEEEEESSSCHHHHHHHHHHHHHHHHHHH
T ss_pred             HCCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHH
T ss_conf             689099976002775333566778997999955899999999999999999986


No 34 
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.19A {Helicobacter pylori 26695}
Probab=100.00  E-value=0  Score=452.73  Aligned_cols=356  Identities=19%  Similarity=0.185  Sum_probs=293.3

Q ss_pred             HHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEE
Q ss_conf             99996303789833415678678878889999999999808788887888898899999999998648867886707882
Q T0591            28 EALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIIT  107 (406)
Q Consensus        28 ~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it  107 (406)
                      .++..........||||+|+||+++| +.+.+++++.+.  ..++|++..|.++||++||+|+++++|..+++ ++|++|
T Consensus        13 ~~l~~~~~~~~~~I~l~~g~pd~~~p-~~i~~a~~~~~~--~~~~Y~~~~G~~~lR~aia~~~~~~~~~~~~~-~~i~it   88 (376)
T 3ezs_A           13 RALLKEITPKKRGLDLGIGEPQFETP-KFIQDALKNHTH--SLNIYPKSAFEESLRAAQRGFFKRRFKIELKE-NELIST   88 (376)
T ss_dssp             HHHHTTCCCSSCCCBCSSCCCCSCCC-HHHHHHHHTTGG--GGGSCCCTTCCHHHHHHHHHHHHHHHSCCCCG-GGEEEE
T ss_pred             HHHHHHHCCCCCEEECCCCCCCCCCC-HHHHHHHHHHHH--CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCH-HHEEEC
T ss_conf             99986445898847796999989777-999999998763--77779988577999999999999985899975-768974


Q ss_pred             CCCCHHHHHHHHH--HHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             4872789999999--97200101013105513899999829969998604466677666778899999850254034215
Q T0591           108 PGTQGALFLAVAA--TVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFS  185 (406)
Q Consensus       108 ~G~~~~l~~~~~~--l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~  185 (406)
                      +|+++++..++..  ++++||.|++++|+|..+...+...|...+.++.+...    .+..+.+   .+..+++|++++|
T Consensus        89 ~G~~~al~~i~~~~~~~~~~~~Vl~p~P~y~~~~~~~~~~~~~~v~~~~~~~~----~~~~~~~---~~~~~~~~~~il~  161 (376)
T 3ezs_A           89 LGSREVLFNFPSFVLFDYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKEN----DFTPSLN---EKELQEVDLVILN  161 (376)
T ss_dssp             SSSHHHHHHHHHHHTTTCSSCEEEEEESCCTHHHHHHHHTTCEEEEEECCGGG----TSCCCCC---HHHHHHCSEEEEC
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCEEEECCCCCCC----CCCCHHH---HHHCCCCCEEEEC
T ss_conf             78799999999998624799989978874620366787627604512543345----4430378---8750687389989


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHH---HHHCCCCCCEEEEEECCHHCCCCCCCCH
Q ss_conf             6664323344378999999998637875784175023556888765223---3210267868998504001046311211
Q T0591           186 NPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLR---AEAAVDAENVVTIMGPSKTESLSGYRLG  262 (406)
Q Consensus       186 ~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~---~~~~~~~~~~i~~~S~SK~~~~~GlRiG  262 (406)
                      |||||||.+++.+++++|+++|++|+++||+||+|.++.|++..+....   .......+++|+++|+||.|++||+|+|
T Consensus       162 nP~NPtG~~~s~~~l~~i~~~~~~~~~~ii~De~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~s~SK~~~~~GlR~G  241 (376)
T 3ezs_A          162 SPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEACMLAGNEAFKNVLVIHSLSKRSSAPGLRSG  241 (376)
T ss_dssp             SSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTTTCBSSSCCCCHHHHHHHTTCTTCTTEEEEEESTTTTTCGGGCCE
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCHHHHCCCCCCCCHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCEE
T ss_conf             99798774530778999986221567489942762442068988733331101364456878999525324668764310


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEE
Q ss_conf             43325899999998752036761245799999998565258999999999999999999972799455358873078776
Q T0591           263 VAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPR  342 (406)
Q Consensus       263 ~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~  342 (406)
                      |+++++++++.+.+.+....++++++.|..+..+... +.+.+..+..++++++.+.+.+.+     +..|+||||+|++
T Consensus       242 ~~~~~~~~i~~l~~~~~~~~~~~~~~~~~~a~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~~-----~~~~~g~~~~~~~  315 (376)
T 3ezs_A          242 FIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLD-DRHAEFFRNIYANNLKLARKIFKN-----TLIYPYSFYVYLP  315 (376)
T ss_dssp             EEEECHHHHHHHHHHHTTTCCCCCHHHHHHHHHHHHC-SHHHHHHHHHHHHHHHHHHHHSTT-----CCCCSBSSEEEEE
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHC-----CCCCCCEEEEEEE
T ss_conf             0008999999999999863775647999999999739-588999999999999999997532-----5789955899964


Q ss_pred             CCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC--CCCEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             68878898999999998689189616102679--998589985099799999999999999985
Q T0591           343 LPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH--TADSVRLNFSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       343 ~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~--~~~~iRis~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      ++    ++.+|+++|++++||+++||+.||..  +++|+||||+.++|++++|++||++++++|
T Consensus       316 ~~----~~~~~~~~Ll~e~gV~v~PG~~Fg~~~~g~~~iRis~~~~~e~l~~al~rl~~~~e~h  375 (376)
T 3ezs_A          316 VQ----NGENFAKTLYQNEGIITLPALYLGRNRIGADYVRLALVYDTPLLEKPLEIIETYRENH  375 (376)
T ss_dssp             CS----CHHHHHHHHHHHHCCBCEEGGGGCSTTTTTTEEEEECCSCHHHHHHHHHHHHHHHCC-
T ss_pred             CC----CHHHHHHHHHHHCCEEEECCHHHCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHC
T ss_conf             79----9999999999859999981044289988899699997188999999999999999966


No 35 
>3ele_A Amino transferase; RER070207001803, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PLP; 2.10A {Eubacterium rectale}
Probab=100.00  E-value=0  Score=449.20  Aligned_cols=383  Identities=22%  Similarity=0.291  Sum_probs=312.4

Q ss_pred             CCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCC---CCCCCCCC
Q ss_conf             974468887146666157899887889999963037898334156786788788899999999998087---88887888
Q T0591             1 MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGG---VQAYTEYR   77 (406)
Q Consensus         1 m~i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~---~~~Y~~~~   77 (406)
                      |-++|++.++++.....+++...+....+...    ....||||+|+||++. ++.+.+++.+.+.+..   .++|++..
T Consensus         2 ~~~~e~~~~~~~~~~~i~~~~~~~~~~~~~~g----~~~vi~ls~G~p~~~~-p~~v~~a~~~~~~~~~~~~~~~Y~~~~   76 (398)
T 3ele_A            2 MVVNESMYQLGSVRSAIRELFEYGKKRAAIVG----KENVYDFSIGNPSIPA-PQIVNDTIKELVTDYDSVALHGYTSAQ   76 (398)
T ss_dssp             CSSCHHHHHHHHCCCHHHHHHHHHHHHHHHHC----GGGCEECCSCCCCSCC-CHHHHHHHHHHHHHSCHHHHHSCCCTT
T ss_pred             CCHHHHHHHCCCCCCHHHHHHHHHHHHHHHCC----CCCEEECCCCCCCCCC-CHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             84679998737887589999999999888639----9986899998999998-999999999998576555666989987


Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCC-HHHHHHHCCCHHHHHHHHHHCCEEEEEEECC
Q ss_conf             898899999999998648867886707882487278999999997200-1010131055138999998299699986044
Q T0591            78 GDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARG-DKVAIVQPDYFANRKLVEFFEGEMVPVQLDY  156 (406)
Q Consensus        78 G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pG-d~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~  156 (406)
                      |+++||++||+|+++++|+++++ ++|++|+|++++|.+++.+++++| |.|+++.|+|+.|.......|...+.++.  
T Consensus        77 G~~~lR~aia~~l~~~~g~~~~~-d~I~it~G~~~al~~~~~~l~~~g~d~vi~~~~~~~~~~~~~~~~~~~~~~~~~--  153 (398)
T 3ele_A           77 GDVETRAAIAEFLNNTHGTHFNA-DNLYMTMGAAASLSICFRALTSDAYDEFITIAPYFPEYKVFVNAAGARLVEVPA--  153 (398)
T ss_dssp             CCHHHHHHHHHHHHHHHCCCCCG-GGEEEESSHHHHHHHHHHHHCCSTTCEEEEESSCCTHHHHHHHHTTCEEEEECC--
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCC-CCEEEEECCCHHHCCHHHHHCCCCCCCCCEEECCCHHHHHHHHHHCCCCEEEEE--
T ss_conf             89999999999999863976355-522786211021110123201234664402101102456788873686414542--


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC------CEEEECCCCCCCCCCCCCC
Q ss_conf             6667766677889999985025403421566643233443789999999986378------7578417502355688876
Q T0591           157 VSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYG------ATVIADQLYSRLRYAGASY  230 (406)
Q Consensus       157 ~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~------~~ii~De~Y~~l~~~~~~~  230 (406)
                         +++++.+|++.+++.+++++++++++|||||||.+++.+++++++++|++|+      +++|+||+|.++.+++...
T Consensus       154 ---~~~~~~~d~~~l~~~~~~~~~~v~~~~p~nptg~~~~~~~~~~l~~~~~~~~~~~~~~i~ii~De~y~~~~~~~~~~  230 (398)
T 3ele_A          154 ---DTEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKSKEIGRPIFIIADEPYREIVYDGIKV  230 (398)
T ss_dssp             ---CTTTSSCCHHHHHHTCCTTEEEEEECSSCTTTCCCCCHHHHHHHHHHHHHHHHHHTSCCEEEEECTTTTCBCTTCCC
T ss_pred             ---ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCC
T ss_conf             ---02224568899998751466432345445677543333332221014556554146521566302120222233443


Q ss_pred             CCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH---HHHHCCCHHHHHH
Q ss_conf             5223321026786899850400104631121143325899999998752036761245799999---9985652589999
Q T0591           231 THLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLR---GWFDEAPGWMEDR  307 (406)
Q Consensus       231 ~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~---~~l~~~~~~~~~~  307 (406)
                      ..+.    ...++++++.|+||.+++||+|+||+++++++++.+...+.....+.+...+.+..   ..... ..+..+.
T Consensus       231 ~~~~----~~~~~~iv~~s~sK~~~~~G~RiG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~  305 (398)
T 3ele_A          231 PFVT----KYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRALGYVCAPSLFQKMIVK-CQGATGD  305 (398)
T ss_dssp             CCGG----GTCSSEEEEEESTTTSSCTTTCCEEEECCTTSTTHHHHHHHHHHHHHHTTCCCSCHHHHHHHTT-CTTCCCC
T ss_pred             CCCC----CCCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHCCCHHHHHHHHHH-HHHHHHH
T ss_conf             3333----3456643540566311467555312468899998775442120344101201003778877776-5434567


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCH
Q ss_conf             99999999999999972799455358873078776688788989999999986891896161026799985899850997
Q T0591           308 IARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDH  387 (406)
Q Consensus       308 ~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~  387 (406)
                      +..++++|+.+.+.|.++ |+++..|+||||+|++++.  .++.++++.| .++||.++||+.||.  ++|||+||+.++
T Consensus       306 ~~~~~~~r~~l~~~L~~~-g~~~~~p~gg~~~~~~~~~--~~~~~~~~~l-~~~gV~v~pG~~Fg~--~~~vRls~~~~~  379 (398)
T 3ele_A          306 INAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKALE--DDSNAFCEKA-KEEDVLIVAADGFGC--PGWVRISYCVDR  379 (398)
T ss_dssp             HHHHHHHHHHHHHHHHHH-TCCEECCSBSSEEEEECSS--SCHHHHHHHH-HTTTEECEESGGGTC--TTEEEEECCSCH
T ss_pred             HHHHHHHHHHHHHHHHHC-CCEEECCCCEEEEEEECCC--CCHHHHHHHH-HHCCEEEEECCCCCC--CCEEEEEECCCH
T ss_conf             999999999999999866-9776368941899897999--9999999999-969999991775799--994999982899


Q ss_pred             HHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999999856
Q T0591           388 EAAVAAARRIVTLVERYR  405 (406)
Q Consensus       388 e~l~~al~rl~~~~~~~r  405 (406)
                      |++++|++||++++++|+
T Consensus       380 e~i~~al~~l~~~l~~~~  397 (398)
T 3ele_A          380 EMIKHSMPAFEKIYKKYN  397 (398)
T ss_dssp             HHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHC
T ss_conf             999999999999999857


No 36 
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, alternative splicing, mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 2vgz_A*
Probab=100.00  E-value=0  Score=446.32  Aligned_cols=356  Identities=19%  Similarity=0.253  Sum_probs=291.8

Q ss_pred             CCCCEEECCCCCCCCC-CCHHHHHHHH--------HHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC---CC---CC
Q ss_conf             8983341567867887-8889999999--------99980878888788889889999999999864886---78---86
Q T0591            37 EGRPVDFSHGDVDAHE-PTPGAFDLFS--------AGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAP---VD---AR  101 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~-p~~~~~~~~~--------~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~---~~---~~  101 (406)
                      .+..|+|+.|+||+.. |.+.....+.        +.. .....+|++..|+++||++|++|+++.++..   ++   ..
T Consensus        30 ~~~~I~l~~G~P~p~~~P~~~~~~~~~~~~~~~~~~~~-~~~~~~Y~~~~G~~~Lr~aia~~~~~~~~~~~~~~~~~~~~  108 (425)
T 2r2n_A           30 PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEM-MKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQ  108 (425)
T ss_dssp             CTTCEECCCCCCCGGGCSEEEEEEEETTSCCEEECHHH-HHHHTSCCCTTCCHHHHHHHHHHHHHHHCCTTTTSCGGGTC
T ss_pred             CCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             99908899978894107879999999976776656652-14304889874609999999999999718887455878987


Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-----
Q ss_conf             707882487278999999997200101013105513899999829969998604466677666778899999850-----
Q T0591           102 DGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-----  176 (406)
Q Consensus       102 ~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-----  176 (406)
                      ++|++|+|++++|.++++++++|||+|++++|+|+.|...++..|+++++|+++..       +.+++.++..+.     
T Consensus       109 ~~I~vt~G~~~al~~~~~~l~~~Gd~Vlv~~P~y~~~~~~~~~~g~~vv~v~~~~~-------g~~~~~l~~~~~~~~~~  181 (425)
T 2r2n_A          109 MDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDES-------GIVPDSLRDILSRWKPE  181 (425)
T ss_dssp             EEEEEESSHHHHHHHHHHHHCCTTCEEEEESSCCHHHHHHHGGGTCEEEEECEETT-------EECHHHHHHHHTTSCST
T ss_pred             CEEEEECCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCEEEEEECCCC-------CCCHHHHHHHHHCCCHH
T ss_conf             85999138899999999997299898998668773147899863974789851444-------45667898876303767


Q ss_pred             -------CCCEEEEC-CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEE
Q ss_conf             -------25403421-5666432334437899999999863787578417502355688876522332102678689985
Q T0591           177 -------AGARVFLF-SNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIM  248 (406)
Q Consensus       177 -------~~~k~i~l-~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~  248 (406)
                             .+++++++ +|||||||.+++.+++++|+++|++||++||+||+|+++.|++...+.+...  ...+++|+++
T Consensus       182 ~~~~~~~~~~~~l~~~p~p~NPtG~~~s~~~~~~i~~~a~~~~~~ii~De~y~~~~~~~~~~~~~~~~--~~~~~~i~~~  259 (425)
T 2r2n_A          182 DAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSM--DVDGRVIRAD  259 (425)
T ss_dssp             TSSSTTSCCCSEEEECCSSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTGGGBSSSSCCCCTGGG--CTTSCEEEEE
T ss_pred             HHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCHHHHC--CCCCCEEEEC
T ss_conf             88752238985999968999981715779999999999987345764477777751489999634421--4665348965


Q ss_pred             ECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC-----CCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             040010463112114332589999999875203676124579999999856-----525899999999999999999997
Q T0591           249 GPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDE-----APGWMEDRIARHQAIRDELLHVLR  323 (406)
Q Consensus       249 S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~-----~~~~~~~~~~~~~~~r~~l~~~L~  323 (406)
                      |+||.++ ||||+||+++++++++++.+.+.....+++++.|.++..++..     ...++++.+..|+++++.+.+.|.
T Consensus       260 s~sk~~~-~GlRvG~~~~~~~~i~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  338 (425)
T 2r2n_A          260 SFSKIIS-SGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAAD  338 (425)
T ss_dssp             ESTTTTC-STTCCEEEEEEHHHHHHHHHHHHTTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCC-CCCCHHHHHCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             6556668-823155553219999999999986325788089999999998633432002258999999999999999999


Q ss_pred             HC-C-CCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC---CCCEEEEEEC-CCHHHHHHHHHHH
Q ss_conf             27-9-945535887307877668878898999999998689189616102679---9985899850-9979999999999
Q T0591           324 GC-E-GVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH---TADSVRLNFS-QDHEAAVAAARRI  397 (406)
Q Consensus       324 ~~-~-g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~---~~~~iRis~~-~~~e~l~~al~rl  397 (406)
                      +. + ++.+..|+||||+|+++++ ..++.+|+.++++++||.++||+.|+..   +++|+|+||+ .++|++++|++||
T Consensus       339 ~~~~~~~~~~~p~gg~f~~~~~~~-~~~~~~~~~~~l~~~gV~v~PG~~F~~~~~~~~~~~Rls~a~~~~~~l~~a~~rL  417 (425)
T 2r2n_A          339 KWLTGLAEWHVPAAGMFLWIKVKG-INDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVL  417 (425)
T ss_dssp             HHCSSSEEECCCSBSSEEEEEETT-CSCCHHHHHTHHHHTTEECEEGGGGSSSTTSCCCEEEEECSSCCHHHHHHHHHHH
T ss_pred             HHCCCCCEECCCCCEEEEEEECCC-CCCHHHHHHHHHHHCCEEEEECHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHH
T ss_conf             756798446079932699998999-9999999999999789999943552789888999899995869999999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999985
Q T0591           398 VTLVERY  404 (406)
Q Consensus       398 ~~~~~~~  404 (406)
                      +++++++
T Consensus       418 ~~~l~e~  424 (425)
T 2r2n_A          418 AQLIKES  424 (425)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
T ss_conf             9999952


No 37 
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus HB27} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A*
Probab=100.00  E-value=0  Score=431.01  Aligned_cols=353  Identities=20%  Similarity=0.294  Sum_probs=301.7

Q ss_pred             CCCCEEECCCCCCCCC-CCHHHHHHHHHHHHCC--CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             8983341567867887-8889999999999808--788887888898899999999998648867886707882487278
Q T0591            37 EGRPVDFSHGDVDAHE-PTPGAFDLFSAGVQSG--GVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~-p~~~~~~~~~~~~~~~--~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      .+..|||+.|+||+.. |++.+.+++.+.+.+.  ...+|++..|.++||++||+|+    +  +++ ++|++|+|++++
T Consensus        31 ~~~~i~l~~G~P~~~~~P~~~~~~~~~~~~~~~~~~~~~Y~~~~G~~~LR~~ia~~~----~--~~~-~~I~it~G~~~a  103 (397)
T 2zyj_A           31 RPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVALQYSPTEGYAPLRAFVAEWI----G--VRP-EEVLITTGSQQA  103 (397)
T ss_dssp             STTCEEESSCCCCGGGCCHHHHHHHHHHHHHHHHHHHTSCCCTTCCHHHHHHHHHHH----T--SCG-GGEEEESHHHHH
T ss_pred             CCCCEECCCCCCCCHHCCHHHHHHHHHHHHHCCCHHHCCCCCCCCHHHHHHHHHHCC----C--CCH-HHEEEECCHHHH
T ss_conf             999688999789911279899999999999717844237898737099999998204----9--777-898983786999


Q ss_pred             HHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCC--CCEEEECCCCCCCC
Q ss_conf             9999999972001010131055138999998299699986044666776667788999998502--54034215666432
Q T0591           114 LFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKA--GARVFLFSNPNNPA  191 (406)
Q Consensus       114 l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~--~~k~i~l~~P~NPT  191 (406)
                      +++++.++++|||+|++++|+|+.|...++..|++++++|++.       ++.+++.++...+.  ...+++++||||||
T Consensus       104 l~~~~~~l~~~gd~Vl~~~P~y~~~~~~~~~~g~~~~~v~~~~-------~~~~~~~l~~~~~~~~~~~~~~~~~~~NPt  176 (397)
T 2zyj_A          104 LDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGE-------EGPDLDALEEVLKRERPRFLYLIPSFQNPT  176 (397)
T ss_dssp             HHHHHHHHCCTTCEEEEEESCCHHHHHHHHTTCCEEEEEEEET-------TEECHHHHHHHHHHCCCSCEEECCBSCTTT
T ss_pred             HHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCEEEEECCCC-------CCCCHHHHHHHHHCCCCCEEEEECCCCCCC
T ss_conf             9999999628998787579973237999986497321221643-------222347899998506685899967852457


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHH-CCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHH
Q ss_conf             3344378999999998637875784175023556888765223321-026786899850400104631121143325899
Q T0591           192 GVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEA-AVDAENVVTIMGPSKTESLSGYRLGVAFGSRAI  270 (406)
Q Consensus       192 G~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~-~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~  270 (406)
                      |.+++.+++++++++|+++++++|+||+|.++.|++.+..++.... ....+++++++||||.++ ||+|+||+++++++
T Consensus       177 g~~~~~~~~~~~~~~~~~~~~~li~dd~y~~~~~~~~~~~~~~~~~~~~~~~~vi~~~s~SK~~~-~GlRiG~~i~~~~~  255 (397)
T 2zyj_A          177 GGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEA  255 (397)
T ss_dssp             CCBCCHHHHHHHHHHHHHHTCCEEEECTTTTCBCSSCCCCCHHHHHHHHTCCCEEEEEESTTTTC-GGGCCEEEECCHHH
T ss_pred             CCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCC-CCCCCCCCCCCHHH
T ss_conf             75566443211100012038740122232101368888875888644531362489616775778-88875614679999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHC--CCCEEECCCCCEEEEEECCCCC
Q ss_conf             999998752036761245799999998565-2589999999999999999999727--9945535887307877668878
Q T0591           271 IARMEKLQAIVSLRAAGYSQAVLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGC--EGVFARTPQAGSYLFPRLPKLA  347 (406)
Q Consensus       271 i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~--~g~~~~~p~gg~~~w~~~~~~~  347 (406)
                      ++.+.+.+.....+++.+.|.++..++.+. ..+++..+..++++++.+.+.|...  .++++..|+||||+|+++|+ +
T Consensus       256 i~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~r~~~~~~~~~~~~~L~~~~~~~~~~~~p~gg~f~~~~~~~-~  334 (397)
T 2zyj_A          256 LQKLVQAKQGADLHTPMLNQMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPK-G  334 (397)
T ss_dssp             HHHHHHHHHHHHSSCCHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTSEECCCSBSSEEEEECST-T
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCEEEEEEECCC-C
T ss_conf             999999985244678669999999999818711499999999999999999999756777155179952599998999-9


Q ss_pred             CCHHHHHHHHHHHCCEEEEECCCCCCC--CCCEEEEEEC-CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             898999999998689189616102679--9985899850-9979999999999999998569
Q T0591           348 VAPAEFVKILRLQAGVVVTPGTEFSPH--TADSVRLNFS-QDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       348 ~~~~~~~~~Ll~~~gV~v~pG~~Fg~~--~~~~iRis~~-~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      .++.++++.|+ ++||.++||+.|+..  +++|+|+||+ .++|++++|++||+++++++.|
T Consensus       335 ~~~~~~~~~l~-~~gV~v~pg~~F~~~~~~~~~iRis~~~~~~e~l~~a~~rl~~~l~~lla  395 (397)
T 2zyj_A          335 LSAEGLFRRAL-EENVAFVPGGPFFANGGGENTLRLSYATLDREGIAEGVRRLGRALKGLLA  395 (397)
T ss_dssp             CCHHHHHHHHH-HTTEEEEESGGGCTTSCCTTEEEEECSSSCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHH-HCCEEEEECHHHCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             89999999999-78969994466378999899899995769999999999999999999860


No 38 
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Salmonella typhimurium}
Probab=100.00  E-value=0  Score=440.86  Aligned_cols=387  Identities=19%  Similarity=0.254  Sum_probs=295.7

Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHH-HHHHHHHHCC----CCCCCCCCCCCHH
Q ss_conf             8871466661578998878899999630378983341567867887888999-9999999808----7888878888988
Q T0591             7 FKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAF-DLFSAGVQSG----GVQAYTEYRGDLG   81 (406)
Q Consensus         7 ~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~-~~~~~~~~~~----~~~~Y~~~~G~~~   81 (406)
                      |+++|........+++...++   ... ...+..|+|+.|+|+..+++++.+ +++.+.+...    ..++|++..|.++
T Consensus         4 ~s~~~~~~~~~~~i~~l~~~l---~~~-~~~p~~I~l~~G~P~~~p~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~~G~~~   79 (417)
T 3g7q_A            4 FSLFGDKFTRHSGITRLMEDL---NDG-LRTPGAIMLGGGNPAHIPAMQDYFQTLLTDMVESGKAADALCNYDGPQGKTA   79 (417)
T ss_dssp             ------------CHHHHHHHH---HC------CCEECSCCCCCCCHHHHHHHHHHHHHHHHHTHHHHHHHSTTCTTSHHH
T ss_pred             HHHHHHHHCCCCHHHHHHHHH---HHH-CCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHCCCCCCCCCHH
T ss_conf             738988631564799999999---875-5899908999988999887589999999999866855666449899867299


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHC---CHHHHHHHCCCHHHHHHHHHHCCEEEEEEE--CC
Q ss_conf             9999999999864886788670788248727899999999720---010101310551389999982996999860--44
Q T0591            82 IRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVAR---GDKVAIVQPDYFANRKLVEFFEGEMVPVQL--DY  156 (406)
Q Consensus        82 Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~p---Gd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~--~~  156 (406)
                      ||+++|+|+++++|+++++ ++|++|+|++++|++++++++++   ||.+.+..|+|+.|.......+...+.+..  ..
T Consensus        80 lr~aia~~~~~~~~~~~~~-~~I~it~G~~~al~~~~~~l~~~~~~g~~~~v~~P~~~~~~~~~~~~~~~~~~~~~~~~~  158 (417)
T 3g7q_A           80 LLNALAVLLRETLGWDIEP-QNIALTNGSQSAFFYLFNLFAGRRADGSTKKVLFPLAPEYIGYADSGLEDDLFVSARPNI  158 (417)
T ss_dssp             HHHHHHHHHHHHHCCCCCG-GGEEEESCHHHHHHHHHHHHSBC----CCBEEEESSCCCHHHHHC-----CCEEECCCEE
T ss_pred             HHHHHHHHHHHHCCCCCCH-HEEEECCCHHHHHHHHHHHHHCCCCCCCCEEEEECCCHHHHHHHHHHCCCEEEECCCCCC
T ss_conf             9999999999870999882-009992888999999999985445567741586137624999999815571531256640


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHH
Q ss_conf             66677666778899999850254034215666432334437899999999863787578417502355688876522332
Q T0591           157 VSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAE  236 (406)
Q Consensus       157 ~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~  236 (406)
                      ...+++++.++++.++..+++++|+++++|||||||.++|.+++++|+++|++||++||+||+|+.+ |.+....+..  
T Consensus       159 ~~~~~~~~~~~~d~~~~~~~~~~~~i~l~~p~NPtG~~~s~e~~~~l~~~a~~~~~~vi~De~y~~~-~~~~~~~~~~--  235 (417)
T 3g7q_A          159 ELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVP-FPGIIFSEAR--  235 (417)
T ss_dssp             EEEGGGEEEEECCGGGCCCCTTEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHTTCCEEEECTTCTT-TTCCBCSCCC--
T ss_pred             CCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCC-CCCCCCCCCC--
T ss_conf             2566546787988999867899739998899898675541688999988776436809998875542-3455323432--


Q ss_pred             HCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCH--HHH-HHHHHHHH
Q ss_conf             102678689985040010463112114332589999999875203676124579999999856525--899-99999999
Q T0591           237 AAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPG--WME-DRIARHQA  313 (406)
Q Consensus       237 ~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~--~~~-~~~~~~~~  313 (406)
                       ....+++++++|+|| +++||+|+||+++++++++.+.+.+...+.+++.+.|.++..++.....  +.. ..+..+++
T Consensus       236 -~~~~~~vi~~~s~sk-~~~~G~RiG~~~~~~~~~~~l~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~~~~~~~~~~~~  313 (417)
T 3g7q_A          236 -PLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNDLLRLSETVIKPFYYQ  313 (417)
T ss_dssp             -CCCCTTEEEEEESGG-GTCTTSCCEEEECCHHHHHHHHHHHHHHCCCCCSHHHHHHHHHHHTTCHHHHHHHTHHHHHHH
T ss_pred             -CCCCCCEEEECCCCC-CCCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH
T ss_conf             -113652456458777-778988668763899999999999866224431057889998862305777777776642101


Q ss_pred             HHHHHHHHHHHC---CCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC-------CCCEEEEEE
Q ss_conf             999999999727---9945535887307877668878898999999998689189616102679-------998589985
Q T0591           314 IRDELLHVLRGC---EGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH-------TADSVRLNF  383 (406)
Q Consensus       314 ~r~~l~~~L~~~---~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~-------~~~~iRis~  383 (406)
                      +++.+.+.+.+.   .++.+..|+||||+|+++++...+... +..+++++||.++||+.|++.       +++|+|+||
T Consensus       314 r~~~~~~~l~~~l~~~~~~~~~P~gg~f~~~~l~~~~~~~~~-~~~~l~~~gV~v~pG~~F~~~~~~~~~~~~~~~Ris~  392 (417)
T 3g7q_A          314 RVQQTIAIIRRYLSEERCLIHKPEGAIFLWLWFKDLPITTEL-LYQRLKARGVLMVPGHYFFPGLDKPWPHTHQCMRMNY  392 (417)
T ss_dssp             HHHHHHHHHHHHCCTTTCEEECCCBSSEEEEECTTCSSCHHH-HHHHHHHTTEECEEGGGGCTTBSSCCGGGGGEEEEES
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCHHH-HHHHHHHCCEEEEECHHHCCCCCCCCCCCCCEEEEEE
T ss_conf             378999999985352682784788327999988999974999-9999996997998354426775566667799799995


Q ss_pred             CCCHHHHHHHHHHHHHHHHHH
Q ss_conf             099799999999999999985
Q T0591           384 SQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       384 ~~~~e~l~~al~rl~~~~~~~  404 (406)
                      +.++|++++|++||+++++|.
T Consensus       393 ~~~~e~l~~~l~rL~~~l~~~  413 (417)
T 3g7q_A          393 VPEPDKIEAGVKILAEEIERA  413 (417)
T ss_dssp             CSCHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHH
T ss_conf             599999999999999999999


No 39 
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A*
Probab=100.00  E-value=0  Score=428.95  Aligned_cols=369  Identities=24%  Similarity=0.347  Sum_probs=310.7

Q ss_pred             CCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCH
Q ss_conf             97446888714666615789988788999996303789833415678678878889999999999808788887888898
Q T0591             1 MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDL   80 (406)
Q Consensus         1 m~i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~   80 (406)
                      |..+.|+.++....+.         .+.++++.    ...|||++|+||+++ ++.+.+++.+++..  .++|++..|.+
T Consensus         1 ~~~~~r~~~~~~~~~~---------~~~~la~~----~~~i~l~~g~p~~~~-p~~v~~al~~~~~~--~~~Y~~~~G~~   64 (381)
T 1v2d_A            1 MRLHPRTEAAKESIFP---------RMSGLAQR----LGAVNLGQGFPSNPP-PPFLLEAVRRALGR--QDQYAPPAGLP   64 (381)
T ss_dssp             CCCCGGGGGC---CHH---------HHHHHHHH----HTCEECCCCSCSSCC-CHHHHHHHHHHTTT--SCSCCCTTCCH
T ss_pred             CCCCHHHHHCCCCHHH---------HHHHHHCC----CCCEEECCCCCCCCC-CHHHHHHHHHHHCC--CCCCCCCCCCH
T ss_conf             9778234536899999---------99998654----997783388999988-99999999998524--77989985769


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCC
Q ss_conf             89999999999864886788670788248727899999999720010101310551389999982996999860446667
Q T0591            81 GIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSAD  160 (406)
Q Consensus        81 ~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~  160 (406)
                      +||++||+|+    +  +++ ++|++|+|+++++.+++.+++++||.|++++|+|..+...+...|.+++.++++.   +
T Consensus        65 ~lReaia~~~----~--~~~-~~I~it~G~~~ai~~~~~~l~~~gd~v~~~~P~~~~~~~~~~~~g~~~~~~~~~~---~  134 (381)
T 1v2d_A           65 ALREALAEEF----A--VEP-ESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDL---T  134 (381)
T ss_dssp             HHHHHHHHHH----T--SCG-GGEEEESSHHHHHHHHHHHHCCTTCEEEEEESCCTTHHHHHHHTTCEEEEEECEE---E
T ss_pred             HHHHHHHHHH----C--CCH-HHCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHCCCEEEEEECCC---C
T ss_conf             9999999874----9--994-6543145147888988874224456421358873010135775187556641264---2


Q ss_pred             CCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCC
Q ss_conf             76667788999998502540342156664323344378999999998637875784175023556888765223321026
Q T0591           161 ETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVD  240 (406)
Q Consensus       161 ~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~  240 (406)
                      .+.+..|++..+....+.++++++||||||||.+++.+++++|+++|++||++||+||+|+.+.++.... .+.   ...
T Consensus       135 ~~~~~~d~~~~~~~~~~~~~~i~~~~p~NPtG~~~~~~~l~~i~~~a~~~~~~ii~D~~~~~~~~~~~~~-~~~---~~~  210 (381)
T 1v2d_A          135 PEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPR-RLR---EFA  210 (381)
T ss_dssp             TTEEECCHHHHHTTCCTTEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTTTCBSSSCCC-CHH---HHC
T ss_pred             CCCCCCCHHHHHHHHCCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEHHHHHHCCCCCCC-HHH---CCC
T ss_conf             1334467889987405567615436988765444999999999999998398799720332220344442-011---023


Q ss_pred             CCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHH
Q ss_conf             786899850400104631121143325899999998752036761245799999998565--258999999999999999
Q T0591           241 AENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDEL  318 (406)
Q Consensus       241 ~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l  318 (406)
                      .++++++.|+||.+++||+|+||+++++++++.+...+.....+++++.|.++..++...  .+++++.+..++++++.+
T Consensus       211 ~~~~~~~~~~sk~~~~~G~R~g~~~~~~~~~~~~~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~~r~~~l  290 (381)
T 1v2d_A          211 PERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKLARREGFYEALREGYRRRRDLL  290 (381)
T ss_dssp             TTTEEEEEEHHHHTTCGGGCCEEEECCTTTHHHHHHHHHHHTSSCCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHH
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             34442573356556678664222224323444232332223333333332222222333222102456579999977789


Q ss_pred             HHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC--CCCEEEEEECCCHHHHHHHHHH
Q ss_conf             99997279945535887307877668878898999999998689189616102679--9985899850997999999999
Q T0591           319 LHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH--TADSVRLNFSQDHEAAVAAARR  396 (406)
Q Consensus       319 ~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~--~~~~iRis~~~~~e~l~~al~r  396 (406)
                      .+.+... |+++..|+||||+|+++|.  .+.    .+|++++||.++||+.|+..  +++|+||||+.++|++++|++|
T Consensus       291 ~~~~~~~-g~~~~~p~g~~f~~~~l~~--~~~----~~ll~~~gV~v~pG~~F~~~~~~~~~iRis~~~~~e~l~~al~r  363 (381)
T 1v2d_A          291 AGGLRAM-GLRVYVPEGTYFLMAELPG--WDA----FRLVEEARVALIPASAFYLEDPPKDLFRFAFCKTEEELHLALER  363 (381)
T ss_dssp             HHHHHHT-TCCEECCSBSSEEEEECTT--CCH----HHHHHHTCEECEEGGGGCSSSCCTTEEEEECCSCHHHHHHHHHH
T ss_pred             HHHHHHC-CCCCCCCCCCEEEEEECCC--HHH----HHHHHHCCEEEEECHHCCCCCCCCCEEEEEECCCHHHHHHHHHH
T ss_conf             9986110-2543079832699996893--389----99999699999962330789998998999965999999999999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999998569
Q T0591           397 IVTLVERYRA  406 (406)
Q Consensus       397 l~~~~~~~ra  406 (406)
                      |++++++||.
T Consensus       364 l~~~l~~~~~  373 (381)
T 1v2d_A          364 LGRVVNSPRE  373 (381)
T ss_dssp             HHHHC-----
T ss_pred             HHHHHHHHHH
T ss_conf             9999997998


No 40 
>3d6k_A Putative aminotransferase; APC82464, structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae}
Probab=100.00  E-value=0  Score=423.62  Aligned_cols=359  Identities=18%  Similarity=0.197  Sum_probs=275.6

Q ss_pred             HHHHHHHHCCCCCCEEECCCCCCCCCC--CHHHHHHHHHHHH---CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             999996303789833415678678878--8899999999998---08788887888898899999999998648867886
Q T0591            27 LEALIRGAPIEGRPVDFSHGDVDAHEP--TPGAFDLFSAGVQ---SGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDAR  101 (406)
Q Consensus        27 ~~~~~~~~~~~~~~i~ls~G~pd~~~p--~~~~~~~~~~~~~---~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~  101 (406)
                      +.........++..|||+.|+|+...+  +....+.......   .....+|++..|.++||++||+|+    |  +++ 
T Consensus        21 ~~~~~~~l~~~~~~i~l~~G~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~~G~~~lR~~iA~~l----~--~~~-   93 (422)
T 3d6k_A           21 VTAKYAELKAKNLSLDLTRGKPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLLGIADIRELWAEAL----G--LPA-   93 (422)
T ss_dssp             HHHHHHHHHHTTCCEECCCCSCCHHHHHTTGGGGGCSTTCCBCTTCCBTTSSCCSSCCHHHHHHHHHHH----T--CCG-
T ss_pred             HHHHHHHHHHCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHHHHHHHH----C--CCH-
T ss_conf             999999998679957678879997557998358876446776524943207998030399999999887----8--284-


Q ss_pred             CEEEEECCCCHHHHH--HHHHH------------HHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCC
Q ss_conf             707882487278999--99999------------7200101013105513899999829969998604466677666778
Q T0591           102 DGLIITPGTQGALFL--AVAAT------------VARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLD  167 (406)
Q Consensus       102 ~~I~it~G~~~~l~~--~~~~l------------~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d  167 (406)
                      ++|++|+|++++++.  +.+++            ++|||+|++++|+|+.|...++..|+++++||++.       +++|
T Consensus        94 ~~I~it~Gs~~~l~~~l~~~~~~~~~~~~~~~~~~~pgd~Vlv~~P~Y~~~~~~~~~~G~~~~~vp~d~-------~g~d  166 (422)
T 3d6k_A           94 DLVVAQDGSSLNIMFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEMINVPMTD-------EGPD  166 (422)
T ss_dssp             GGEEECSSCHHHHHHHHHHHHHHHCCTTCSSCGGGSSCCEEEEEESCCHHHHHHHHHHTCEEEEEEEET-------TEEC
T ss_pred             HHEEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHCCCEEEEEECCC-------CCCC
T ss_conf             769982787999999999999741344333323379999899838983899999998699899984478-------8789


Q ss_pred             HHHHHHHHCCCCEEEECCCC--CCCCCCCCCHHHHHHHHHHHHHC-CCEEEECCCCCCCCCCCCCCCCHH---H-HHCCC
Q ss_conf             89999985025403421566--64323344378999999998637-875784175023556888765223---3-21026
Q T0591           168 LTGLEEAFKAGARVFLFSNP--NNPAGVVYSAEEIGQIAALAARY-GATVIADQLYSRLRYAGASYTHLR---A-EAAVD  240 (406)
Q Consensus       168 ~~~l~~~~~~~~k~i~l~~P--~NPTG~~~s~~~l~~i~~~a~~~-~~~ii~De~Y~~l~~~~~~~~~~~---~-~~~~~  240 (406)
                      +++++++++++++.+++++|  |||||.++|.+++++|+++|++| +++||+||+|+++.|++..+....   . .....
T Consensus       167 ~~~le~~~~~~~~~~i~~~P~~~NPTG~v~s~~~~~~i~~~a~~~~~i~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~  246 (422)
T 3d6k_A          167 MGVVRELVKDPQVKGMWTVPVFGNPTGVTFSEQTCRELAEMSTAAPDFRIVWDNAYALHTLSDEFPIVHNVIEFAQAAGN  246 (422)
T ss_dssp             HHHHHHHHTSTTEEEEEECCSSCTTTCCCCCHHHHHHHHHCCCSSTTCEEEEECTTTTCBSSSCCCCCCCHHHHHHHTTC
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHCCCCCCCHHHHHHHHHHCCC
T ss_conf             79999973058976999859999999771899999999998765598579963240254226667751445459872799


Q ss_pred             CCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC---CHHHHHHHHHHHHHHHH
Q ss_conf             786899850400104631121143325899999998752036761245799999998565---25899999999999999
Q T0591           241 AENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA---PGWMEDRIARHQAIRDE  317 (406)
Q Consensus       241 ~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~---~~~~~~~~~~~~~~r~~  317 (406)
                      ++++|+++||||.|+ ||+|+||+++++++++.+.+.+.....+++++.|.++..++.+.   +.++++.+..++++++.
T Consensus       247 ~~~vi~~~S~SK~~~-~GlRiG~~~~~~~~~~~~~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~~~~~~~  325 (422)
T 3d6k_A          247 PNRFWFMSSTSKITH-AGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQFFGDVAGLKAHMLKHAASLAPKFER  325 (422)
T ss_dssp             TTCEEEEEESTTTSC-TTSSCEEEECCHHHHHHHHHHHHHHCSCCCHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCCCCCC-CHHHHHCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             880899824411047-3021302248999999999998635778985999999999975411799999999999999999


Q ss_pred             H----HHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEE-ECCCCCC---CCCCEEEEEEC-CCHH
Q ss_conf             9----999972799455358873078776688788989999999986891896-1610267---99985899850-9979
Q T0591           318 L----LHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVT-PGTEFSP---HTADSVRLNFS-QDHE  388 (406)
Q Consensus       318 l----~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~-pG~~Fg~---~~~~~iRis~~-~~~e  388 (406)
                      +    .+.|.+.+++.+..|+||||+|+++|+  ..+.++++.+ .++||.++ ||+.|+.   .+++|||+||+ .++|
T Consensus       326 ~~~~l~~~l~~~~~~~~~~P~gg~fl~~~l~~--~~~~~~~~~l-~~~gv~~v~~g~~f~~~~~~~~~~iRlsf~~~~~e  402 (422)
T 3d6k_A          326 VLEILDSRLSEYGVAKWTSPTGGYFISVDVVP--GTASRVVELA-KEAGIALTGAGSSFPLHNDPNNENIRLAPSLPPVA  402 (422)
T ss_dssp             HHHHHHHHHGGGTCEEECCCSBSSCEEEEEST--TCHHHHHHHH-HHTTEECCCTTTTSGGGCCTTSCEEEECCSSSCHH
T ss_pred             HHHHHHHHCCCCCCCEECCCCCCEEEEEECCC--CCHHHHHHHH-HHCCCEEECCCCCCCCCCCCCCCEEEEEECCCCHH
T ss_conf             99999985400587144278820599998899--8599999999-98598898585313589888999899984889999


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999998
Q T0591           389 AAVAAARRIVTLVER  403 (406)
Q Consensus       389 ~l~~al~rl~~~~~~  403 (406)
                      ++++|++||+..++.
T Consensus       403 ~l~~a~~~la~~v~~  417 (422)
T 3d6k_A          403 ELEVAMDGFATCVLM  417 (422)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 41 
>3ez1_A Aminotransferase MOCR family; YP_604413.1, structural genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300}
Probab=100.00  E-value=0  Score=418.54  Aligned_cols=353  Identities=21%  Similarity=0.255  Sum_probs=269.6

Q ss_pred             CCCCCEEECCCCCCCCCC--CHHHHHHHHH-HHHCC--CCCCC-CCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECC
Q ss_conf             789833415678678878--8899999999-99808--78888-788889889999999999864886788670788248
Q T0591            36 IEGRPVDFSHGDVDAHEP--TPGAFDLFSA-GVQSG--GVQAY-TEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPG  109 (406)
Q Consensus        36 ~~~~~i~ls~G~pd~~~p--~~~~~~~~~~-~~~~~--~~~~Y-~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G  109 (406)
                      ..+..|||+.|+|+..+.  +......... .....  ....| ++..|+|+||+++|+|+    |  ++ .++|++|+|
T Consensus        23 ~~~~~idls~G~P~~~~ld~~~~~~~~~~~~~~~~~~~d~~~y~g~~~G~pelR~~iA~~l----~--~~-~~~i~v~~g   95 (423)
T 3ez1_A           23 ARGLNLNMQRGQPADADFDLSNGLLTVLGAEDVRMDGLDLRNYPGGVAGLPSARALFAGYL----D--VK-AENVLVWNN   95 (423)
T ss_dssp             HHTCCEESCCCCCCHHHHHTTGGGGGSCCGGGCEETTEETTSSCSCTTCCHHHHHHHHHHT----T--SC-GGGEEECSS
T ss_pred             HCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCHHHCCCHHCCCCCCCCCCHHHHHHHHHHH----C--CC-HHHEEEECC
T ss_conf             7599736777789910027763556065632112126222048899887099999999986----8--79-667998289


Q ss_pred             CCHHHHHHHHHH-------------HHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC
Q ss_conf             727899999999-------------7200101013105513899999829969998604466677666778899999850
Q T0591           110 TQGALFLAVAAT-------------VARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK  176 (406)
Q Consensus       110 ~~~~l~~~~~~l-------------~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~  176 (406)
                      ++++|..++.++             ++|||+|+++.|+|+.|...++.+|+++++||++..       ++|++.+++.++
T Consensus        96 as~~l~~~~~~~~~~~g~~~~~~~~~~~Gd~vl~p~P~y~~~~~~~~~~G~~~~~vp~~~~-------g~d~~~le~l~~  168 (423)
T 3ez1_A           96 SSLELQGLVLTFALLHGVRGSTGPWLSQTPKMIVTVPGYDRHFLLLQTLGFELLTVDMQSD-------GPDVDAVERLAG  168 (423)
T ss_dssp             CHHHHHHHHHHHHHHTCCTTCSSCGGGGCCEEEEEESCCHHHHHHHHHHTCEEEEEEEETT-------EECHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCEEEEEECCCC-------CCCHHHHHHHHH
T ss_conf             4599999999999854545566444799998999799838999999986998999613799-------999999999972


Q ss_pred             C---CCEEEECCCCCCCCCCCCCHHHHHHHHHH-HHHCCCEEEECCCCCCCCCCCCCCCC---HHHH--HCCCCCCEEEE
Q ss_conf             2---54034215666432334437899999999-86378757841750235568887652---2332--10267868998
Q T0591           177 A---GARVFLFSNPNNPAGVVYSAEEIGQIAAL-AARYGATVIADQLYSRLRYAGASYTH---LRAE--AAVDAENVVTI  247 (406)
Q Consensus       177 ~---~~k~i~l~~P~NPTG~~~s~~~l~~i~~~-a~~~~~~ii~De~Y~~l~~~~~~~~~---~~~~--~~~~~~~~i~~  247 (406)
                      .   .+++++++|||||||.+||.+++++|+++ |++|+++||+||+|.++.|.+.....   +...  .....+++|++
T Consensus       169 ~~~~~~~~~~~~~p~NPTG~v~s~e~l~~l~~l~a~~~~~~Ii~De~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~~  248 (423)
T 3ez1_A          169 TDPSVKGILFVPTYSNPGGETISLEKARRLAGLQAAAPDFTIFADDAYRVHHLVEEDRAEPVNFVVLARDAGYPDRAFVF  248 (423)
T ss_dssp             SCTTEEEEEECSSSCTTTCCCCCHHHHHHHHTCCCSSTTCEEEEECTTSSCBCCSSSCCCCCCHHHHHHHHTCTTSEEEE
T ss_pred             CCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCHHHCCCCCCCCCCHHHHHHHHCCCCCCEEEEE
T ss_conf             79998299995989697281289999999999998628658999850155414777888815666653016998759998


Q ss_pred             EECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCC----HHHHHH----HHHHHHHHHHHH
Q ss_conf             504001046311211433258999999987520367612457999999985652----589999----999999999999
Q T0591           248 MGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAP----GWMEDR----IARHQAIRDELL  319 (406)
Q Consensus       248 ~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~----~~~~~~----~~~~~~~r~~l~  319 (406)
                      +|+||.+ +||||+||+++++++++.+.+.+....++++.+.|.++..++.+..    .++++.    +..++.+++.+.
T Consensus       249 ~s~sK~~-~~G~RiG~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  327 (423)
T 3ez1_A          249 ASTSKIT-FAGAGLGFVASSEDNIRWLSKYLGAQSIGPNKVEQARHVKFLTEYPGGLEGLMRDHAAIIAPKFRAVDEVLR  327 (423)
T ss_dssp             EESTTTS-CSSSSCEEEEECHHHHHHHHHHHHHSCSCCCHHHHHHHHHHHHHSTTHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCC-CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2564445-640010042506999999999975502589869999999999813333699999999999999999999999


Q ss_pred             HHHHHCC-CCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC----CCCEEEEEEC-CCHHHHHHH
Q ss_conf             9997279-945535887307877668878898999999998689189616102679----9985899850-997999999
Q T0591           320 HVLRGCE-GVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH----TADSVRLNFS-QDHEAAVAA  393 (406)
Q Consensus       320 ~~L~~~~-g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~----~~~~iRis~~-~~~e~l~~a  393 (406)
                      +.|.+.. ++.+..|+||||+|+++++.  .+.++. .++.++||.++||+.|++.    .++|+||||+ .++|++++|
T Consensus       328 ~~l~~~~~~~~~~~P~gg~f~w~~~~~~--~~~~~~-~~l~~~gV~v~PG~~F~~~g~~~~~~~iRls~a~~~~e~l~ea  404 (423)
T 3ez1_A          328 AELGEGGEYATWTLPKGGYFISLDTAEP--VADRVV-KLAEAAGVSLTPAGATYPAGQDPHNRNLRLAPTRPPVEEVRTA  404 (423)
T ss_dssp             HHHTTTTSSEEECCCSBSSCEEEEESSS--CHHHHH-HHHHHTTEECCCTTTTSSTTCCSSSCEEEECCSSSCHHHHHHH
T ss_pred             HHHHHCCCCEEEECCCCEEEEEEECCCC--HHHHHH-HHHHHCCEEEEECHHHCCCCCCCCCCEEEEEECCCCHHHHHHH
T ss_conf             9987558860573698126999976976--799999-9999789599965230578878889989998488999999999


Q ss_pred             HHHHHHHH----HHHCC
Q ss_conf             99999999----98569
Q T0591           394 ARRIVTLV----ERYRA  406 (406)
Q Consensus       394 l~rl~~~~----~~~ra  406 (406)
                      ++||++++    +++||
T Consensus       405 i~rL~~~lr~a~~e~~~  421 (423)
T 3ez1_A          405 MQVVAACIRLATEEYRA  421 (423)
T ss_dssp             HHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHC
T ss_conf             99999999999999853


No 42 
>3f6t_A Aspartate aminotransferase; YP_194538.1, structural genomics, joint center for structural genomics, JCSG; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm}
Probab=100.00  E-value=0  Score=414.64  Aligned_cols=323  Identities=17%  Similarity=0.221  Sum_probs=255.4

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHC---CCCCCCCCEEEEECCCCHHHHHHHHHH-----HHCCHHHHHHHCCCHHHHHHH
Q ss_conf             888788889889999999999864---886788670788248727899999999-----720010101310551389999
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFT---GAPVDARDGLIITPGTQGALFLAVAAT-----VARGDKVAIVQPDYFANRKLV  142 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~---g~~~~~~~~I~it~G~~~~l~~~~~~l-----~~pGd~Vl~~~P~y~~~~~~~  142 (406)
                      .+||++.+...++|.|++++-++.   +.....+++|++|+|+++||..+++++     ++|||+|++++|+|+.|...+
T Consensus       131 ~~YP~P~r~l~~~E~i~~~~l~~~~~~~~~~~~~~~i~~t~Ga~~ai~~~~~aL~~~~ll~pGD~Vli~~P~y~~y~~~~  210 (533)
T 3f6t_A          131 NNYPVPDRCLVNTEKIINYFLQELSYKDANLAEQTDLFPTEGGTAAIVYAFHSLAENHLLKKGDKIAINEPIFTPYLRIP  210 (533)
T ss_dssp             CSCCSSSSCCHHHHHHHHHHHHHHHTTTCCCGGGEEEEEEEHHHHHHHHHHHHHHHTTSSCTTCEEEEESSCCHHHHTSG
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHH
T ss_conf             88989446578899999999998612489999827499938889999999999886136799995799599877799999


Q ss_pred             HHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEECCCCC
Q ss_conf             98299699986044666776667788999998502540342156664323344378999999998637-87578417502
Q T0591           143 EFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY-GATVIADQLYS  221 (406)
Q Consensus       143 ~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~-~~~ii~De~Y~  221 (406)
                      ++.|+++++|++..  .++++|.+|+++|++++++++|++++||||||||.++|.+++++|+++|+++ +++||+||+|+
T Consensus       211 ~~~g~~~v~v~~~~--~~~~~~~~d~~~L~~~~~~~~k~i~i~nP~NPTG~~~s~e~l~~i~~~~~~~~~l~II~DevY~  288 (533)
T 3f6t_A          211 ELKDYELVEVDLHS--YEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNPKLMIISDEVYG  288 (533)
T ss_dssp             GGGGSEEEEECCCE--ETTTTSEECHHHHHHHSCTTEEEEEEESSCTTTCBCCCHHHHHHHHHHHHHCTTCEEEEECTTG
T ss_pred             HHCCCEEEEEECCC--CCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCC
T ss_conf             98699899972567--7555747899999973899981899818969889998999999999999977995595377764


Q ss_pred             CCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHH--------------H-----------
Q ss_conf             355688876522332102678689985040010463112114332589999999--------------8-----------
Q T0591           222 RLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARME--------------K-----------  276 (406)
Q Consensus       222 ~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~--------------~-----------  276 (406)
                      +|.|++.+.   ..   ..++++|+++||||.|++||||+||++++++.+....              +           
T Consensus       289 ~~~~~~~s~---~~---~~~~~~i~v~SfSK~f~~~G~RlG~i~~~~~~i~~~~~~~l~~~~~~~~~~~y~~~~~~P~~~  362 (533)
T 3f6t_A          289 AFVPNFKSI---YS---VVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDPDKM  362 (533)
T ss_dssp             GGSTTCCCH---HH---HSGGGEEEEEESHHHHTCGGGCEEEEEEESSCHHHHHHHTSCHHHHHHHHHHHHTTCSCGGGC
T ss_pred             CCCCCCCCC---CH---HHHHCCCCCCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             112246763---11---333001113555544566211157542688999999998642788889999998872783369


Q ss_pred             ------------HHHHCCCCHHHHHHHHHH-----HHHHC-----CCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC
Q ss_conf             ------------752036761245799999-----99856-----52589999999999999999999727994553588
Q T0591           277 ------------LQAIVSLRAAGYSQAVLR-----GWFDE-----APGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ  334 (406)
Q Consensus       277 ------------~~~~~~~~~~~~~q~a~~-----~~l~~-----~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~  334 (406)
                                  +...++.+.+++.|...+     .+++.     .+.|++..++.+++|++.+.+.|...  .....|+
T Consensus       363 ~~idrlvadsr~~~l~htagls~pqqv~~al~~~~~~l~~~~~~~~~~y~~~~r~~~~~R~~~L~~~L~~~--~~~~~p~  440 (533)
T 3f6t_A          363 KFIDRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTSTNGGSDDPYIDIARKLVSERYDQLHDAMQAP--KDETDTN  440 (533)
T ss_dssp             CHHHHHHHHHTTTTTGGGCSCCHHHHHHHHHHHHHHHTTCBGGGTBCHHHHHHHHHHHHHHHHHHHHHTCC--CCCSTTB
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCC
T ss_conf             99999876667778877640267178999999999999987334306899999999999999999985266--7776898


Q ss_pred             CCEEEEEECCCC---------------CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC-CCHHHHHHHHHHHH
Q ss_conf             730787766887---------------88989999999986891896161026799985899850-99799999999999
Q T0591           335 AGSYLFPRLPKL---------------AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS-QDHEAAVAAARRIV  398 (406)
Q Consensus       335 gg~~~w~~~~~~---------------~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~-~~~e~l~~al~rl~  398 (406)
                      ||||+|+++...               ..++.+|+.+|++++||+++||+.||. .++|+|+||+ .+++++.+++++|+
T Consensus       441 g~fY~~~dl~~~~~~~~g~~f~~~l~~~~~~~d~~~~Llee~gV~v~PG~~Fg~-~~g~iRiS~A~l~eed~~~i~~~i~  519 (533)
T 3f6t_A          441 THYYSLIDIYRLAEKIYGKEFRDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGA-KPGELRVSQANLPTEDYALIGKQVL  519 (533)
T ss_dssp             CCSEEEEEHHHHHHHHHCHHHHHHHHHHCCHHHHHHHHHHHTTSSSCTTEEECS-STTEEEEESSSSCHHHHHHHHHHHH
T ss_pred             EEEEEEEEHHHHHCCCCCCHHHHCCCCCCCHHHHHHHHHHHCCEEEECCHHHCC-CCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             016998740663100245114421578999999999999868999978433489-9897999944599999999999999


Q ss_pred             HHHHHH
Q ss_conf             999985
Q T0591           399 TLVERY  404 (406)
Q Consensus       399 ~~~~~~  404 (406)
                      +.+++|
T Consensus       520 ~~l~e~  525 (533)
T 3f6t_A          520 ELLKEY  525 (533)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
T ss_conf             999999


No 43 
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A*
Probab=100.00  E-value=0  Score=405.59  Aligned_cols=323  Identities=18%  Similarity=0.219  Sum_probs=246.4

Q ss_pred             CCCCCCCCCHHHHHHHHHH-HHHHCCCCCCC--CCEEEEECCCCHHHHHHHHHH-----HHCCHHHHHHHCCCHHHHHHH
Q ss_conf             8887888898899999999-99864886788--670788248727899999999-----720010101310551389999
Q T0591            71 QAYTEYRGDLGIRDLLAPR-LAAFTGAPVDA--RDGLIITPGTQGALFLAVAAT-----VARGDKVAIVQPDYFANRKLV  142 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~-~~~~~g~~~~~--~~~I~it~G~~~~l~~~~~~l-----~~pGd~Vl~~~P~y~~~~~~~  142 (406)
                      .+||++.|..++||+|++. +.+..+....|  +++|++|+|+++|+..++.++     ++|||+|++++|+|+.|...+
T Consensus       132 ~~Yp~p~~~l~~~e~i~~~yl~~~~~~~~~p~~~~~i~~T~Gat~Al~~if~~l~~~~ll~pGD~Vli~~P~y~~y~~~~  211 (546)
T 2zy4_A          132 CNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIP  211 (546)
T ss_dssp             CSCCSSSSCCHHHHHHHHHHHHHHTTCTTSCGGGEEEEEEEHHHHHHHHHHHHHHHTTSSCTTCEEEEEESCCHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHH
T ss_conf             88979986479999999999999717688989968599907879999999999988307298998998389848799999


Q ss_pred             HHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC--CCEEEECCCC
Q ss_conf             98299699986044666776667788999998502540342156664323344378999999998637--8757841750
Q T0591           143 EFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY--GATVIADQLY  220 (406)
Q Consensus       143 ~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~--~~~ii~De~Y  220 (406)
                      ++.|+.+++|+++..  .+++|.+|.++++++.++++|++++||||||||.++|.+++++|+++|++|  |++||+||+|
T Consensus       212 ~l~g~~~~~v~~~~~--~~~~~~~~~~~l~~~~~~~~k~lil~nP~NPTG~~~s~~~l~~i~~i~~~~~~~l~II~DEvY  289 (546)
T 2zy4_A          212 ELAQYALEEVAINAD--PSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVY  289 (546)
T ss_dssp             HSTTSCCEEEEEECB--GGGTTBCCHHHHGGGGSTTEEEEEEESSCSSSCBCCCHHHHHHHHHHHHHTCTTCEEEEECTT
T ss_pred             HHCCCEEEEEEECCC--CCCCCCCCHHHHHHHCCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             981984799984168--555889999999972899986899828979604348999999999877522898799978865


Q ss_pred             CCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHH----------------------
Q ss_conf             2355688876522332102678689985040010463112114332589999999875----------------------
Q T0591           221 SRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQ----------------------  278 (406)
Q Consensus       221 ~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~----------------------  278 (406)
                      ++|.+++.+   +..   ..++|+|+++||||.|++||||+||+++|++++......+                      
T Consensus       290 ~~~~~~~~s---~~~---~~~~~~I~v~S~SK~f~~~G~RlG~i~~~~~~I~~~~~~~l~~~~~~~l~~~y~~l~~~~~~  363 (546)
T 2zy4_A          290 GTFADDFQS---LFA---ICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRS  363 (546)
T ss_dssp             GGGSTTCCC---HHH---HCGGGEEEEEESTTTTTCGGGCEEEEEEESSCHHHHHHHTSCHHHHHHHHHHHTTTCSCGGG
T ss_pred             CCCCCCCCC---HHH---CCCCCEEEECCCCCCCCCCCCCEEEEEECHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCHHH
T ss_conf             445678876---434---17667799423612037856016999976899999999971532120178899886045203


Q ss_pred             ---------------HHCCCCHHHHHH--HHHH---HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEE
Q ss_conf             ---------------203676124579--9999---99856525899999999999999999997279945535887307
Q T0591           279 ---------------AIVSLRAAGYSQ--AVLR---GWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSY  338 (406)
Q Consensus       279 ---------------~~~~~~~~~~~q--~a~~---~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~  338 (406)
                                     .....+.+++.|  .++.   .+++..+.+.+..+..+++|++.+.+.+ +++++. ..|.++||
T Consensus       364 ~~fi~rlvad~r~~aln~~aglstP~q~q~a~~~~~al~d~~~~y~~~~k~~~~rR~~~l~~~l-g~~~~~-~~~~~~fY  441 (546)
T 2zy4_A          364 LKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYREL-GMPPLR-DENAVDYY  441 (546)
T ss_dssp             CCHHHHHHHHTTTTTTGGGCSSCHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHHGGG-TSSCCC-CTTBCCSE
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHC-CCCCCC-CCCCEEEE
T ss_conf             8999999998888887610303680899999999998622179999999999999999999857-998601-28981489


Q ss_pred             EEEECCCC---------------CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECC-CHHHHHHHHHHHHHHHH
Q ss_conf             87766887---------------889899999999868918961610267999858998509-97999999999999999
Q T0591           339 LFPRLPKL---------------AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQ-DHEAAVAAARRIVTLVE  402 (406)
Q Consensus       339 ~w~~~~~~---------------~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~-~~e~l~~al~rl~~~~~  402 (406)
                      +|++++..               ..++.+|+.+|++++||+++||+.||.. ++++|+||+. +++++.+..++|+++++
T Consensus       442 ~~~dl~~~~~~~~g~~f~~~l~~~~~~~~~~~~Llee~GV~vvPG~~FG~~-~~~vRiS~Anl~e~~~~~I~~~ir~~~~  520 (546)
T 2zy4_A          442 TLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSN-RPSGRASLANLNEYEYAAIGRALRKMAD  520 (546)
T ss_dssp             EEEEHHHHHHHHHCHHHHHHHHHHCCHHHHHHHHHHHHSCCCEESSCTTCS-SCEEEEESSSSCHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHCCEEEECCHHHCCC-CCEEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             998750003444517788762258998999999998489999777445889-8979999487997899999999999999


Q ss_pred             HH
Q ss_conf             85
Q T0591           403 RY  404 (406)
Q Consensus       403 ~~  404 (406)
                      +|
T Consensus       521 e~  522 (546)
T 2zy4_A          521 EL  522 (546)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             99


No 44 
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A*
Probab=100.00  E-value=0  Score=408.93  Aligned_cols=345  Identities=13%  Similarity=0.083  Sum_probs=281.6

Q ss_pred             CCCCEEECCC---CCCCCCCC-HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCC-
Q ss_conf             8983341567---86788788-899999999998087888878888988999999999986488678867078824872-
Q T0591            37 EGRPVDFSHG---DVDAHEPT-PGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQ-  111 (406)
Q Consensus        37 ~~~~i~ls~G---~pd~~~p~-~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~-  111 (406)
                      .+..|||++|   +||..+|. +.+.++..+.+.++..++|++..|.++||++|++|+.++++...++ ++|+++.|++ 
T Consensus        27 ~~~~InL~iG~~~d~~~~~~~~~~V~~a~~~~~~~~~~~~Y~p~~G~~~lReaia~~~~~~~~~~~~~-~~i~~~~~~~~  105 (401)
T 7aat_A           27 NSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKS-GRYVTVQGISG  105 (401)
T ss_dssp             CTTCEECCCCSCCCTTSCCCCCHHHHHHHHHHHHTTCCCCCCCTTCCHHHHHHHHHHHHCTTCHHHHT-TCEEEEEEEHH
T ss_pred             CCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCC-CCEEEECCCHH
T ss_conf             99958863777768889989988999999999638888999998878999999999986105887886-76899457177


Q ss_pred             ----HHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHH---CCCCEEEEC
Q ss_conf             ----7899999999720010101310551389999982996999860446667766677889999985---025403421
Q T0591           112 ----GALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAF---KAGARVFLF  184 (406)
Q Consensus       112 ----~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~---~~~~k~i~l  184 (406)
                          +++.+++.++++|||+|++++|+|+.|...+..+|+++++++++    +++++..+.+.+.+..   .++++++++
T Consensus       106 ~~~~~~~~~~~~~~~~~gd~Vlip~P~y~~y~~~~~~~G~~~~~v~~~----~~~~~~~~~~~~~~~~~~~~~~~~~ii~  181 (401)
T 7aat_A          106 TGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYY----DPKTCSLDFTGAMEDISKIPEKSIILLH  181 (401)
T ss_dssp             HHHHHHHHHHHHHHCTTCCEEEEEESCCTTHHHHHHHTTCEEEEEECE----ETTTTEECHHHHHHHHTTSCTTCEEEEE
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCCCEEEEEECC----HHHCCCCCHHHHHHHHHHCCCCCEEEEE
T ss_conf             899999999987417999989981698711789999859957996253----1430356999999998627898389997


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHH-HHHCCCCCCEEEEEECCHHCCCCCCCCHH
Q ss_conf             56664323344378999999998637875784175023556888765223-32102678689985040010463112114
Q T0591           185 SNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLR-AEAAVDAENVVTIMGPSKTESLSGYRLGV  263 (406)
Q Consensus       185 ~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~-~~~~~~~~~~i~~~S~SK~~~~~GlRiG~  263 (406)
                      +|||||||.++|.+++++|+++|++|+++||+||+|.+|.|++....... .......++++++.|+||.++++|||+||
T Consensus       182 ~~P~NPTG~v~s~e~~~~l~~~a~~~~~~vi~De~Y~~l~~~~~~~~~~~~~~~~~~~~~~i~~~s~sK~~~~~G~RiG~  261 (401)
T 7aat_A          182 ACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGA  261 (401)
T ss_dssp             SSSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEEESCTTTTTSCHHHHTHHHHHHHHTTCCCEEEEECTTTSCCGGGCEEE
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCEEEEEEECCCHHHCCCCCCCCHHHHHHHHHCCCCCEEEECCCCCCCCCCCCEEE
T ss_conf             89999958778999999999987646579999547113104886544677766642156413773144456676677489


Q ss_pred             HHHHHHHHHHHHHHHH-------HCCCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHHHHHHHHHHHHHCC---C
Q ss_conf             3325899999998752-------036761245799999998565------25899999999999999999997279---9
Q T0591           264 AFGSRAIIARMEKLQA-------IVSLRAAGYSQAVLRGWFDEA------PGWMEDRIARHQAIRDELLHVLRGCE---G  327 (406)
Q Consensus       264 ~~~~~~~i~~l~~~~~-------~~~~~~~~~~q~a~~~~l~~~------~~~~~~~~~~~~~~r~~l~~~L~~~~---g  327 (406)
                      ++++.++++.+.+++.       ...++++...|.++...+.+.      .+++++.+++|+++|+.+.+.|++..   +
T Consensus       262 ~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~q~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~~~~~~  341 (401)
T 7aat_A          262 FTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHN  341 (401)
T ss_dssp             EEEECSSHHHHHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSC
T ss_pred             EEECHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             98358889999999999876311442412189999999861787889999999999999999999999999998479888


Q ss_pred             CEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC-CCHHHHHHHHHHHHHHHH
Q ss_conf             455358873078776688788989999999986891896161026799985899850-997999999999999999
Q T0591           328 VFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS-QDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       328 ~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~-~~~e~l~~al~rl~~~~~  402 (406)
                      +.+..|+||||+|+.++      .+++++|++|+||.++||          +||||+ .++++++...++|+++++
T Consensus       342 ~~~~~~~gG~F~~~~ls------~e~~~~Ll~e~gV~~~~g----------~Ris~a~~~~~~i~~~a~ai~~v~k  401 (401)
T 7aat_A          342 WQHITDQIGMFCFTGLK------PEQVERLTKEFSIYMTKD----------GRISVAGVASSNVGYLAHAIHQVTK  401 (401)
T ss_dssp             CHHHHHCCSSEEECCCC------HHHHHHHHHHHCEECCTT----------CEEEGGGCCTTTHHHHHHHHHHHHC
T ss_pred             CEEECCCCEEEEECCCC------HHHHHHHHHCCCEEECCC----------EEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             13767897699944989------999999998398996797----------0898445987779999999999749


No 45 
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A*
Probab=100.00  E-value=0  Score=404.65  Aligned_cols=359  Identities=16%  Similarity=0.102  Sum_probs=276.8

Q ss_pred             HHHHHHHHCCCCCCEEECCC---CCCCCCCCHHHHHHHHHHHHC--CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             99999630378983341567---867887888999999999980--8788887888898899999999998648867886
Q T0591            27 LEALIRGAPIEGRPVDFSHG---DVDAHEPTPGAFDLFSAGVQS--GGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDAR  101 (406)
Q Consensus        27 ~~~~~~~~~~~~~~i~ls~G---~pd~~~p~~~~~~~~~~~~~~--~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~  101 (406)
                      +.+..+..+ .++.||||+|   +||..+|.+..++.+.+.+..  ...++|+|..|+++||++|++|+.+++|..++++
T Consensus        20 ~~~~~~~~~-~~~~InlsiG~~~d~~g~~p~~~~V~~A~~~i~~~~~~~~~Y~p~~G~p~lreaia~~~~~~~~~~~~~~   98 (412)
T 1ajs_A           20 LIADFREDP-DPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIANNSSLNHEYLPILGLAEFRTCASRLALGDDSPALQEK   98 (412)
T ss_dssp             HHHHHHTCC-CTTCEECCSCCCCCTTSCCCCCHHHHHHHHHHHTCTTCCCCCCCTTCCHHHHHHHHHHHHCTTCHHHHTT
T ss_pred             HHHHHHCCC-CCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             999983789-9993884078876988999888999999999973788788889977629999999999732258421246


Q ss_pred             CEEEE-ECC-------CCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             70788-248-------7278999999997200101013105513899999829969998604466677666778899999
Q T0591           102 DGLII-TPG-------TQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEE  173 (406)
Q Consensus       102 ~~I~i-t~G-------~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~  173 (406)
                      ..+.+ |.|       +++++...+.++++|||+|++++|+|+.|...+..+|++.+++++...   +..+..|.+.+++
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pgd~Vl~~~P~y~~y~~~~~~~g~~~~~~~~~~~---~~~~~~~~~~~~~  175 (412)
T 1ajs_A           99 RVGGVQSLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFTTAGFKDIRSYRYWD---TEKRGLDLQGFLS  175 (412)
T ss_dssp             CEEEEEEEHHHHHHHHHHHHHHHHSSSSSCCCSCEEEEESCCTHHHHHHHHTTCSCEEEEECEE---TTTTEECHHHHHH
T ss_pred             CCEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCEEEEEECCCC---CCCCCCCHHHHHH
T ss_conf             5135227631777776999999877751389874895688872379999985981224213565---2346768899999


Q ss_pred             H---HCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHH-HHCCCCCCEEEEEE
Q ss_conf             8---5025403421566643233443789999999986378757841750235568887652233-21026786899850
Q T0591           174 A---FKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRA-EAAVDAENVVTIMG  249 (406)
Q Consensus       174 ~---~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~-~~~~~~~~~i~~~S  249 (406)
                      .   .+++++++++||||||||.++|.+++++|+++|++|+++||+||+|.++.|++.....+.. ......++++++.|
T Consensus       176 ~~~~~~~~~~~il~~~P~NPTG~~~s~e~~~~l~~la~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~~i~~~s  255 (412)
T 1ajs_A          176 DLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNLEKDAWAIRYFVSEGFELFCAQS  255 (412)
T ss_dssp             HHHHSCTTCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTTTTTSCHHHHTHHHHHHHHTTCCEEEEEE
T ss_pred             HHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHCCCCCCCHHHHHHHHHCCCCEEEEEE
T ss_conf             98638788389995799998898899999999999998749349973234665348977770766656530661369961


Q ss_pred             CCHHCCCCCCCCHHHHHHHHHHHHHHHH-------HHHCCCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHHHHH
Q ss_conf             4001046311211433258999999987-------52036761245799999998565------2589999999999999
Q T0591           250 PSKTESLSGYRLGVAFGSRAIIARMEKL-------QAIVSLRAAGYSQAVLRGWFDEA------PGWMEDRIARHQAIRD  316 (406)
Q Consensus       250 ~SK~~~~~GlRiG~~~~~~~~i~~l~~~-------~~~~~~~~~~~~q~a~~~~l~~~------~~~~~~~~~~~~~~r~  316 (406)
                      +||.++++|||+||++++.++++.+...       .....++++...|.++..++.+.      ..++..++++|+++|+
T Consensus       256 ~sK~~~~~G~RiG~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rr~  335 (412)
T 1ajs_A          256 FSKNFGLYNERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRS  335 (412)
T ss_dssp             CTTTSCCGGGCEEEEEEECSSHHHHHHHHHHHHHHHHTTTSSCCSHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             23103246787202433726799999999899887523506446899999999963978899999999999999999999


Q ss_pred             HHHHHHHHCC---CCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC-CCHHHHHH
Q ss_conf             9999997279---9455358873078776688788989999999986891896161026799985899850-99799999
Q T0591           317 ELLHVLRGCE---GVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS-QDHEAAVA  392 (406)
Q Consensus       317 ~l~~~L~~~~---g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~-~~~e~l~~  392 (406)
                      .+.+.|++..   .|.+..|++|||+|+.+      +.+++++|++++||.++||.          ||+|+ .++++++.
T Consensus       336 ~l~~~L~~~~~~~~~~~~~~~~G~F~~~~l------~~~~~~~L~~e~gV~~~pg~----------Ri~~a~~~~~~i~~  399 (412)
T 1ajs_A          336 ELRARLEALKTPGTWNHITDQIGMFSFTGL------NPKQVEYLINQKHIYLLPSG----------RINMCGLTTKNLDY  399 (412)
T ss_dssp             HHHHHHHHTTCSSCCHHHHHCCSSEEECCC------CHHHHHHHHHTTCEECCTTS----------EEEGGGCCTTTHHH
T ss_pred             HHHHHHHHHCCCCCEEEECCCCEEEEECCC------CHHHHHHHHHCCCEEECCCC----------EEEECCCCHHHHHH
T ss_conf             999999983899871577799746984597------99999999981999981896----------48832698888999


Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999999856
Q T0591           393 AARRIVTLVERYR  405 (406)
Q Consensus       393 al~rl~~~~~~~r  405 (406)
                      +.++|++++++.|
T Consensus       400 la~~I~~~~~~~k  412 (412)
T 1ajs_A          400 VATSIHEAVTKIQ  412 (412)
T ss_dssp             HHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHCC
T ss_conf             9999999999609


No 46 
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A
Probab=100.00  E-value=0  Score=386.47  Aligned_cols=334  Identities=19%  Similarity=0.220  Sum_probs=273.3

Q ss_pred             CCCEEECCCCCCCCCCCHHHHHHHHHHHHC--CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             983341567867887888999999999980--878888788889889999999999864886788670788248727899
Q T0591            38 GRPVDFSHGDVDAHEPTPGAFDLFSAGVQS--GGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        38 ~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~--~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      ..+|+|+.++ ++..|+|.+++++.+++.+  ...++|++ .|..+||++||+|+++++|+.+++ ++|++|+|++++|+
T Consensus        30 ~~~i~l~~ne-np~~p~~~v~~a~~~~~~~~~~~~~~Yp~-~~~~~Lr~aia~~~~~~~g~~~~~-~~I~~t~G~~~~i~  106 (369)
T 3cq5_A           30 NVDIRLNTNE-NPYPPSEALVADLVATVDKIATELNRYPE-RDAVELRDELAAYITKQTGVAVTR-DNLWAANGSNEILQ  106 (369)
T ss_dssp             CCSEECSSCC-CCSCCCHHHHHHHHHHHHHHGGGTTSCCC-TTCHHHHHHHHHHHHHHHCCCCCG-GGEEEESHHHHHHH
T ss_pred             CCCEEEECCC-CCCCCCHHHHHHHHHHHHHHHHHCCCCCC-CCHHHHHHHHHHHHHHHHCCCCCC-CEEEEECCHHHHHH
T ss_conf             9967716899-99998999999999999754452176999-987999999999988975889883-14999059899999


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHH-CCCCEEEECCCCCCCCCCC
Q ss_conf             999999720010101310551389999982996999860446667766677889999985-0254034215666432334
Q T0591           116 LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAF-KAGARVFLFSNPNNPAGVV  194 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~-~~~~k~i~l~~P~NPTG~~  194 (406)
                      .+++++++|||+|++++|+|..|...++.+|.+.++++.+      .++.+|++++.+.+ .+++|++++||||||||.+
T Consensus       107 ~~~~~~~~pGd~vl~~~P~y~~~~~~~~~~g~~~v~v~~~------~~~~~d~~~~~~~~~~~~~~~v~l~~P~NPtG~~  180 (369)
T 3cq5_A          107 QLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRG------ADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDV  180 (369)
T ss_dssp             HHHHHHCSTTCEEEEEESSCTHHHHHHHHTTCEEEEEECC------TTSSCCHHHHHHHHHHHCCSEEEEESSCTTTCCC
T ss_pred             HHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCC------CCCCCCHHHHHHHHHCCCCCEEEECCCCCCCCCC
T ss_conf             9999972898989993897168999998659569993168------8878599999998524798489988999986542


Q ss_pred             CCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             43789999999986378757841750235568887652233210267868998504001046311211433258999999
Q T0591           195 YSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARM  274 (406)
Q Consensus       195 ~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l  274 (406)
                      ++.+++.+|++   .++.++|+||+|.+|.+++...+.+.    ..++++|+++||||.|++||+|+||+++++++++++
T Consensus       181 ~~~~el~~l~~---~~~~~vI~Deay~~~~~~~~~~~~~~----~~~~~~iv~~S~SK~~~l~G~RvG~~~~~~~~i~~~  253 (369)
T 3cq5_A          181 TSLDDVERIIN---VAPGIVIVDEAYAEFSPSPSATTLLE----KYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAV  253 (369)
T ss_dssp             CCHHHHHHHHH---HCSSEEEEECTTGGGCCSCCGGGGTT----TCTTTEEEEEESSSTTSCGGGCCEEEEECTHHHHHH
T ss_pred             CHHHHHHHHHH---HCCCEEEEECCCHHHCCCCCCCHHHH----HHCCCEEEECCCCHHHCCCCCEEEEEEECHHHHHHH
T ss_conf             11579999999---72768999447076423434341567----624858995246143248874489998699999999


Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHH
Q ss_conf             98752036761245799999998565258999999999999999999972799455358873078776688788989999
Q T0591           275 EKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFV  354 (406)
Q Consensus       275 ~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~  354 (406)
                      .+++.  ..+.+.+.|.++..++... .+..+.+..++++|+.+.+.|.++ |+.+..|+|+|++|.+.+    ++.+++
T Consensus       254 ~~~~~--~~~~~~~~q~a~~~al~~~-~~~~~~~~~~~~~r~~l~~~L~~~-g~~~~~~~g~f~~~~~~~----~~~~~~  325 (369)
T 3cq5_A          254 MLVRL--PYHLSALSQAAAIVALRHS-ADTLGTVEKLSVERVRVAARLEEL-GYAVVPSESNFVFFGDFS----DQHAAW  325 (369)
T ss_dssp             HTTSC--TTCSCHHHHHHHHHHHHTH-HHHHTHHHHHHHHHHHHHHHHHHH-TCEEECCSSSEEEEECCS----SHHHHH
T ss_pred             HHHCC--CCCCCHHHHHHHHHHHHCC-HHHHHHHHHHHHHHHHHHHHHHHC-CCEEECCCCEEEEEEECC----CHHHHH
T ss_conf             98648--7678869999999998680-999999999999999999999868-898807996799999579----899999


Q ss_pred             HHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             999986891896161026799985899850997999999999999999
Q T0591           355 KILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       355 ~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~  402 (406)
                      +.| .++||+|.|   |+  .++|+|+|++++ |+++..++.|+++++
T Consensus       326 ~~L-~~~gI~vr~---~~--~~~~lRis~~~~-ee~~~li~aL~~ilk  366 (369)
T 3cq5_A          326 QAF-LDRGVLIRD---VG--IAGHLRTTIGVP-EENDAFLDAAAEIIK  366 (369)
T ss_dssp             HHH-HHTTEECBC---CS--CTTEEEEECCCH-HHHHHHHHHHHHHHT
T ss_pred             HHH-HHCCEEEEC---CC--CCCEEEEEECCH-HHHHHHHHHHHHHHH
T ss_conf             999-979969966---89--999799995899-999999999999997


No 47 
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp}
Probab=100.00  E-value=0  Score=392.12  Aligned_cols=363  Identities=13%  Similarity=0.192  Sum_probs=284.8

Q ss_pred             CCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCH
Q ss_conf             97446888714666615789988788999996303789833415678678878889999999999808788887888898
Q T0591             1 MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDL   80 (406)
Q Consensus         1 m~i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~   80 (406)
                      |++.++.+++..- .|.-.       ++++.+... ..+.|+|+.|+.. ..|+|.+++++.+++.+  .+.||+ .|..
T Consensus         2 ~~~~~~~~~~~~~-~~~~~-------~~~~~~~~g-~~~~i~l~~nenp-~~ppp~v~~al~~~~~~--~~~YP~-~g~~   68 (365)
T 3get_A            2 MKFNEFLNNLSNY-EPGKD-------IEVIAKEYG-VKEVIKLASNENP-FGTPPKAIECLRQNANK--AHLYPD-DSMI   68 (365)
T ss_dssp             CCCCGGGGGSCCC-CCCCC-------HHHHHHHTT-CSCCEECSSCCCT-TCSCHHHHHHHHHHGGG--TTSCCC-TTCH
T ss_pred             CCHHHHHHCCCCC-CCCCC-------HHHHHHHCC-CCCEEEECCCCCC-CCCCHHHHHHHHHHHHH--CCCCCC-CCHH
T ss_conf             8752587569998-99989-------999999809-9988993398999-88999999999987764--076998-8889


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCC
Q ss_conf             89999999999864886788670788248727899999999720010101310551389999982996999860446667
Q T0591            81 GIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSAD  160 (406)
Q Consensus        81 ~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~  160 (406)
                      +||++||+|+    ++  + .++|++|+|+++++.++++++++|||.|+++.|+|+.|...++.++.....++..     
T Consensus        69 ~Lr~aiA~~~----~~--~-~~~i~it~G~~~~l~~~~~~~~~~~d~v~~~~p~y~~~~~~~~~~~~~~~~~~~~-----  136 (365)
T 3get_A           69 ELKSTLAQKY----KV--Q-NENIIIGAGSDQVIEFAIHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSI-----  136 (365)
T ss_dssp             HHHHHHHHHH----TC--C-GGGEEEESSHHHHHHHHHHHHCCTTCEEEECSSCCTHHHHHHHHHTCEEEECSSS-----
T ss_pred             HHHHHHHHHH----CC--C-CCCEEECCCHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCC-----
T ss_conf             9999999997----88--9-4529985775899998887404999879976676505789999874201224454-----


Q ss_pred             CCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCC
Q ss_conf             76667788999998502540342156664323344378999999998637875784175023556888765223321026
Q T0591           161 ETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVD  240 (406)
Q Consensus       161 ~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~  240 (406)
                       .++..+.+.+.+...+++|++++||||||||.+++.+++++|+++|++++++++.|++|.++.+++.............
T Consensus       137 -~~~~~~~~~~~~~~~~~~k~i~l~nP~NPtG~~~~~~~l~~l~~~~~~~~~~ii~D~~~~~~~~~~~~~~~s~~~~~~~  215 (365)
T 3get_A          137 -THNLDEFKKLYETHKDEIKLIFLCLPNNPLGECLDASEATEFIKGVNEDCLVVIDAAYNEFASFKDSKKHLEPCELIKE  215 (365)
T ss_dssp             -SCCHHHHHHHHHHTTTTEEEEEEESSCTTTCCCCCHHHHHHHHHTSCTTSEEEEECTTHHHHHHHCGGGCCCHHHHHHH
T ss_pred             -CCCCCCHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEECCHHHHHHCCCCCCCCCHHHHHCC
T ss_conf             -3345579999974546860899738999752100016899999854337379985303645313566565411111035


Q ss_pred             CCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             78689985040010463112114332589999999875203676124579999999856525899999999999999999
Q T0591           241 AENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       241 ~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      .+++|+++||||.|++||+|+||+++++++++.+.+++.  .++.+.++|.++..++.+ ..+..+.++.++++|+.+.+
T Consensus       216 ~~nvIvi~S~SK~~gl~GlR~G~~i~~~~~~~~~~~~~~--~~~vs~~~~~~a~~al~~-~~~~~~~~~~~~~~r~~l~~  292 (365)
T 3get_A          216 FDNVLYLGTFSKLYGLGGLRIGYGIANANIISAFYKLRA--PFNVSNLALKAAVAAMDD-DEFTEKTLENNFSQMELYKE  292 (365)
T ss_dssp             CTTEEEEEESSSTTSCTTTCCEEEEECHHHHHHHHHHSC--TTCSCHHHHHHHHHHHTC-HHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEECCCCHHHCCCCCCCCCCCCCHHHHHHHHHHCC--CCCCCHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHHH
T ss_conf             797799803707742586444444599999999997317--655679999999999846-52557999999987899999


Q ss_pred             HHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHH
Q ss_conf             99727994553588730787766887889899999999868918961610267999858998509979999999999999
Q T0591           321 VLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTL  400 (406)
Q Consensus       321 ~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~  400 (406)
                      .|+.. |+++..+ +|.|+|+.++.  .++.+|+++|+ ++||.|+||+.||   .+|+||++++ +++.+..++.|+++
T Consensus       293 ~l~~~-g~~v~~~-~~~f~~~~~~~--~~~~~~~~~L~-~~gV~v~p~~~fg---~~~iRis~~~-~ee~~~~l~al~~i  363 (365)
T 3get_A          293 FAKKH-NIKIIDS-YTNFITYFFDE--KNSTDLSEKLL-KKGIIIRNLKSYG---LNAIRITIGT-SYENEKFFTEFDKI  363 (365)
T ss_dssp             HHHHT-TCEECCC-SSSEEEEECSS--SCHHHHHHHHH-TTTEECEECGGGT---CSEEEEECCC-HHHHHHHHHHHHHH
T ss_pred             HHHHC-CCEECCC-CCCEEEEECCC--CCHHHHHHHHH-HCCEEEEECCCCC---CCEEEEEECC-HHHHHHHHHHHHHH
T ss_conf             99858-9878889-87789998899--99999999998-5893998278789---1969998599-99999999999997


Q ss_pred             H
Q ss_conf             9
Q T0591           401 V  401 (406)
Q Consensus       401 ~  401 (406)
                      +
T Consensus       364 l  364 (365)
T 3get_A          364 L  364 (365)
T ss_dssp             H
T ss_pred             H
T ss_conf             3


No 48 
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum}
Probab=100.00  E-value=0  Score=383.94  Aligned_cols=335  Identities=14%  Similarity=0.210  Sum_probs=271.6

Q ss_pred             CCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHH
Q ss_conf             98334156786788788899999999998087888878888988999999999986488678867078824872789999
Q T0591            38 GRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLA  117 (406)
Q Consensus        38 ~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~  117 (406)
                      .+.||||.+.+.+ .|+|.+++++.+++..  ...|++. +..+||++||+|+    |+  ++ ++|++|+|+++++.++
T Consensus        26 ~~lid~s~n~Np~-g~p~~~~~al~~~~~~--~~~Yp~~-~~~~Lr~~ia~~~----~~--~~-~~I~~t~G~~~~~~~~   94 (361)
T 3ftb_A           26 RELLDYSSNINPL-GIPKSFLNNIDEGIKN--LGVYPDV-NYRRLNKSIENYL----KL--KD-IGIVLGNGASEIIELS   94 (361)
T ss_dssp             --CEETTCCCCTT-CSCHHHHTTHHHHHHG--GGSCCCT-TCHHHHHHHHHHH----TC--CS-CEEEEESSHHHHHHHH
T ss_pred             CCEEECCCCCCCC-CCCHHHHHHHHHHHHH--CCCCCCC-CHHHHHHHHHHHH----CC--CH-HEEEECCCHHHHHHHH
T ss_conf             9669878999987-8799999999999876--0369997-6999999999986----94--85-5199847299999999


Q ss_pred             HHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCH
Q ss_conf             99997200101013105513899999829969998604466677666778899999850254034215666432334437
Q T0591           118 VAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSA  197 (406)
Q Consensus       118 ~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~  197 (406)
                      +    .+||+|+++.|+|+.|...++..|.+++.++++      .+|.+|+++++++++ ++++++++|||||||.+++.
T Consensus        95 ~----~~~d~Vlv~~P~y~~~~~~~~~~g~~~v~~~~~------~~~~~d~~~l~~~~~-~~~~~ii~nP~NPtG~~~~~  163 (361)
T 3ftb_A           95 I----SLFEKILIIVPSYAEYEINAKKHGVSVVFSYLD------ENMCIDYEDIISKID-DVDSVIIGNPNNPNGGLINK  163 (361)
T ss_dssp             H----TTCSEEEEEESCCTHHHHHHHHTTCEEEEEECC------TTSCCCHHHHHHHTT-TCSEEEEETTBTTTTBCCCH
T ss_pred             H----HHCCEEEEECCCCHHHHHHHHHCCCEEEEEECC------CCCCCCHHHHHHHCC-CCCEEEECCCCCCCCCCCCH
T ss_conf             9----858989990797478999999879989997459------888989999986266-76689857998986867699


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHH-HHHHH
Q ss_conf             89999999986378757841750235568887652233210267868998504001046311211433258999-99998
Q T0591           198 EEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAII-ARMEK  276 (406)
Q Consensus       198 ~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i-~~l~~  276 (406)
                      +++++|+++|++|+++||+||+|.+|.+++.. +.+...  ...+++|+++||||.|++||+|+||++++++.+ +.++.
T Consensus       164 ~~l~~i~~~a~~~~~~vi~Deay~~~~~~~~~-~~~~~~--~~~~~~i~~~S~SK~~g~~G~R~G~~v~~~~~i~~~~~~  240 (361)
T 3ftb_A          164 EKFIHVLKLAEEKKKTIIIDEAFIEFTGDPSS-SFVGEI--KNYSCLFIIRAMTKFFAMPGIRFGYGITNNKEIAAKIKA  240 (361)
T ss_dssp             HHHHHHHHHHHHHTCEEEEECSSGGGTCCTTS-SSGGGT--TTCSSEEEEEESSSTTSCGGGCCEEEEESCHHHHHHHHT
T ss_pred             HHHHHHHHHHHHCCEEEEEECCHHHHCCCCCC-CCHHHH--CCCCCEEEECCCHHHHCCCCCCCEEEEECCHHHHHHHHH
T ss_conf             99999999876348499996010442456565-502220--267855997345164247876504799782999999998


Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHH
Q ss_conf             75203676124579999999856525899999999999999999997279945535887307877668878898999999
Q T0591           277 LQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKI  356 (406)
Q Consensus       277 ~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~  356 (406)
                      ..  ..++++.++|.++..++.+ ..++++.++.++++|+++.+.|.+++++....|++|+|+|+++++  .++.+++++
T Consensus       241 ~~--~~~~~~~~~~~aa~~~~~~-~~~~~~~~~~~~~~~~~l~~~L~~~g~~~~~~~~~~~fv~~~~~~--~~~~~~~~~  315 (361)
T 3ftb_A          241 KQ--NPWNINCFAEMAAINCLKD-TNYIEESLLWIKKERKRFIEELNKIGFIKRVFSPHANFVLCRLEN--ISGEKLYDS  315 (361)
T ss_dssp             TS--CTTCSCHHHHHHHHHTSSC-HHHHHHHHHHHHHHHHHHHHHHHHSSSEEEEECCSSSEEEEEESS--SCHHHHHHH
T ss_pred             HC--CCCCCCHHHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCCCCEEEEEECCC--CCHHHHHHH
T ss_conf             50--8889659999999998538-899999999999999999999971899752579988699998999--999999999


Q ss_pred             HHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             998689189616102679998589985099799999999999999985
Q T0591           357 LRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       357 Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      |+ ++||.|+||+.|+..+++|+|+|+++ +|++++.++.|+++++++
T Consensus       316 L~-~~gI~v~~~~~f~~~~~~~iRis~~t-~ee~~~li~aL~~i~~~L  361 (361)
T 3ftb_A          316 LL-KEDIVIRRCCNFIGLDDSFVRFAIKD-EKKNTKFLRALKGVENNL  361 (361)
T ss_dssp             HH-TTTEECEECTTSTTCCTTEEEEECCC-HHHHHHHHHHHHHHHHTC
T ss_pred             HH-HCCEEEEECCCCCCCCCCEEEEECCC-HHHHHHHHHHHHHHHHCC
T ss_conf             99-78939995755688899979997289-999999999999999519


No 49 
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal aldimine, schiff base; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A*
Probab=100.00  E-value=0  Score=391.68  Aligned_cols=344  Identities=17%  Similarity=0.132  Sum_probs=269.3

Q ss_pred             CCCCEEECCC---CCCCCCCCHHHHHHHHHHHH--CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCC
Q ss_conf             8983341567---86788788899999999998--087888878888988999999999986488678867078824872
Q T0591            37 EGRPVDFSHG---DVDAHEPTPGAFDLFSAGVQ--SGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQ  111 (406)
Q Consensus        37 ~~~~i~ls~G---~pd~~~p~~~~~~~~~~~~~--~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~  111 (406)
                      .+..|||++|   ++|..+|....++.+.+.+.  ....++|+|..|+++||++|++|+.++++..+++ ++|+++.|.+
T Consensus        25 ~~~ki~l~iG~~~~~~g~~~~~~~V~~A~~~l~~~~~~~~~Y~p~~G~~elr~aia~~~~~~~~~~~~~-~~v~~~~~~~  103 (397)
T 3fsl_A           25 RSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQ-QRVATIQTLG  103 (397)
T ss_dssp             CSCCEECSSCCCCCTTSCCCCCHHHHHHHHHHHHSCCCCCCCCCTTCCHHHHHHHHHHHHCTTCHHHHT-TCEEEEEESH
T ss_pred             CCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCC-CCEEEECCCH
T ss_conf             989488507777288899888789999999997186556778996668999999999985136976676-7589846643


Q ss_pred             HH----HHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC---CCCEEEEC
Q ss_conf             78----999999997200101013105513899999829969998604466677666778899999850---25403421
Q T0591           112 GA----LFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK---AGARVFLF  184 (406)
Q Consensus       112 ~~----l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~---~~~k~i~l  184 (406)
                      ++    +.+++..+++|||.|++++|+|+.|...++.+|++++++|++.    ++.+.+|++++.+.+.   ++++++++
T Consensus       104 ~~~~~~~~~~~~~~~~pgd~Vlv~~P~y~~y~~~~~~~G~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~  179 (397)
T 3fsl_A          104 GSGALKVGADFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYD----EATNGVRFNDLLATLKTLQAGSIVLLH  179 (397)
T ss_dssp             HHHHHHHHHHHHHHHCTTCCEEEESSCCHHHHHHHHHTTCCEEEECCEE----TTTTEECHHHHHHHHTTCCTTCEEEEC
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEECCCCCCCHHHHHHHCCCEEEEEECCC----CCCCCCCHHHHHHHHHHCCCCCEEEEE
T ss_conf             4778999999988628998358648988304799998599799983524----445676626667787617887089997


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHH
Q ss_conf             56664323344378999999998637875784175023556888765223321026786899850400104631121143
Q T0591           185 SNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVA  264 (406)
Q Consensus       185 ~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~  264 (406)
                      +|||||||.+++.+++++|+++|++|+++||+||+|.+|.|++...++.........+++++++|+||.|++||+|+||+
T Consensus       180 ~~p~NPTG~~~s~~~~~~l~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~s~SK~~~~~G~RiG~~  259 (397)
T 3fsl_A          180 PCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGL  259 (397)
T ss_dssp             SSSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEEESCTTSSSCTTGGGHHHHHHHHTTCCEEEEEECTTTTTCGGGCCEEE
T ss_pred             CCCCCCCCHHHCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCEEECCCCCEEECCCCCEEEE
T ss_conf             89979887410756999999987307988983202022236886553144433341564113204651342357866899


Q ss_pred             HHHHHHHHHHHHH-------HHHCCCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHHHHHHHHHHHHHCC---CC
Q ss_conf             3258999999987-------52036761245799999998565------25899999999999999999997279---94
Q T0591           265 FGSRAIIARMEKL-------QAIVSLRAAGYSQAVLRGWFDEA------PGWMEDRIARHQAIRDELLHVLRGCE---GV  328 (406)
Q Consensus       265 ~~~~~~i~~l~~~-------~~~~~~~~~~~~q~a~~~~l~~~------~~~~~~~~~~~~~~r~~l~~~L~~~~---g~  328 (406)
                      +++.++++...+.       ......+++...|.++..++.+.      .++..+.++++..+|+.+.+.|....   +|
T Consensus       260 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~L~~~~~~~~~  339 (397)
T 3fsl_A          260 SVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNF  339 (397)
T ss_dssp             EEECSSHHHHHHHHHHHHHHHHTTTSSCCSHHHHHHHHHHTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCC
T ss_pred             EECHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             71617789999999999987651346772799999998608989999999999999999999999999888985899876


Q ss_pred             EEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC-CCHHHHHHHHHHHHHHH
Q ss_conf             55358873078776688788989999999986891896161026799985899850-99799999999999999
Q T0591           329 FARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS-QDHEAAVAAARRIVTLV  401 (406)
Q Consensus       329 ~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~-~~~e~l~~al~rl~~~~  401 (406)
                      .+..|+||||+|+.+      +.+++++|++|+||.+.||          .||||+ .++++++...++|++++
T Consensus       340 ~~~~~~~G~F~~~~l------s~e~~~~L~~e~gV~l~~g----------~Ri~~a~l~~~~i~~l~~ai~~v~  397 (397)
T 3fsl_A          340 DYLLNQRGMFSYTGL------SAAQVDRLREEFGVYLIAS----------GRMCVAGLNTANVQRVAKAFAAVM  397 (397)
T ss_dssp             THHHHCCSSEEECCC------CHHHHHHHHHTTCEECCTT----------CEEEGGGCCTTTHHHHHHHHHHHC
T ss_pred             EEECCCCCEEEEECC------CHHHHHHHHHHCCEEECCC----------CEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             996689832885182------9999999999599992697----------279845799889999999999869


No 50 
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134}
Probab=100.00  E-value=0  Score=386.85  Aligned_cols=334  Identities=19%  Similarity=0.250  Sum_probs=276.0

Q ss_pred             CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHH
Q ss_conf             83341567867887888999999999980878888788889889999999999864886788670788248727899999
Q T0591            39 RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAV  118 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~  118 (406)
                      ..|+|+.++.. ..|+|.+.+++.+++.+...+.|++. |.++||++||+|+.    .+  ++++|++|+|+++++.+++
T Consensus        31 ~~i~L~~nenp-~~pp~~~~~al~~~~~~~~~~~YP~~-~~~~Lr~aiA~~~~----~~--~~~~i~vt~Ga~~~i~~~~  102 (367)
T 3euc_A           31 GLVKLDAMENP-YRLPPALRSELAARLGEVALNRYPVP-SSEALRAKLKEVMQ----VP--AGMEVLLGNGSDEIISMLA  102 (367)
T ss_dssp             TCEECCSSCCC-CCCCHHHHHHHHHHHHHHHTTCSCCC-CHHHHHHHHHHHHT----CC--TTCEEEEEEHHHHHHHHHH
T ss_pred             CCEEEECCCCC-CCCCHHHHHHHHHHHCCHHHCCCCCC-CHHHHHHHHHHHHC----CC--CCCCEEECCCCCHHHHHHH
T ss_conf             81894278999-99899999999997332211479998-68999999999868----99--6651696688614468887


Q ss_pred             HHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHH-HCCCCEEEECCCCCCCCCCCCCH
Q ss_conf             99972001010131055138999998299699986044666776667788999998-50254034215666432334437
Q T0591           119 AATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEA-FKAGARVFLFSNPNNPAGVVYSA  197 (406)
Q Consensus       119 ~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~-~~~~~k~i~l~~P~NPTG~~~s~  197 (406)
                      +++++|||.|++++|+|+.|...++..|++++.|+++.      ++..+.+.+.+. ...+++++++||||||||.+++.
T Consensus       103 ~~~~~~gd~Vli~~P~y~~~~~~~~~~g~~~~~v~~~~------~~~~~~~~~~~~~~~~~~~~i~i~~P~NPtG~~~~~  176 (367)
T 3euc_A          103 LAAARPGAKVMAPVPGFVMYAMSAQFAGLEFVGVPLRA------DFTLDRGAMLAAMAEHQPAIVYLAYPNNPTGNLFDA  176 (367)
T ss_dssp             HHTCCTTCEEEEEESCSCCSCHHHHTTTCEEEEEECCT------TSCCCHHHHHHHHHHHCCSEEEEESSCTTTCCCCCH
T ss_pred             HHHCCCCCEEEECCCCCCCCCHHHHCCCCEEEEECCCC------CCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             52145662488557620011023322786168611244------444321100011014554211245555454644688


Q ss_pred             HHHHHHHHHHHHC--CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             8999999998637--87578417502355688876522332102678689985040010463112114332589999999
Q T0591           198 EEIGQIAALAARY--GATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARME  275 (406)
Q Consensus       198 ~~l~~i~~~a~~~--~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~  275 (406)
                      +++++++++|+++  +.+|++||+|.++.+++..  .    .....+++++++|+|| |++||||+||+++++++++.+.
T Consensus       177 ~~l~~l~~~~~~~~~~~~vi~De~y~~~~~~~~~--~----~~~~~~~~i~~~s~sK-~~l~GlRiG~~i~~~~~i~~l~  249 (367)
T 3euc_A          177 ADMEAIVRAAQGSVCRSLVVVDEAYQPFAQESWM--S----RLTDFGNLLVMRTVSK-LGLAGIRLGYVAGDPQWLEQLD  249 (367)
T ss_dssp             HHHHHHHHHTBTTSCBCEEEEECTTCCSSSCCSG--G----GGGTCTTEEEEEECCC-TTSCSCCEEEEEECHHHHHHHG
T ss_pred             HHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCC--C----CCCCCCCCCCCCCCCC-CCCCCCCCCEEECCHHHHHHHH
T ss_conf             8852011123223233332023443202333121--0----1112334322346665-6661200111653799999999


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHH
Q ss_conf             87520367612457999999985652589999999999999999999727994553588730787766887889899999
Q T0591           276 KLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVK  355 (406)
Q Consensus       276 ~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~  355 (406)
                      +++....  .+.+.|.++..++.. ..++.+.++.++++|+.+.+.|.+..|+.+. |++|+|+|++++    ++.++++
T Consensus       250 ~~~~~~~--~~~~~~~~~~~a~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~-p~~~~fl~~~~~----~~~~~~~  321 (367)
T 3euc_A          250 KVRPPYN--VNVLTEATALFALEH-VAVLDEQAAQLRAERSRVAEGMAAHGGVTVF-PSAANFLLARVP----DAAQTFD  321 (367)
T ss_dssp             GGCCSSC--CCHHHHHHHHHHHTT-HHHHHHHHHHHHHHHHHHHHHHHTSTTCEEC-CCSSSEEEEECS----CHHHHHH
T ss_pred             HHCCCCC--CCCCCCHHHHHHHCC-CCCCCCCHHHHHHHHHHHHHHHHHCCCCEEC-CCCCEEEEEECC----CHHHHHH
T ss_conf             7336553--312220123443203-3222220134566666789999974997888-998618999689----9999999


Q ss_pred             HHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             999868918961610267999858998509979999999999999998
Q T0591           356 ILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       356 ~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~  403 (406)
                      +|+ ++||.++||+.|++.+++|+|+++++ +++.+..++.|++++++
T Consensus       322 ~L~-~~gi~v~~~~~f~~~~~~~iRis~~~-~~e~~~li~al~~~Lke  367 (367)
T 3euc_A          322 RLL-ARKVLIKNVSKMHPLLANCLRVTVST-PEENAQFLEAFAASLQD  367 (367)
T ss_dssp             HHH-TTTEECEECGGGCGGGTTEEEEECCC-HHHHHHHHHHHHHHTCC
T ss_pred             HHH-HCCCEEEECCCCCCCCCCEEEEEECC-HHHHHHHHHHHHHHHCC
T ss_conf             999-78928996676788898989998389-89999999999998378


No 51 
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 1ars_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* 1cq7_A* ...
Probab=100.00  E-value=0  Score=396.12  Aligned_cols=344  Identities=16%  Similarity=0.134  Sum_probs=273.2

Q ss_pred             CCCEEECCC---CCCCCCCC-HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCC-CH
Q ss_conf             983341567---86788788-89999999999808788887888898899999999998648867886707882487-27
Q T0591            38 GRPVDFSHG---DVDAHEPT-PGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGT-QG  112 (406)
Q Consensus        38 ~~~i~ls~G---~pd~~~p~-~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~-~~  112 (406)
                      +..|||++|   ++|...|. +.+.++..+.+.+...++|+|..|+++||+++++|+.++++....++..++++.|+ +.
T Consensus        26 ~~~inL~iG~~~d~~~~~~~~~~V~~A~~~~~~~~~~~~Y~p~~G~~~lR~aia~~~~~~~~~~~~~~~~~~~~~~~~~~  105 (396)
T 2q7w_A           26 PGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTG  105 (396)
T ss_dssp             --CEESSCCSCCCTTSCCCCCHHHHHHHHHHHHHCCCCCCCCTTCCHHHHHHHHHHHHCTTCHHHHTTCEEEEEESHHHH
T ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCHHHH
T ss_conf             99688227787688899998889999999996289889889877789999999999974579877887399954747899


Q ss_pred             H--HHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC---CCCEEEECCCC
Q ss_conf             8--999999997200101013105513899999829969998604466677666778899999850---25403421566
Q T0591           113 A--LFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK---AGARVFLFSNP  187 (406)
Q Consensus       113 ~--l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~---~~~k~i~l~~P  187 (406)
                      +  +..++.+++++||+|++++|+|+.|...++.+|++++.+++.    .++++.+|.+.+++...   ++++++++|||
T Consensus       106 ~~~l~~~~~~~~~~gd~v~~p~P~y~~y~~~~~~~G~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~p  181 (396)
T 2q7w_A          106 ALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY----DAENHTLDFDALINSLNEAQAGDVVLFHGCC  181 (396)
T ss_dssp             HHHHHHHHHHHHSCCCEEEEEESCCTHHHHHHHHTTCEEEEEECE----ETTTTEECHHHHHHHHTTCCTTCEEEEECSS
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCC----CCCCCCCCHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             999999999742898579993778763899999869978973055----2125577888999999854789789997999


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHH
Q ss_conf             64323344378999999998637875784175023556888765223321026786899850400104631121143325
Q T0591           188 NNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS  267 (406)
Q Consensus       188 ~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~  267 (406)
                      |||||.++|.+++++|+++|++|+++||+||+|.+|.|++....+.........++++++.|+||.|+++|||+||++++
T Consensus       182 ~NPTG~~~s~~~~~~i~~la~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~~~~~s~sk~~~~~G~RvG~~~~~  261 (396)
T 2q7w_A          182 HNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSXNFGLYNERVGACTLV  261 (396)
T ss_dssp             CTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTTSSSCHHHHTHHHHHHHHHCSCEEEEEECTTTTTCGGGCCEEEEEE
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCEEEECCCCEECCCCCCCEEEEEC
T ss_conf             99998777989998888762366138998716563447986652687755650665168731631000225770258964


Q ss_pred             HHHHHHHHHHH-------HHCCCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHHHHHHHHHHHHHCCC---CEEE
Q ss_conf             89999999875-------2036761245799999998565------258999999999999999999972799---4553
Q T0591           268 RAIIARMEKLQ-------AIVSLRAAGYSQAVLRGWFDEA------PGWMEDRIARHQAIRDELLHVLRGCEG---VFAR  331 (406)
Q Consensus       268 ~~~i~~l~~~~-------~~~~~~~~~~~q~a~~~~l~~~------~~~~~~~~~~~~~~r~~l~~~L~~~~g---~~~~  331 (406)
                      +++++...+.+       .....+++...|.++..++.+.      .++++.++++++++|+.+.+.|++...   +.+.
T Consensus       262 ~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~~~~~~~~~i  341 (396)
T 2q7w_A          262 AADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFI  341 (396)
T ss_dssp             CSSHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHTSHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHTTCCSCCTHH
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             26799999999999987503234332688999998606867789999999999999999999999999983898773056


Q ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC-CCHHHHHHHHHHHHHHH
Q ss_conf             58873078776688788989999999986891896161026799985899850-99799999999999999
Q T0591           332 TPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS-QDHEAAVAAARRIVTLV  401 (406)
Q Consensus       332 ~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~-~~~e~l~~al~rl~~~~  401 (406)
                      .|++|||+|+.++      .+++.+|++++||.++||+          |+|++ .++++++..+++|++++
T Consensus       342 ~~~~G~F~~~~ls------~e~~~~L~~e~~V~~~~g~----------Ri~~agl~~~~i~~~~~ai~~V~  396 (396)
T 2q7w_A          342 IKQNGMFSFSGLT------KEQVLRLREEFGVYAVASG----------RVNVAGMTPDNMAPLCEAIVAVL  396 (396)
T ss_dssp             HHCCSSEEECCCC------HHHHHHHHHHHCEECCTTC----------EEEGGGCCTTTHHHHHHHHHHHC
T ss_pred             CCCCEEEEEECCC------HHHHHHHHHHCCEEECCCC----------EEEECCCCHHHHHHHHHHHHHHC
T ss_conf             4897189984949------9999999982899967998----------79963799888999999999869


No 52 
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A*
Probab=100.00  E-value=0  Score=389.01  Aligned_cols=344  Identities=15%  Similarity=0.142  Sum_probs=274.7

Q ss_pred             CCCCEEECCC---CCCCCCCC-HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCH
Q ss_conf             8983341567---86788788-8999999999980878888788889889999999999864886788670788248727
Q T0591            37 EGRPVDFSHG---DVDAHEPT-PGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQG  112 (406)
Q Consensus        37 ~~~~i~ls~G---~pd~~~p~-~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~  112 (406)
                      .+..|||++|   ++|..+|. |.+.+++.+.+.+...++|+|..|.++||++|++++.++++....++..++++.|++.
T Consensus        25 ~~~kInl~iG~~~d~~g~~~~~~~V~~a~~~~~~~~~~~~Y~p~~G~~~lR~aia~~~~~~~~~~~~~~~~~~~~~~~~~  104 (394)
T 2ay1_A           25 RQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGAL  104 (394)
T ss_dssp             CTTCEECCCCSCCCTTSCCCCCHHHHHHHHHHHHHCCCCCCCCSSCCHHHHHHHHHHHHGGGCCGGGEEEEEEEHHHHHH
T ss_pred             CCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHH
T ss_conf             99978850787748889989877999999998518878888997778999999999985545533355431046718899


Q ss_pred             HHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHH---HCCCCEEEECCCCCC
Q ss_conf             89999999972001010131055138999998299699986044666776667788999998---502540342156664
Q T0591           113 ALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEA---FKAGARVFLFSNPNN  189 (406)
Q Consensus       113 ~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~---~~~~~k~i~l~~P~N  189 (406)
                      ++.+.+.++++|||+|++++|+|+.|...++.+|++++.+|++.    +.++..+.+++.+.   ..+++++++++||||
T Consensus       105 ~l~~~~~~~~~pgd~Vli~~P~y~~y~~~~~~~G~~~~~vp~~~----~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~N  180 (394)
T 2ay1_A          105 RQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFD----AETRGVDFEGMKADLAAAKKGDMVLLHGCCHN  180 (394)
T ss_dssp             HHHHHHHHHHCTTCCEEEEESCCHHHHHHHHHHTCCEEEEECEE----TTTTEECHHHHHHHHHTCCTTCEEEEESSSCT
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHCCCEEEEECCCC----CCCCCCCCHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             99998888737850799956532120799998599799953542----10345430456777664036836998258889


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHH
Q ss_conf             32334437899999999863787578417502355688876522332102678689985040010463112114332589
Q T0591           190 PAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRA  269 (406)
Q Consensus       190 PTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~  269 (406)
                      |||.++|.+++++|+++|++|+++||+||+|.+|.|++....+..........+++.+.|+||+++++|||+||+.++..
T Consensus       181 PTG~~~s~e~~~~l~~~a~~~~i~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~~~~~s~sk~~~~~g~r~g~~~~~~~  260 (394)
T 2ay1_A          181 PTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCA  260 (394)
T ss_dssp             TTCCCCCHHHHHHHHHHHHHHTCEEEEEECCTTSSSCHHHHHHHHHHHHHHCSSEEEEEECTTTTTCGGGCEEEEEEECS
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCHH
T ss_conf             88877999999999998752527624660654555688655216654332045431020343441024554212003547


Q ss_pred             -------HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHHHHHHHHHHHHHCC---CCEEECC
Q ss_conf             -------9999998752036761245799999998565------25899999999999999999997279---9455358
Q T0591           270 -------IIARMEKLQAIVSLRAAGYSQAVLRGWFDEA------PGWMEDRIARHQAIRDELLHVLRGCE---GVFARTP  333 (406)
Q Consensus       270 -------~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~------~~~~~~~~~~~~~~r~~l~~~L~~~~---g~~~~~p  333 (406)
                             +...+.........+.+...|.++..++.+.      .++++..+++++++|+.+.+.|+++.   .|.+..|
T Consensus       261 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~g~~~~~~~~~~  340 (394)
T 2ay1_A          261 DAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAE  340 (394)
T ss_dssp             SHHHHHHHHHHHHHHHHTTTSSCCCHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSTTTHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             79999999877766402222455178888887630577899999999999999999999999999998589886468779


Q ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC-CCHHHHHHHHHHHHHH
Q ss_conf             873078776688788989999999986891896161026799985899850-9979999999999999
Q T0591           334 QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS-QDHEAAVAAARRIVTL  400 (406)
Q Consensus       334 ~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~-~~~e~l~~al~rl~~~  400 (406)
                      +||||+|+.++      .+++++|++|+||.++||+          ||||+ .++++++...++|.++
T Consensus       341 ~gG~F~~~~ls------~e~~~~L~~e~~V~~~~g~----------Ris~a~l~~~~i~~l~~ai~~v  392 (394)
T 2ay1_A          341 HRGMFSRLGAT------PEQVKRIKEEFGIYMVGDS----------RINIAGLNDNTIPILARAIIEV  392 (394)
T ss_dssp             CCSSEEECCCC------HHHHHHHHHHHCEECCTTC----------EEEGGGCCTTTHHHHHHHHHHH
T ss_pred             CCEEEEECCCC------HHHHHHHHHHCCEEECCCC----------EEEECCCCHHHHHHHHHHHHHH
T ss_conf             97069842959------9999999984998847985----------7995569988899999999982


No 53 
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase, cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A*
Probab=100.00  E-value=0  Score=380.13  Aligned_cols=336  Identities=13%  Similarity=0.184  Sum_probs=273.0

Q ss_pred             CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHH
Q ss_conf             83341567867887888999999999980878888788889889999999999864886788670788248727899999
Q T0591            39 RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAV  118 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~  118 (406)
                      +.||||.|.+.+ .|++.+.+++.+++..  .++||+ .|.++||++||+++    |+  + .++|++|+|+++++.+++
T Consensus        25 ~iidls~n~np~-~~p~~~~~a~~~~~~~--~~~YP~-~~~~~Lr~aiA~~~----~v--~-~~~I~i~~gs~~~~~~~~   93 (364)
T 1lc5_A           25 QLLDFSANINPL-GMPVSVKRALIDNLDC--IERYPD-ADYFHLHQALARHH----QV--P-ASWILAGNGETESIFTVA   93 (364)
T ss_dssp             GSEECSSCCCTT-CCCHHHHHHHHHTGGG--GGSCCC-TTCHHHHHHHHHHH----TS--C-GGGEEEESSHHHHHHHHH
T ss_pred             CEEECCCCCCCC-CCCHHHHHHHHHHHHH--HCCCCC-CCHHHHHHHHHHHH----CC--C-HHEEEECCCHHHHHHHHH
T ss_conf             158856999998-8899999999987777--327999-98499999999986----97--8-550998865999999985


Q ss_pred             HHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHH
Q ss_conf             99972001010131055138999998299699986044666776667788999998502540342156664323344378
Q T0591           119 AATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAE  198 (406)
Q Consensus       119 ~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~  198 (406)
                      .++  +|+.++++.|+|+.|.......+++++.+++..    +++|.++ +.+++..++++|++++||||||||.+++.+
T Consensus        94 ~~~--~~~~~~i~~p~~~~y~~~~~~~~~~~~~~~~~~----~~~~~~~-~~~~~~~~~~~~~v~l~nPnNPtG~~~~~~  166 (364)
T 1lc5_A           94 SGL--KPRRAMIVTPGFAEYGRALAQSGCEIRRWSLRE----ADGWQLT-DAILEALTPDLDCLFLCTPNNPTGLLPERP  166 (364)
T ss_dssp             HHH--CCSEEEEEESCCTHHHHHHHHTTCEEEEEECCG----GGTTCCC-TTHHHHCCTTCCEEEEESSCTTTCCCCCHH
T ss_pred             HCC--CCCCEEEECCCCHHHHHHHHHCCCEEEEEECCH----HHCCCCH-HHHHHHCCCCCCEEEEECCCCCCCCCCHHH
T ss_conf             114--899679967984478999998298357985655----5178981-999974789975899838989866434477


Q ss_pred             HHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHH-HHHHHHH
Q ss_conf             999999998637875784175023556888765223321026786899850400104631121143325899-9999987
Q T0591           199 EIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAI-IARMEKL  277 (406)
Q Consensus       199 ~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~-i~~l~~~  277 (406)
                      ++++|+++|++|++++|+||+|.+|.+++......    ....+++++++||||.|++||+|+||++++++. ++.+++.
T Consensus       167 ~l~~l~~~a~~~~~~ii~De~y~~f~~~~~~~~~~----~~~~~~vi~~~S~SK~~gl~GlR~G~~i~~~~~~~~~~~~~  242 (364)
T 1lc5_A          167 LLQAIADRCKSLNINLILDEAFIDFIPHETGFIPA----LKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQ  242 (364)
T ss_dssp             HHHHHHHHHHHHTCEEEEECTTGGGSTTCCCSGGG----CTTCTTEEEEEESTTTTTCTTTCCEEEECCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCH----HHCCCCCEEEECCCHHHCCCCCCEEEEEECCHHHHHHHHHH
T ss_conf             87777877631520699746655334565332202----32177523883344453378652389997859999999985


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHH
Q ss_conf             52036761245799999998565258999999999999999999972799455358873078776688788989999999
Q T0591           278 QAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKIL  357 (406)
Q Consensus       278 ~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~L  357 (406)
                      +  ..++.+.++|.++..++++ ..++.+.++.++++++.+.+.|.+++|+.+ .|++|+|+|++++.   ++.+++++|
T Consensus       243 ~--~~~~~~~~~~~~a~~~l~~-~~~~~~~~~~~~~~~~~~~~~L~~~~~~~~-~p~~~~f~~~~~~~---~~~~~~~~L  315 (364)
T 1lc5_A          243 Q--MPWSVNALAALAGEVALQD-SAWQQATWHWLREEGARFYQALCQLPLLTV-YPGRANYLLLRCER---EDIDLQRRL  315 (364)
T ss_dssp             S--CTTCSCHHHHHHHHHGGGC-HHHHHHHHHHHHHHHHHHHHHHHTSTTEEE-CCCSSSEEEEEESC---TTCCHHHHH
T ss_pred             H--CCCCCHHHHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHHHHHHCCCCEE-CCCCCEEEEEECCC---CHHHHHHHH
T ss_conf             1--8731008999999999609-899999999999998999999985699888-89987799997899---999999999


Q ss_pred             HHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             986891896161026799985899850997999999999999999856
Q T0591           358 RLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       358 l~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      + ++||+++||+.|+..+++|+|||+++ +++++..++.|+++++...
T Consensus       316 ~-~~gi~v~~~~~f~~~~~~~~Ris~~~-~ee~~~~l~~L~~il~~~~  361 (364)
T 1lc5_A          316 L-TQRILIRSCANYPGLDSRYYRVAIRS-AAQNERLLAALRNVLTGIA  361 (364)
T ss_dssp             H-TTTEECEECTTSTTCCTTEEEEECCC-HHHHHHHHHHHHHHC----
T ss_pred             H-HCCCEEEECCCCCCCCCCEEEEEECC-HHHHHHHHHHHHHHHHCCC
T ss_conf             9-78919984765789999989998389-9999999999999986678


No 54 
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1
Probab=100.00  E-value=0  Score=390.99  Aligned_cols=348  Identities=16%  Similarity=0.144  Sum_probs=271.4

Q ss_pred             CCCCEEECCC---CCCCCCCCHHHHHHHHHHHHC--CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCC-EEEEECCC
Q ss_conf             8983341567---867887888999999999980--87888878888988999999999986488678867-07882487
Q T0591            37 EGRPVDFSHG---DVDAHEPTPGAFDLFSAGVQS--GGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARD-GLIITPGT  110 (406)
Q Consensus        37 ~~~~i~ls~G---~pd~~~p~~~~~~~~~~~~~~--~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~-~I~it~G~  110 (406)
                      .+..|||++|   ++|..+|.+..++.+.+.+..  ...++|+|..|.++||+++++|+.++++.....++ .+++|.|+
T Consensus        28 ~~~kInL~iG~y~d~~g~~~~~~~V~~A~~~l~~~~~~~~~Y~p~~G~~~lr~aia~~~~~~~~~~~~~~~~~~~~~~~~  107 (412)
T 1yaa_A           28 RATKVDLGIGAYRDDNGKPWVLPSVKAAEKLIHNDSSYNHEYLGITGLPSLTSNAAKIIFGTQSDALQEDRVISVQSLSG  107 (412)
T ss_dssp             CSSCEECSSCCCBCTTSCBCCCHHHHHHHHHHHTCTTCCCCCCCTTCCHHHHHHHHHHHHCTTCHHHHTTCEEEEEEEHH
T ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCEEECCCCC
T ss_conf             98968830777748889999878999999999727665788999756099999999998400276533221100014530


Q ss_pred             CHHHHHH--HHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC---CCCEEEECC
Q ss_conf             2789999--99997200101013105513899999829969998604466677666778899999850---254034215
Q T0591           111 QGALFLA--VAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK---AGARVFLFS  185 (406)
Q Consensus       111 ~~~l~~~--~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~---~~~k~i~l~  185 (406)
                      +.++.++  +.++++|||.|++++|+|+.|...+..+|++++.+++..    ++.+..+.+.+.+.+.   +++++++++
T Consensus       108 ~~~~~~~~~~~~~~~pgd~Vlip~P~y~~y~~~~~~~g~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~i~~~  183 (412)
T 1yaa_A          108 TGALHISAKFFSKFFPDKLVYLSKPTWANHMAIFENQGLKTATYPYWA----NETKSLDLNGFLNAIQKAPEGSIFVLHS  183 (412)
T ss_dssp             HHHHHHHHHHHHHHCTTCCEEEEESCCTTHHHHHHTTTCCEEEEECEE----TTTTEECHHHHHHHHHHSCTTCEEEEEC
T ss_pred             HHHHHHHHHHHHCCCCCCEEECCCCCCCCHHHHHHHCCCCCCCCCCCC----CCCCCCCCHHHHHHHCCCCCCEEEEEEC
T ss_conf             568999999874248999885578776551789997599531354333----4554422101232211478753899943


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHH----HHHCCCCCCEEEEEECCHHCCCCCCCC
Q ss_conf             6664323344378999999998637875784175023556888765223----321026786899850400104631121
Q T0591           186 NPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLR----AEAAVDAENVVTIMGPSKTESLSGYRL  261 (406)
Q Consensus       186 ~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~----~~~~~~~~~~i~~~S~SK~~~~~GlRi  261 (406)
                      |||||||.+++.+++++|+++|++++++||+||+|.+|.|++.......    .......+++|++.|+||.|++||||+
T Consensus       184 ~p~NPTG~~~s~~~~~~i~~~~~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~~~~~i~~~s~SK~~~~~G~Ri  263 (412)
T 1yaa_A          184 CAHNPTGLDPTSEQWVQIVDAIASKNHIALFDTAYQGFATGDLDKDAYAVRLGVEKLSTVSPVFVCQSFAKNAGMYGERV  263 (412)
T ss_dssp             SSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEEESCTTTSSSCHHHHTHHHHHHHHHTTTTCCEEEEEECTTTSCCGGGCE
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCEEEECCHHHHHHHCCCCCCCHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCE
T ss_conf             78998376489999999999986459146225024444138855641443232320135776299971477655777760


Q ss_pred             HHHHHHHHHHHHHHHHH-----------HHCCCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             14332589999999875-----------2036761245799999998565------258999999999999999999972
Q T0591           262 GVAFGSRAIIARMEKLQ-----------AIVSLRAAGYSQAVLRGWFDEA------PGWMEDRIARHQAIRDELLHVLRG  324 (406)
Q Consensus       262 G~~~~~~~~i~~l~~~~-----------~~~~~~~~~~~q~a~~~~l~~~------~~~~~~~~~~~~~~r~~l~~~L~~  324 (406)
                      ||++++++++..+..++           +....+.+...|.++..++.+.      .+++.+++++|+++|+.+.+.|++
T Consensus       264 G~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~  343 (412)
T 1yaa_A          264 GCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTMSSRITKMRHALRDHLVK  343 (412)
T ss_dssp             EEEEEECCSCTTHHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             78996433667788899888776789999886347749999999851787789999999999999999999999999998


Q ss_pred             CCC---CEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC-CCHHHHHHHHHHHHHH
Q ss_conf             799---455358873078776688788989999999986891896161026799985899850-9979999999999999
Q T0591           325 CEG---VFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS-QDHEAAVAAARRIVTL  400 (406)
Q Consensus       325 ~~g---~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~-~~~e~l~~al~rl~~~  400 (406)
                      +..   |.+..|+||||+|+.+      +.+++++|++++||.++||+          |++++ .++++++...+.|.++
T Consensus       344 ~g~~~~~~~~~~~gG~F~~~~l------s~e~~~~L~~~~~V~~~~g~----------Ris~~g~~~~~i~~la~ai~~v  407 (412)
T 1yaa_A          344 LGTPGNWDHIVNQCGMFSFTGL------TPQMVKRLEETHAVYLVASG----------RASIAGLNQGNVEYVAKAIDEV  407 (412)
T ss_dssp             HTCSSCCTHHHHCCSSEEECCC------CHHHHHHHHHHHCEECCTTS----------EEEGGGCCTTTHHHHHHHHHHH
T ss_pred             HCCCCCCCEECCCCEEEEECCC------CHHHHHHHHHHCCEEECCCC----------EEEECCCCHHHHHHHHHHHHHH
T ss_conf             4898886256899617983398------99999999985988977988----------7985139888899999999999


Q ss_pred             HHHH
Q ss_conf             9985
Q T0591           401 VERY  404 (406)
Q Consensus       401 ~~~~  404 (406)
                      ++.|
T Consensus       408 ~k~~  411 (412)
T 1yaa_A          408 VRFY  411 (412)
T ss_dssp             HHHC
T ss_pred             HHHH
T ss_conf             9851


No 55 
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis}
Probab=100.00  E-value=0  Score=385.58  Aligned_cols=331  Identities=18%  Similarity=0.256  Sum_probs=266.3

Q ss_pred             CCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             78983341567867887888999999999980878888788889889999999999864886788670788248727899
Q T0591            36 IEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        36 ~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      ...+.||||.+.+... |++.+.+++.+.+..  ...||+.. ..+||++||++    +|+  ++ ++|++|+|++++|.
T Consensus        13 ~~~~i~dfs~n~~~~~-~p~~~~~~l~~~~~~--~~~YPd~~-~~~Lr~aiA~~----~~v--~~-d~I~it~G~~e~i~   81 (350)
T 3fkd_A           13 LSSEIVNFSTTVWTDG-DKDHLEKHLVENLNC--IRHYPEPD-AGTLRQMLAKR----NSV--DN-NAILVTNGPTAAFY   81 (350)
T ss_dssp             ---CCEECSCCSCCCS-CCHHHHHHHHHTGGG--GGSCCCTT-CHHHHHHHHHH----TTC--CG-GGEEEESHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCC-CCHHHHHHHHHHHHH--HHCCCCCC-HHHHHHHHHHH----HCC--CH-HEEEECCCHHHHHH
T ss_conf             8676646678899999-999999999998899--74299998-89999999999----788--72-41998457999999


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCC
Q ss_conf             99999972001010131055138999998299699986044666776667788999998502540342156664323344
Q T0591           116 LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVY  195 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~  195 (406)
                      ++++++  +||+|++++|+|+.|...++..|.+.+.++++..             +.++..+++|++++||||||||.++
T Consensus        82 ~~~~~~--~gd~vlv~~P~Y~~y~~~~~~~g~~~~~~~~~~~-------------~~~~~~~~~~~i~l~nPnNPtG~~~  146 (350)
T 3fkd_A           82 QIAQAF--RGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNED-------------IGEADFSNMDFCWLCNPNNPDGRLL  146 (350)
T ss_dssp             HHHHHT--TTCEEEEEESCCHHHHHHHHHTTCEEEEEETTSC-------------GGGSCCTTCSEEEEESSCTTTCCCC
T ss_pred             HHHHHH--CCCCEEEECCCHHHHHHHHHHHCCCCEEECCHHH-------------HHHHCCCCCCEEEECCCCCCCCCCC
T ss_conf             999985--8997799678628899999982886413356888-------------9874234898899838999986644


Q ss_pred             CHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             37899999999863787578417502355688876522332102678689985040010463112114332589999999
Q T0591           196 SAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARME  275 (406)
Q Consensus       196 s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~  275 (406)
                      +.+++++|++  +.++..+|+||+|.++.++...  ....  ....+++|+++||||.+++||+|+||+++++++++++.
T Consensus       147 s~e~~~~i~~--~~~~~~vi~De~y~~f~~~~~~--~~~~--~~~~~~~i~~~s~SK~~~~~GlRiG~~~~~~~li~~l~  220 (350)
T 3fkd_A          147 QRTEILRLLN--DHPDTTFVLDQSYVSFTTEEVI--RPAD--IKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVA  220 (350)
T ss_dssp             CHHHHHHHHH--HCTTSEEEEECTTTTSCSSCCC--CGGG--GTTCSSEEEEEESHHHHSCGGGCCEEEECCHHHHHHHH
T ss_pred             CCCHHHHHHH--HCCCCEEEEEEEEECCCCCCCC--CCHH--HCCCCCEEEECCCCCCCCCCHHCEEEECCCHHHHHHHH
T ss_conf             4421557999--7467628866532101346666--6044--30457647840453211686221455128999999999


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHH
Q ss_conf             87520367612457999999985652589999999999999999999727994553588730787766887889899999
Q T0591           276 KLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVK  355 (406)
Q Consensus       276 ~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~  355 (406)
                      +++.  .++.+.++|.++..++.+.+.+....++ +.++|+.+.+.|.+..|+.+. |++|+|+|++++.  .++.+++.
T Consensus       221 ~~~~--~~~~~~~~~~~a~~~l~~~~~~~~~~~~-~~~~r~~~~~~l~~~~g~~v~-p~~~~f~~~~~~~--~~~~~~~~  294 (350)
T 3fkd_A          221 AFST--PWAVNALAIEAAKFILIHPAQFTLPIRK-WQRNTVDFITALNRLDGVEVH-PSGTTFFLLRLKK--GTAAELKK  294 (350)
T ss_dssp             TTCC--TTCSCHHHHHHHHHHHHCTTTTCCCHHH-HHHHHHHHHHHHHHSTTEEEC-CCSSSEEEEEESS--SCHHHHHH
T ss_pred             HHCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCCCCEEC-CCCCEEEEEECCC--CCHHHHHH
T ss_conf             9669--7663899999999975222999999999-999999999997404896888-9985599998999--99999999


Q ss_pred             HHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             99986891896161026799985899850997999999999999999856
Q T0591           356 ILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       356 ~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      .+++++||+|+||+.|+...++|+|||+++ +|++++.+++|+++++|||
T Consensus       295 ~~L~~~gV~v~pg~~f~~~~~~~iRis~~~-~ee~~~~i~aL~~~l~k~~  343 (350)
T 3fkd_A          295 YMLEEYNMLIRDASNFRGLDESYVRITTQR-PAQNQLFIKALETFLEKYE  343 (350)
T ss_dssp             HHHHTTCEECEECTTSTTCCTTEEEEECCC-HHHHHHHHHHHHHHHTC--
T ss_pred             HHHHHCCEEEEECCCCCCCCCCEEEEEECC-HHHHHHHHHHHHHHHHHHC
T ss_conf             999869999997875788898989998379-9999999999999999838


No 56 
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria innocua CLIP11262, structural genomics, PSI-2, protein structure initiative; 2.31A {Listeria innocua}
Probab=100.00  E-value=0  Score=374.47  Aligned_cols=359  Identities=14%  Similarity=0.182  Sum_probs=281.8

Q ss_pred             CCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCH
Q ss_conf             97446888714666615789988788999996303789833415678678878889999999999808788887888898
Q T0591             1 MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDL   80 (406)
Q Consensus         1 m~i~~~~~r~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~   80 (406)
                      |..+.+.+++.    |+.    .+..+.++.+... .++.|+||.++. +..|+|.+.+++++.+.  ....||+ .|..
T Consensus         4 ~~~~~~~~~~~----~y~----~~~~~~~~~~~~g-~~~~i~l~~Nen-p~gp~p~v~~al~~~~~--~~~~YP~-~~~~   70 (363)
T 3ffh_A            4 MKWKKSLAGLS----SYK----PGKREEEVMAELG-LTKITKLSSNEN-PLGTSKKVAAIQANSSV--ETEIYPD-GWAS   70 (363)
T ss_dssp             CCCCGGGTTCC----C--------CHHHHHHHTTT-CSCCEECSSCSC-TTCCCHHHHHHHHTCBS--CCCBC-----CH
T ss_pred             CCCCHHHHCCC----CCC----CCCCHHHHHHHCC-CCCEEEEECCCC-CCCCCHHHHHHHHHHHH--HHCCCCC-CCHH
T ss_conf             76446862899----999----9999899998749-998699548999-98888999999996467--5166999-8889


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCC
Q ss_conf             89999999999864886788670788248727899999999720010101310551389999982996999860446667
Q T0591            81 GIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSAD  160 (406)
Q Consensus        81 ~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~  160 (406)
                      +||++||+++    |+  + +++|++|+|+++++..++++++.+||.|+++.|+|+.|...++..|.+++.++++.    
T Consensus        71 ~Lr~~iA~~~----~i--~-~d~I~~t~Ga~~~i~~~~~~l~~~gd~vi~~~P~y~~~~~~a~~~g~~~~~~~~~~----  139 (363)
T 3ffh_A           71 SLRKEVADFY----QL--E-EEELIFTAGVDELIELLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREIPLLQ----  139 (363)
T ss_dssp             HHHHHHHHHH----TC--C-GGGEEEESSHHHHHHHHHHHHCSTTCEEEEEESSCHHHHHHHHHHTCEEEEEECCT----
T ss_pred             HHHHHHHHHH----CC--C-HHHEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCCEEEECCC----
T ss_conf             9999999997----85--8-79999828788999999999708999899836860477899986597201320134----


Q ss_pred             CCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCC
Q ss_conf             76667788999998502540342156664323344378999999998637875784175023556888765223321026
Q T0591           161 ETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVD  240 (406)
Q Consensus       161 ~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~  240 (406)
                        ++..+++++++.+++++|++++||||||||.+++.+++.++++.|++++++++.|+.|.++.+++...  ...  ...
T Consensus       140 --~~~~~~~~l~~~i~~~~~lv~l~nPnNPtG~~~~~~el~~l~~~~~~~~~~iidD~~~~~~~~~~~~~--~~~--~~~  213 (363)
T 3ffh_A          140 --DGEHDLEGMLNAIDEKTTIVWICNPNNPTGNYIELADIQAFLDRVPSDVLVVLDEAYIEYVTPQPEKH--EKL--VRT  213 (363)
T ss_dssp             --TSCCCHHHHHHHCCTTEEEEEEESSCTTTCCCCCHHHHHHHHTTSCTTSEEEEECTTGGGCSSCCCCC--GGG--GGT
T ss_pred             --CCCCCHHHHHHHCCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECHHHHHHCCCCCCC--HHH--HHC
T ss_conf             --54205899997567798389977998998710448999999997334838999640267642577642--123--303


Q ss_pred             CCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             78689985040010463112114332589999999875203676124579999999856525899999999999999999
Q T0591           241 AENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       241 ~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      .+++|+++||||.|++||+|+||+++++++++.+.+...  .++++++.|.++..++.+ ..+..+.++.+.+.++.+..
T Consensus       214 ~~~~i~~~s~SK~~gl~G~R~G~~~~~~~~~~~l~~~~~--~~~~~~~~q~a~~~al~~-~~~~~~~~~~~~~~~~~~~~  290 (363)
T 3ffh_A          214 YKNLIITRTFSKIYGLASARVGYGIADKEIIRQLNIVRP--PFNTTSIGQKLAIEAIKD-QAFIGECRTSNANGIKQYEA  290 (363)
T ss_dssp             CTTEEEEEESSSTTCCSSCCCEEEEECHHHHHHHHHTCC--SCCCBHHHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCC--CCCCCHHHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHH
T ss_conf             674576225653214665444234599999999997408--744456999999999859-39999999999998888999


Q ss_pred             HHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHH
Q ss_conf             99727994553588730787766887889899999999868918961610267999858998509979999999999999
Q T0591           321 VLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTL  400 (406)
Q Consensus       321 ~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~  400 (406)
                      .+.+++|+++. |++|+|+|++++   .++.++++.| .++||.|+||+.||.  ++|+|+|+++ +|+++..++.|+++
T Consensus       291 ~~~~l~g~~~~-ps~a~fv~~~~~---~~~~~l~~~L-~~~gI~vr~g~~fg~--~~~iRis~~~-~ee~~~~i~al~~i  362 (363)
T 3ffh_A          291 FAKRFEKVKLY-PANGNFVLIDLG---IEAGTIFSYL-EKNGYITRSGAALGF--PTAVRITIGK-EEDNSAVIALLEKL  362 (363)
T ss_dssp             HHHHCTTCEEC-CCCSSEEEEECS---SCHHHHHHHH-HHTTEECEETTTTTC--TTEEEEECCC-HHHHHHHHHHHHHH
T ss_pred             HHHHCCCCEEC-CCCCEEEEEECC---CCHHHHHHHH-HHCCEEEECCCCCCC--CCEEEEEECC-HHHHHHHHHHHHHH
T ss_conf             99856997677-898528999689---9999999999-809979976887899--9989997089-99999999999986


No 57 
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 1.61A {Geobacter metallireducens gs-15}
Probab=100.00  E-value=0  Score=362.12  Aligned_cols=326  Identities=21%  Similarity=0.288  Sum_probs=258.9

Q ss_pred             CCCEEECCCCCCCCCCCHHHHHHHHHHHHCC--CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             9833415678678878889999999999808--78888788889889999999999864886788670788248727899
Q T0591            38 GRPVDFSHGDVDAHEPTPGAFDLFSAGVQSG--GVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        38 ~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~--~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      ...|||+.|++++ .|+|.+++++.+++...  ..+.| |..|..+||++||+++    |+  + +++|++|+|+++++.
T Consensus        26 ~~~i~L~~nenp~-~p~p~v~~a~~~~l~~~~~~~~~Y-p~~~~~~Lr~aiA~~~----~~--~-~~~I~it~Ga~~ai~   96 (360)
T 3hdo_A           26 ASWIKLNTNENPY-PPSPEVVKAILEELGPDGAALRIY-PSASSQKLREVAGELY----GF--D-PSWIIMANGSDEVLN   96 (360)
T ss_dssp             TTSEECSSCCCSS-CCCHHHHHHHHHHHTTTCGGGGSC-CCSSCHHHHHHHHHHH----TC--C-GGGEEEESSHHHHHH
T ss_pred             CCCEECCCCCCCC-CCCHHHHHHHHHHHHCCHHHHCCC-CCCCHHHHHHHHHHHH----CC--C-HHHCCCCCCCHHHHH
T ss_conf             9907868989899-999999999999975064542209-9876799999999885----33--1-653145554167888


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCC
Q ss_conf             99999972001010131055138999998299699986044666776667788999998502540342156664323344
Q T0591           116 LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVY  195 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~  195 (406)
                      .++.+++++||.|++++|+|+.|...+..+|.+++.++.+...    .+...      ..+.++|++++||||||||.++
T Consensus        97 ~~~~~~~~~g~~V~~~~P~y~~~~~~~~~~g~~~~~~~~~~~~----~~~~~------~~~~~~kli~l~nP~NPtG~~~  166 (360)
T 3hdo_A           97 NLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTGDF----RIAGF------PERYEGKVFFLTTPNAPLGPSF  166 (360)
T ss_dssp             HHHHHHCCTTCEEEEESSSCTHHHHHHHHHTCEEEEECBCTTS----SBTTC------CSSBCSSEEEEESSCTTTCCCC
T ss_pred             HHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCC----HHHHH------HHHHCCCEEECCCCCCCCCCCC
T ss_conf             8987424579668614330168889999729753234322111----11565------5400343221001367876768


Q ss_pred             CHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             37899999999863787578417502355688876522332102678689985040010463112114332589999999
Q T0591           196 SAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARME  275 (406)
Q Consensus       196 s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~  275 (406)
                      +.+++   .++|++++.++|+||+|.+|.++..    ....  ...+++|+++||||.|++||+|+||+++++++++.+.
T Consensus       167 ~~~ei---~~la~~~~~~ii~De~~~~~~~~~~----~~~~--~~~~~vi~~~S~SK~~gl~GlR~G~i~~~~~~~~~l~  237 (360)
T 3hdo_A          167 PLEYI---DELARRCAGMLVLDETYAEFAESNA----LELV--RRHENVVVTRTLSKSYSLAGMRIGLAIARPEVIAALD  237 (360)
T ss_dssp             CHHHH---HHHHHHBSSEEEEECTTGGGSSCCC----THHH--HHCSSEEEEEESTTTTSCTTSCCEEEECCHHHHHHHH
T ss_pred             CHHHH---HHHHHHCCCCCHHHHHHHHHCCCCC----CCCH--HHCCCEEEECCCCHHHCCCCCCCHHHHCCCHHHHHHH
T ss_conf             89999---9999876864013455554223320----0243--2249789986483885087342113204604677765


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHH
Q ss_conf             87520367612457999999985652589999999999999999999727994553588730787766887889899999
Q T0591           276 KLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVK  355 (406)
Q Consensus       276 ~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~  355 (406)
                      ..+...  +.+...|.++.+++.+ .++..+.++.++++|+.+.+.|.+. |+++. |++|+|+|+++++  .++.++++
T Consensus       238 ~~~~~~--~~~~~~~~~~~~~l~~-~~~~~~~~~~~~~~r~~l~~~l~~~-g~~~~-p~~~~fl~~~~~~--~d~~~~~~  310 (360)
T 3hdo_A          238 KIRDHY--NLDRLAQAACVAALRD-QAYLSECCRRIRETREWFTTELRSI-GYDVI-PSQGNYLFATPPD--RDGKRVYD  310 (360)
T ss_dssp             HHSCSC--CSCHHHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHHHHHHT-TCEEC-CCSSSEEEEECTT--CCHHHHHH
T ss_pred             HHCCCC--CCCCCCCCCCCCCCCC-HHHHHHHHHHHHHHHHHHHHHHHHC-CCEEC-CCCCEEEEEECCC--CCHHHHHH
T ss_conf             302232--0000122333333442-3567888879999989988888856-97589-8988289898999--98999999


Q ss_pred             HHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             99986891896161026799985899850997999999999999999
Q T0591           356 ILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       356 ~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~  402 (406)
                      .|+ ++||.|+|++.|+  .++|+|+|+++ +++++..+++|+++.+
T Consensus       311 ~L~-~~gI~v~~~~~~~--~~~~lRis~~~-~ee~~~l~~aL~~i~e  353 (360)
T 3hdo_A          311 GLY-ARKVLVRHFSDPL--LAHGMRISIGT-REEMEQTLAALKEIGE  353 (360)
T ss_dssp             HHH-HTTEECBCCCSTT--TTTSEEEECCC-HHHHHHHHHHHHHHHC
T ss_pred             HHH-HCCCEEECCCCCC--CCCEEEEEECC-HHHHHHHHHHHHHHHC
T ss_conf             999-7892897088888--89989998389-9999999999999978


No 58 
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A*
Probab=100.00  E-value=0  Score=378.54  Aligned_cols=337  Identities=16%  Similarity=0.162  Sum_probs=251.7

Q ss_pred             HHHHHHHH-HCCCCCCEEECCCCCCCCCCCHHHH-HHHHHHHHCCCC--CCC-CCCCCC-----HHHHHHHHHHHHHHCC
Q ss_conf             89999963-0378983341567867887888999-999999980878--888-788889-----8899999999998648
Q T0591            26 GLEALIRG-APIEGRPVDFSHGDVDAHEPTPGAF-DLFSAGVQSGGV--QAY-TEYRGD-----LGIRDLLAPRLAAFTG   95 (406)
Q Consensus        26 ~~~~~~~~-~~~~~~~i~ls~G~pd~~~p~~~~~-~~~~~~~~~~~~--~~Y-~~~~G~-----~~Lr~aia~~~~~~~g   95 (406)
                      +.+.+.+. .+.....|||+.|+|++.+  |... ++..+++...+.  .+| ++..|.     ++||++|++++....+
T Consensus         9 k~~~~~~k~~~~~d~vi~l~~G~P~~~~--p~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~el~~~i~~~~~~~~~   86 (391)
T 3bwn_A            9 KPEKISNKNIPMSDFVVNLDHGDPTAYE--EYWRKMGDRCTVTIRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVVGN   86 (391)
T ss_dssp             ---------CCTTTSCEECSSCCCGGGH--HHHHHTGGGSCEEECTTTTCSSCSCTTSSSTTSCHHHHHHHHHHHHHHCS
T ss_pred             CHHHHHCCCCCCCCCEEECCCCCCCCCC--CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             6898834789999870789997999998--57899999999736365665657898875544679999999999987469


Q ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHH----HHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHH
Q ss_conf             8678867078824872789999999972001010----131055138999998299699986044666776667788999
Q T0591            96 APVDARDGLIITPGTQGALFLAVAATVARGDKVA----IVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGL  171 (406)
Q Consensus        96 ~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl----~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l  171 (406)
                      ..+++ ++|++|+|++++|+++++++++|||.|+    ++.|+|+.|.......+.+......            |.   
T Consensus        87 ~~~~~-~~I~vt~Ga~~~i~~~~~~l~~~gd~v~~~~~~~~p~y~~~~~~~~~~~~~~~~~~~------------d~---  150 (391)
T 3bwn_A           87 AATED-RYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEG------------DA---  150 (391)
T ss_dssp             BCCSS-SEEEEEEHHHHHHHHHHHHHHHTSSSSSEEEEECSSCCTHHHHHHHTTCBTTEEEEE------------ES---
T ss_pred             CCCCC-CEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCCC------------CH---
T ss_conf             88996-979989888999999999985389974410452654088777677514476757382------------88---


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECC
Q ss_conf             99850254034215666432334437899999999863787578417502355688876522332102678689985040
Q T0591           172 EEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPS  251 (406)
Q Consensus       172 ~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~S  251 (406)
                      ++..++++|++++||||||||.++     ++|+++|++++++||+||+|.++.|....         ...+++|+++|||
T Consensus       151 ~~~~~~~~k~i~l~~P~NPTG~~~-----~~i~~~a~~~~~~vi~De~y~~~~~~~~~---------~~~~~~I~i~S~S  216 (391)
T 3bwn_A          151 WGFDKKGPYIELVTSPNNPDGTIR-----ETVVNRPDDDEAKVIHDFAYYWPHYTPIT---------RRQDHDIMLFTFS  216 (391)
T ss_dssp             TTCCCCSCEEEEEESSCTTTCCCC-----CCCC-----CCCEEEEECTTCSTTTSCCC---------CCBCCSEEEEEHH
T ss_pred             HHHCCCCCEEEEECCCCCCCCHHH-----HHHHHHHHHCCCEEEECCCEECCCHHHCC---------CCCCCEEEEECCC
T ss_conf             961778976999889989986589-----99999867419679955824223010023---------4668889994583


Q ss_pred             HHCCCCCCCCHHHHH-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH----------CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             010463112114332-58999999987520367612457999999985----------6525899999999999999999
Q T0591           252 KTESLSGYRLGVAFG-SRAIIARMEKLQAIVSLRAAGYSQAVLRGWFD----------EAPGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       252 K~~~~~GlRiG~~~~-~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~----------~~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      |.|++||||+||+++ ++.+.+.+.........+++.+.|.++...+.          ..+.+++..+..++++++.+.+
T Consensus       217 K~~~l~GlRiG~~v~~~~~l~~~~~~~~~~~~~~~s~~~q~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~r~~~l~~  296 (391)
T 3bwn_A          217 KITGHAGSRIGWALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLRE  296 (391)
T ss_dssp             HHHSCGGGCEEEEEECCHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHHHTTCCCTTTSHHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCEEEEEECHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             01017440579999782999999998432056775899999999998868999876665799999999999999999999


Q ss_pred             HHHHCCCCEEEC--CC-----------CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCH
Q ss_conf             997279945535--88-----------73078776688788989999999986891896161026799985899850997
Q T0591           321 VLRGCEGVFART--PQ-----------AGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDH  387 (406)
Q Consensus       321 ~L~~~~g~~~~~--p~-----------gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~  387 (406)
                      .|.+.+++.+..  |+           .+.|.|++..+    +.+ +.+++.++||+++||+.||. +++|+||||+.++
T Consensus       297 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~----~~~-~~~~L~~~gV~v~pG~~Fg~-~~~~vRis~~~~~  370 (391)
T 3bwn_A          297 VVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKE----ETD-LVSELRRHKVMSRAGERCGS-DKKHVRVSMLSRE  370 (391)
T ss_dssp             HHHTCSSEECCCCCCEEETTTTEEECCCCSEEEEEESS----SCC-HHHHHHHTTEECEEGGGGTC-CTTEEEEESCSCH
T ss_pred             HHHHCCCCEECCCCCCEEEEEEEECCCCCCHHCCCCCC----HHH-HHHHHHHCCEEEEECCCCCC-CCCEEEEEECCCH
T ss_conf             99876993113558860589875248864200047898----999-99999859999983400399-9698999970889


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999999
Q T0591           388 EAAVAAARRIVTL  400 (406)
Q Consensus       388 e~l~~al~rl~~~  400 (406)
                      |+++++++||+++
T Consensus       371 e~l~~~l~rL~~l  383 (391)
T 3bwn_A          371 DVFNVFLERLANM  383 (391)
T ss_dssp             HHHHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999997


No 59 
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A*
Probab=100.00  E-value=0  Score=360.38  Aligned_cols=311  Identities=19%  Similarity=0.251  Sum_probs=251.2

Q ss_pred             CEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHH
Q ss_conf             33415678678878889999999999808788887888898899999999998648867886707882487278999999
Q T0591            40 PVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVA  119 (406)
Q Consensus        40 ~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~  119 (406)
                      .|.|+.++..+.. ++..        .....+.||+.. ..+||+++|+++    |+  +| ++|++|+|++++|.++++
T Consensus        31 ~i~L~~nenp~~~-~~~~--------~~~~~~~YPd~~-~~~L~~~lA~~~----gv--~p-e~I~~t~G~~eai~~~~~   93 (356)
T 1fg7_A           31 DVWLNANEYPTAV-EFQL--------TQQTLNRYPECQ-PKAVIENYAQYA----GV--KP-EQVLVSRGADEGIELLIR   93 (356)
T ss_dssp             SEECSSCCCSSCC-CCCC--------CCCCTTSCCCSS-CHHHHHHHHHHH----TS--CG-GGEEEESHHHHHHHHHHH
T ss_pred             CEEEECCCCCCCC-CHHH--------HHHHHHCCCCCC-HHHHHHHHHHHH----CC--CH-HHEEEECCHHHHHHHHHH
T ss_conf             6783288978988-9899--------999984398998-999999999887----84--87-889995889999999999


Q ss_pred             HHHHCC-HHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHH
Q ss_conf             997200-1010131055138999998299699986044666776667788999998502540342156664323344378
Q T0591           120 ATVARG-DKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAE  198 (406)
Q Consensus       120 ~l~~pG-d~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~  198 (406)
                      ++++|| |.|+++.|+|..|...++.+|.+++.++++      ++|.+|++++++.+ +++|++++||||||||.+++.+
T Consensus        94 ~~~~pG~d~Vl~~~P~y~~y~~~~~~~G~~~~~v~~~------~~~~~d~~~l~~~~-~~~~~v~l~~P~NPtG~~~~~~  166 (356)
T 1fg7_A           94 AFCEPGKDAILYCPPTYGMYSVSAETIGVECRTVPTL------DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQ  166 (356)
T ss_dssp             HHCCTTTCEEEECSSSCTHHHHHHHHHTCEEEECCCC------TTSCCCHHHHHTSC-TTEEEEEEESSCTTTCCCCCHH
T ss_pred             HHHCCCCCEEEECCCCCHHHHHHHHHCCCEEEEECCC------CCCCCCHHHHHHCC-CCCEEEEEECCCCCCCCCCCHH
T ss_conf             9856898399978986078999999839889993138------88775999998527-8975999808989888878878


Q ss_pred             HHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999863787578417502355688876522332102678689985040010463112114332589999999875
Q T0591           199 EIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQ  278 (406)
Q Consensus       199 ~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~  278 (406)
                      ++++|+++++++ .++|+||+|.+|.++......+     ...+++++++||||.|+++|+|+||+++++++++.+.+++
T Consensus       167 ~l~~i~~~~~~~-~~~ivDeay~~f~~~~~~~~~~-----~~~~~~i~~~s~SK~~gl~GlR~G~~~~~~~~i~~l~~~~  240 (356)
T 1fg7_A          167 DFRTLLELTRGK-AIVVADEAYIEFCPQASLAGWL-----AEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVI  240 (356)
T ss_dssp             HHHHHHHHHTTT-CEEEEECTTGGGSGGGCSGGGT-----TTCTTEEEEEESSSTTCCGGGCCEEEEECHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHC-CCEEEEHHHHHHCCCCCCCCCC-----CCCCCCEEEEECCCCCCCCCCCEEEEECCHHHHHHHHHHH
T ss_conf             999999997527-9522110487754200134400-----0478715983052145588544043347999999999972


Q ss_pred             HHCCCCHHHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHH
Q ss_conf             2036761245799999998565-258999999999999999999972799455358873078776688788989999999
Q T0591           279 AIVSLRAAGYSQAVLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKIL  357 (406)
Q Consensus       279 ~~~~~~~~~~~q~a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~L  357 (406)
                      ..  ++.+++.|.++..++.+. ..++.+.+.+++++|+.+.+.|++++++....|++|+|+|++++    ++.++++.|
T Consensus       241 ~~--~~v~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~r~~l~~~L~~~~~~~~~~ps~~~fv~~~~~----~~~~~~~~L  314 (356)
T 1fg7_A          241 AP--YPLSTPVADIAAQALSPQGIVAMRERVAQIIAEREYLIAALKEIPCVEQVFDSETNYILARFK----ASSAVFKSL  314 (356)
T ss_dssp             CS--SCSCHHHHHHHHHHTSHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTEEEECCCSSSEEEEEET----THHHHHHHH
T ss_pred             CC--CCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCEEEEEECC----CHHHHHHHH
T ss_conf             87--778889999999998705879999999999999999999998389951347998749999679----999999999


Q ss_pred             HHHCCEEEEECCCCCCCCCCEEEEEECCCHH
Q ss_conf             9868918961610267999858998509979
Q T0591           358 RLQAGVVVTPGTEFSPHTADSVRLNFSQDHE  388 (406)
Q Consensus       358 l~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e  388 (406)
                      + ++||+|+|++.|. ..++|+|+|+++++|
T Consensus       315 ~-~~gi~vr~~~~~~-~~~~~lRis~gt~ee  343 (356)
T 1fg7_A          315 W-DQGIILRDQNKQP-SLSGCLRITVGTREE  343 (356)
T ss_dssp             H-HTTEECEECTTST-TCTTEEEEECCCHHH
T ss_pred             H-HCCCEEECCCCCC-CCCCEEEEEECCHHH
T ss_conf             9-6894996277778-999989997089999


No 60 
>3meb_A Aspartate aminotransferase; pyridoxal phosphate, structural genomics, seattle structural genomics center for infectious disease; HET: PLP; 1.90A {Giardia lamblia atcc 50803}
Probab=100.00  E-value=0  Score=359.18  Aligned_cols=364  Identities=10%  Similarity=0.045  Sum_probs=270.5

Q ss_pred             HHHHHHCCCCCCEEECCCC---CCCCCCCHHHHHHHHHHHHC---CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             9996303789833415678---67887888999999999980---87888878888988999999999986488678867
Q T0591            29 ALIRGAPIEGRPVDFSHGD---VDAHEPTPGAFDLFSAGVQS---GGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARD  102 (406)
Q Consensus        29 ~~~~~~~~~~~~i~ls~G~---pd~~~p~~~~~~~~~~~~~~---~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~  102 (406)
                      +..+..+ .+..|||++|.   .+..+|.+..++.+.+.+.+   ...++|+|..|.++||+++++++...++.....+.
T Consensus        41 ~~~~~d~-~~~kinL~iG~y~d~~G~~~v~~~Vk~A~~~l~~~~~~~~~~Y~p~~G~~~lreaia~~~~~~~~~~~~~~~  119 (448)
T 3meb_A           41 VLYNADT-NPKKVNLGVGAYRDESGKPWILPAVKEAEAIISSDLSKYNKEYPPVAGFPLFLEAAQFLMFGKDSKAAQEGR  119 (448)
T ss_dssp             HHHHHCC-CTTCEEESSCCCCCTTSCCCCCHHHHHHHHHHHHCTTTTCCSCCCTTCCHHHHHHHHHHHHCTTCHHHHTTC
T ss_pred             HHHHCCC-CCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             9984599-978678215654388999788779999999997265667887798656799999999998414686433451


Q ss_pred             -EEEEECCCCHHHHHHHH--HHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEE-EECCCCCCCCCCCCCHHHHHHHH---
Q ss_conf             -07882487278999999--997200101013105513899999829969998-60446667766677889999985---
Q T0591           103 -GLIITPGTQGALFLAVA--ATVARGDKVAIVQPDYFANRKLVEFFEGEMVPV-QLDYVSADETRAGLDLTGLEEAF---  175 (406)
Q Consensus       103 -~I~it~G~~~~l~~~~~--~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v-~~~~~~~~~~~~~~d~~~l~~~~---  175 (406)
                       .++.|.|++.++.+++.  ...+|||+|++++|+|++|...+...|++...+ ........+..+.+|++.+.+.+   
T Consensus       120 ~~~~~~~g~~~~~~~~~~~~~~~~~g~~v~ip~P~w~~y~~~~~~~g~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~  199 (448)
T 3meb_A          120 IASCQSLSGTGSLHIGFEFLHLWMPKAEFYMPSTTWPNHYGIYDKVFNKLKVPYKEYTYLRKDGELEIDFSNTKKDIQSA  199 (448)
T ss_dssp             EEEEEESHHHHHHHHHHHHHHHHCTTCCEEEESSCCTHHHHHHHHHHCTTTSCCEEECCBCTTSCSSBCHHHHHHHHHHS
T ss_pred             EEEEECCHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHC
T ss_conf             47752520788999999875203899989980898640799999855763025630356565444464889999988627


Q ss_pred             CCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHH-HCCCCCCEEEEEECCHHC
Q ss_conf             0254034215666432334437899999999863787578417502355688876522332-102678689985040010
Q T0591           176 KAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAE-AAVDAENVVTIMGPSKTE  254 (406)
Q Consensus       176 ~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~-~~~~~~~~i~~~S~SK~~  254 (406)
                      .++++++++++||||||.++|.+++++|+++|+++++++|+||+|.+|.|++......... .....++++++.|+||.|
T Consensus       200 ~~~~~vil~~~p~NPTG~~~s~e~~~~i~~~~~~~~~~ii~De~Y~~~~~~~~~~d~~~~~~~~~~~~~~iv~~s~SK~~  279 (448)
T 3meb_A          200 PEKSIFLFHACAHNPSGIDFTEAQWKELLPIMKEKKHIAFFDSAYQGFATGSFEADAFAVRMFVDAGVEVLVAQSFSKNF  279 (448)
T ss_dssp             CTTCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTTTSSSCHHHHTHHHHHHHHTTCCEEEEEECTTTS
T ss_pred             CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEECHHHHHHCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             88878999689999898328999999999998655979996543454305996767165555542265200014655555


Q ss_pred             CCCCCCCHHHHHHHH---------------HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHH
Q ss_conf             463112114332589---------------9999998752036761245799999998565------2589999999999
Q T0591           255 SLSGYRLGVAFGSRA---------------IIARMEKLQAIVSLRAAGYSQAVLRGWFDEA------PGWMEDRIARHQA  313 (406)
Q Consensus       255 ~~~GlRiG~~~~~~~---------------~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~------~~~~~~~~~~~~~  313 (406)
                      +++|||+||++++.+               +...+........++++...|.++..++.+.      .+++++++.++++
T Consensus       280 ~l~G~RvG~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~r~~~s~~p~~~q~~~~~~l~d~~~~~~w~~el~~~~~~l~~  359 (448)
T 3meb_A          280 GLYGERIGCLHVVHAGVEGSVEKNKALSAAMVSGMTLQIRKTWSMSAIHGAYIVQVIVHDKRLLQMFYDNVKEMSARIHR  359 (448)
T ss_dssp             CCGGGCCEEEEEECCCCSSSHHHHHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHTSHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             66567248999541788998866778877788899999877747798499999999704817789999999999999999


Q ss_pred             HHHHHHHHHHHCCCCEEECCCCCEEEEEECCC----CCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC-CCHH
Q ss_conf             99999999972799455358873078776688----788989999999986891896161026799985899850-9979
Q T0591           314 IRDELLHVLRGCEGVFARTPQAGSYLFPRLPK----LAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS-QDHE  388 (406)
Q Consensus       314 ~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~----~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~-~~~e  388 (406)
                      +|+.+.+.|.+. |+.+..|+|+|+.|.+..+    ++. +.+++++|++|+||.++||+         .||||+ .+++
T Consensus       360 rR~~l~~~L~~~-g~~~~~~~g~f~~i~~~~GmF~~~~l-s~e~~~~L~~e~~V~~vpg~---------gRis~a~l~~~  428 (448)
T 3meb_A          360 MRSLLHASLAKR-KTPGPGSKGTWDHILTAIGMFTFTGL-TPEHVDYLKEKWSIYLVKAG---------GRMSMCGLTES  428 (448)
T ss_dssp             HHHHHHHHHHHT-TCCCSTTTCCCTHHHHCCSSEEECCC-CHHHHHHHHHHHCEEECSGG---------GEEEGGGCCTT
T ss_pred             HHHHHHHHHHHC-CCCCCCCCCCEEEEECCCCCCCCCCC-CHHHHHHHHHCCCEEEECCC---------EEEEEECCCHH
T ss_conf             999999999974-99777999763786057775314699-99999999983899993698---------59998118888


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999985
Q T0591           389 AAVAAARRIVTLVERY  404 (406)
Q Consensus       389 ~l~~al~rl~~~~~~~  404 (406)
                      +++...++|.++++|+
T Consensus       429 ~i~~la~aI~~~v~~l  444 (448)
T 3meb_A          429 NCDYVAEAIHDAVTKL  444 (448)
T ss_dssp             THHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHC
T ss_conf             8999999999999837


No 61 
>3ly1_A Putative histidinol-phosphate aminotransferase; structural genomics, joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica}
Probab=100.00  E-value=0  Score=351.96  Aligned_cols=336  Identities=18%  Similarity=0.267  Sum_probs=267.0

Q ss_pred             CCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             78983341567867887888999999999980878888788889889999999999864886788670788248727899
Q T0591            36 IEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        36 ~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      ....+|+|+.+++.+ .|+|.+.+++.+++.+  .++|++ .|..+||++||+++    |+  ++ ++|++|+|++++|.
T Consensus        14 ~~~~~i~l~~nen~~-g~~p~v~~a~~~~~~~--~~~Yp~-~~~~~Lr~aiA~~~----~v--~~-~~I~it~Ga~~~i~   82 (354)
T 3ly1_A           14 STDNPIRINFNENPL-GMSPKAQAAARDAVVK--ANRYAK-NEILMLGNKLAAHH----QV--EA-PSILLTAGSSEGIR   82 (354)
T ss_dssp             CSSSCEECSSCCCSS-CCCHHHHHHHHHTGGG--TTSCCH-HHHHHHHHHHHHHT----TS--CG-GGEEEESHHHHHHH
T ss_pred             CCCCCEEEECCCCCC-CCCHHHHHHHHHHHHH--HCCCCC-CCHHHHHHHHHHHH----CC--CH-HHEEEECCHHHHHH
T ss_conf             999807977899999-9999999999986677--337999-76899999999997----85--86-88999078999999


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCC--CCEEEECCCCCCCCCC
Q ss_conf             99999972001010131055138999998299699986044666776667788999998502--5403421566643233
Q T0591           116 LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKA--GARVFLFSNPNNPAGV  193 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~--~~k~i~l~~P~NPTG~  193 (406)
                      .++.++++|||+|+++.|+|+.|...++..|.+++.||++      +++++|++.++..+..  ++|++++||||||||.
T Consensus        83 ~~~~al~~~Gd~Vi~~~p~y~~~~~~~~~~g~~~~~v~~~------~~~~~~~~~~~~~~~~~~~~~~v~l~~P~nptG~  156 (354)
T 3ly1_A           83 AAIEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKML------DNWAFDIEGLKAAVAAYSGPSIVYLVNPNNPTGT  156 (354)
T ss_dssp             HHHHHHCCTTCEEEEESSSCTHHHHHHHHTTCEEEEECCC------TTSCCCHHHHHHHHHTCSSCEEEEEESSCTTTCC
T ss_pred             HHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCEEEEEECC------CCCCCCHHHHHHHCCCCCCCEEEEECCCCCCCCC
T ss_conf             9999972899889842444630467898548516997323------4567320123321135889879998899899987


Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHH
Q ss_conf             44378999999998637875784175023556888765223321026786899850400104631121143325899999
Q T0591           194 VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIAR  273 (406)
Q Consensus       194 ~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~  273 (406)
                      +++.++++ ++..|++++.+||+||+|.++.++........ ......+++++++|+||.|+++|+|+||+++++++++.
T Consensus       157 ~~~~e~~~-~~~~~~~~~~~ii~Dd~~~~~~~~~~~~~~~~-~~~~~~~~~i~~~s~sK~~~l~G~R~G~~i~~~~~i~~  234 (354)
T 3ly1_A          157 ITPADVIE-PWIASKPANTMFIVDEAYAEFVNDPRFRSISP-MITQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIAL  234 (354)
T ss_dssp             CCCHHHHH-HHHHTCCTTEEEEEECTTGGGCCCTTCCCSHH-HHHTTCSSEEEEEESSSTTCCGGGCCEEEECCHHHHHH
T ss_pred             CCCCCHHH-HHHHHHHCCCEEEECHHHHHHHCCCCCCCCHH-HHHCCCCCCEEEECCCCCCCCCCCCEEEEEECHHHHHH
T ss_conf             66521135-57887631855663021566643777787266-53101356048841454225787734799849999999


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHH
Q ss_conf             99875203676124579999999856525899999999999999999997279945535887307877668878898999
Q T0591           274 MEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEF  353 (406)
Q Consensus       274 l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~  353 (406)
                      +.+++.....+.+.  +..+...+. ...+..+.++.++.+|+.+.+.|.++ |+.+. |.+|+|+|++++   .+..++
T Consensus       235 l~~~~~~~~~~~~a--~~~a~a~~~-~~~~~~~~~~~~~~~r~~~~~~l~~~-g~~~~-p~~g~f~~~~~~---~~~~~~  306 (354)
T 3ly1_A          235 MGRYVAGEKINFSG--VDAALASMN-DSAFITYSKKSNDVSRQILLKALEDL-KLPYL-PSEGNFVFHQLV---VPLKDY  306 (354)
T ss_dssp             HGGGTTCSCCCHHH--HHHHHHHTT-CHHHHHHHHHHHHHHHHHHHHHHHHH-TCCBC-CCCSSEEEEECS---SCHHHH
T ss_pred             HHHHCCCCCCCHHH--HHHHHHHHC-CHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCC-CCCCCEEEEECC---CCHHHH
T ss_conf             99861789987999--999999821-51899998999999999999999988-99485-898618999689---999999


Q ss_pred             HHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999868918961610267999858998509979999999999999998
Q T0591           354 VKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       354 ~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~  403 (406)
                      ...| .++||++.  ..|+ .+++|+|+||++ ++++++.+++|+++++|
T Consensus       307 ~~~L-~~~gI~v~--~~~~-~~~~~lRis~~t-~ee~~~l~~~l~~~~k~  351 (354)
T 3ly1_A          307 QTHM-ADAGVLIG--RAFP-PADNWCRISLGT-PQEMQWVADTMREFRKK  351 (354)
T ss_dssp             HHHH-HHTTEECC--CCCT-TCTTEEEEECCC-HHHHHHHHHHHHHHHHT
T ss_pred             HHHH-HHCCEEEC--CCCC-CCCCEEEEEECC-HHHHHHHHHHHHHHHHC
T ss_conf             9999-84998987--7878-998989999389-99999999999999851


No 62 
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A*
Probab=100.00  E-value=0  Score=352.93  Aligned_cols=318  Identities=19%  Similarity=0.231  Sum_probs=249.0

Q ss_pred             CCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             89833415678678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            37 EGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      ..+.|+|++|+++++ +++.+++++.+.+.......| |..|.++||++|++|+++. +  ++ +|+|++|+|++++|++
T Consensus        18 ~~d~~~L~~nenp~~-~p~~~~~~~~~~~~~~~~~~y-p~~g~~~lreaia~~~~~~-~--~~-~d~I~it~Ga~~~l~~   91 (335)
T 1uu1_A           18 KRDKTYLALNENPFP-FPEDLVDEVFRRLNSDALRIY-YDSPDEELIEKILSYLDTD-F--LS-KNNVSVGNGADEIIYV   91 (335)
T ss_dssp             CCCSEEESSCCCSSC-CCHHHHHHHHHTCCGGGGGSC-CCSSCHHHHHHHHHHHTCS-S--CC-GGGEEEESSHHHHHHH
T ss_pred             CCCCEEEECCCCCCC-CCHHHHHHHHHHHHCCHHCCC-CCCCCHHHHHHHHHHHCCC-C--CC-HHHEEECCCCHHHHHH
T ss_conf             899308989999898-999999999998501200478-9987199999999974556-7--98-8996734651167777


Q ss_pred             HHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCC
Q ss_conf             99999720010101310551389999982996999860446667766677889999985025403421566643233443
Q T0591           117 AVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYS  196 (406)
Q Consensus       117 ~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s  196 (406)
                      ++    .+||+|+++.|+|+.|...++..|.+++.+|++...    . ..      +....+++++++||||||||.+++
T Consensus        92 l~----~~~d~vl~~~P~y~~y~~~~~~~g~~~~~ip~~~d~----~-~~------~~~~~~~~~~~l~nP~NPtG~~~~  156 (335)
T 1uu1_A           92 MM----LMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDL----R-IP------EVNVGEGDVVFIPNPNNPTGHVFE  156 (335)
T ss_dssp             HH----HHSSEEEECSSSCHHHHHHHHHHTCEEEECCCCTTS----C-CC------CCCCCTTEEEEEESSCTTTCCCCC
T ss_pred             HH----HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----C-CC------CCCCCCCEEEEECCCCCCCCEEEC
T ss_conf             76----403432111222321122200268742224333222----2-21------124665448864155665322205


Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             78999999998637875784175023556888765223321026786899850400104631121143325899999998
Q T0591           197 AEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEK  276 (406)
Q Consensus       197 ~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~  276 (406)
                      .+++.+    +.++++++|+||+|.++.+....    ..  ....+++|+++||||+|++||+|+||+++|+++++.+..
T Consensus       157 ~~~l~~----~~~~~~~ii~De~y~~~~~~~~~----~~--~~~~~~~i~~~S~SK~~~~~GlR~G~~i~~~~~~~~l~~  226 (335)
T 1uu1_A          157 REEIER----ILKTGAFVALDEAYYEFHGESYV----DF--LKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNR  226 (335)
T ss_dssp             HHHHHH----HHHTTCEEEEECTTHHHHCCCCG----GG--GGTCSSEEEEEESTTTTTCGGGCCEEEEECHHHHHHHHH
T ss_pred             HHHHHC----CCCCEEEEECCCCCCHHCCCCCC----CC--CCCCCEEEEEECCCHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             788511----34530588504444100112211----23--345715999925712200222201110254056777887


Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHH
Q ss_conf             75203676124579999999856525899999999999999999997279945535887307877668878898999999
Q T0591           277 LQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKI  356 (406)
Q Consensus       277 ~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~  356 (406)
                      ++.  ..+.+.++|.++..++++ ..+.++.++.++++|+.+.+.|+++ |+++..|+|+ |+|++++.  .++.++++.
T Consensus       227 ~~~--~~~~s~~~~~~~~~~l~~-~~~~~~~~~~~~~~r~~l~~~L~~~-g~~~~~~~g~-F~~~~~~~--~~~~~~~~~  299 (335)
T 1uu1_A          227 VRL--PFNVSYVSQMFAKVALDH-REIFEERTKFIVEERERMKSALREM-GYRITDSRGN-FVFVFMEK--EEKERLLEH  299 (335)
T ss_dssp             HSC--TTCSCHHHHHHHHHHHHT-HHHHHHHHHHHHHHHHHHHHHHHHH-TCCBCCCCSS-EEEEECCT--HHHHHHHHH
T ss_pred             HHH--HCCCHHHHHHHHHHCCCC-CCCHHHHHHHHHHHHHHHHHHHHHC-CCEECCCCCE-EEEEECCC--CCHHHHHHH
T ss_conf             764--103206777777631222-2211468999999898889999988-9878789862-89998999--879999999


Q ss_pred             HHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             9986891896161026799985899850997999999999999999856
Q T0591           357 LRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       357 Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      |+ ++||.|.++       ++|+|+|+++++| .    +|+.+.++++|
T Consensus       300 l~-~~gI~vr~~-------~~~iRis~g~~~e-~----~~~~~~lk~fk  335 (335)
T 1uu1_A          300 LR-TKNVAVRSF-------REGVRITIGKREE-N----DMILRELEVFK  335 (335)
T ss_dssp             HH-HHTEEEEEE-------TTEEEEECCCHHH-H----HHHHHHHHCC-
T ss_pred             HH-HCCCEECCC-------CCEEEEEECCHHH-H----HHHHHHHHHHC
T ss_conf             99-778889879-------9979998089999-9----99999999859


No 63 
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A*
Probab=100.00  E-value=0  Score=359.17  Aligned_cols=328  Identities=15%  Similarity=0.115  Sum_probs=249.7

Q ss_pred             CEEECCCCCCCCCCCHHHHH-HHHHHHHCCC--CCCCCCC----CCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCH
Q ss_conf             33415678678878889999-9999998087--8888788----889889999999999864886788670788248727
Q T0591            40 PVDFSHGDVDAHEPTPGAFD-LFSAGVQSGG--VQAYTEY----RGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQG  112 (406)
Q Consensus        40 ~i~ls~G~pd~~~p~~~~~~-~~~~~~~~~~--~~~Y~~~----~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~  112 (406)
                      .+|+..|+|.+..  |-+.+ ....++.-.+  ..+|.-.    --.++|+++|++..... |-.+..+.+|++|+|++|
T Consensus        58 ~~~~~~gdp~~~~--~~~~~~~~~~~~~~~~~~~~sy~~~~~~~~~~~~L~~~I~~lh~~~-gna~~d~~~IvvG~Gstq  134 (427)
T 2hox_A           58 SADVASGDGLFLE--EYWKQHKEASAVLVSPWHRMSYFFNPVSNFISFELEKTIKELHEVV-GNAAAKDRYIVFGVGVTQ  134 (427)
T ss_dssp             CEECCSCCCGGGH--HHHTTSHHHHCEEECTTTTCSSSCSSCCTTCCHHHHHHHHHHHHHH-TCBCCTTCEEEEESHHHH
T ss_pred             CCCCCCCCCCCCC--HHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCCCCCCCEEEECCCHHH
T ss_conf             1247888987664--7888473531267304455541037876657689999999998510-687888998998978999


Q ss_pred             HHHHHHHHH--------HHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             899999999--------720010101310551389999982996999860446667766677889999985025403421
Q T0591           113 ALFLAVAAT--------VARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLF  184 (406)
Q Consensus       113 ~l~~~~~~l--------~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l  184 (406)
                      +|++++.+|        ++|||+|+++.|+|+.|.....+.+.+..            +|.+|.+.++++.++++++++|
T Consensus       135 li~a~~~AL~~~~~~~~~~pgd~Vv~~~P~Y~~Y~~~~~~~~~~~~------------~~~~d~~~~~~~~~~~~~ii~l  202 (427)
T 2hox_A          135 LIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGY------------VWAGNAANYVNVSNPEQYIEMV  202 (427)
T ss_dssp             HHHHHHHHHSCCTTTCTTSCCEEEEECSSCCHHHHHHHHHSCBTTE------------EEEEEGGGGTTCSCGGGEEEEE
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHCCCCCC------------CCCCCHHHHHHCCCCCCEEEEE
T ss_conf             9999999845412345579999899927871669999997499764------------4269999998517899659999


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHH
Q ss_conf             56664323344378999999998637875784175023556888765223321026786899850400104631121143
Q T0591           185 SNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVA  264 (406)
Q Consensus       185 ~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~  264 (406)
                      ||||||||.+..          +..++..+|+||+|.+..     ++++..    ..+++|+++||||.|+++|||+||+
T Consensus       203 ~sPnNPTG~l~~----------~v~~~~~~I~DeaY~~~~-----~~~i~~----~~~~~Ivl~S~SK~fglaGlRlGwa  263 (427)
T 2hox_A          203 TSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPH-----YTPIKY----KADEDILLFTMSKFTGHSGSRFGWA  263 (427)
T ss_dssp             ESSCTTTCCCCC----------CSSTTCEEEEECTTCSTT-----TSCCCS----CBCCSEEEEEHHHHTSCGGGCCEEE
T ss_pred             ECCCCCHHHHHH----------HHHHCCEEEEECCCCCCC-----CCCCCC----CCCCEEEEEECHHHCCCCHHHEEEE
T ss_conf             799894277578----------787387899553231776-----576310----3688699975778613651332457


Q ss_pred             -HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC-----------CHHHHHHHHHHHHHHHHHHHHHHHCCCCEE--
Q ss_conf             -325899999998752036761245799999998565-----------258999999999999999999972799455--
Q T0591           265 -FGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA-----------PGWMEDRIARHQAIRDELLHVLRGCEGVFA--  330 (406)
Q Consensus       265 -~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~-----------~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~--  330 (406)
                       +.++++++++.+++....+++|.+.|.++..+|++.           ..+.+..++.++++++.+.+.+.+...+.+  
T Consensus       264 i~~~~~v~~~~~~~~~~~~~~vs~~~Q~aa~~aL~~~~~~~~~~~~~~~~~~~~~~~~l~~r~~~l~~~l~~~~~f~l~~  343 (427)
T 2hox_A          264 LIKDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTQKGTMRDLNTFGFKKLRERWVNITALLDQSDRFSYQE  343 (427)
T ss_dssp             EECCHHHHHHHHHHHHHHTSSCCHHHHHHHHHHHHHHHHHHHHHTTSTTSHHHHHHHHHHHHHHHHHHHHTTSSSEECCC
T ss_pred             EECCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECC
T ss_conf             84889999999986122767767999999999985438999999999999999999999999999999986458611011


Q ss_pred             ------------ECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHH
Q ss_conf             ------------35887307877668878898999999998689189616102679998589985099799999999999
Q T0591           331 ------------RTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIV  398 (406)
Q Consensus       331 ------------~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~  398 (406)
                                  ..+.++.|+|++++.   ++.+++.++++++||+++||+.||. +++|+||||+.++|+++++++||+
T Consensus       344 ~p~~~~~~f~~~~~~~~~~f~wlk~~~---~~~~~~~~lL~e~gI~v~pG~~FG~-~~~~vRisl~~~~e~l~~al~rL~  419 (427)
T 2hox_A          344 LPQSEYCNYFRRMRPPSPSYAWVKCEW---EEDKDCYQTFQNGRINTQNGVGFEA-SSRYVRLSLIKTQDDFDQLMYYLK  419 (427)
T ss_dssp             CCSCEEETTTTEEECCCCSEEEEEECS---GGGCSHHHHHHHTTEECEEGGGGTS-CTTEEEEECSSCHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEECCCCCCCCEEEEECCC---CHHHHHHHHHHHCCEEEEECHHCCC-CCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             687301144201358875435543699---8699999999869999995210189-969799995698999999999999


Q ss_pred             HHHHHHC
Q ss_conf             9999856
Q T0591           399 TLVERYR  405 (406)
Q Consensus       399 ~~~~~~r  405 (406)
                      +++++.|
T Consensus       420 ~~v~~~r  426 (427)
T 2hox_A          420 DMVKAKR  426 (427)
T ss_dssp             HHHTCC-
T ss_pred             HHHHHHC
T ss_conf             9999741


No 64 
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A*
Probab=100.00  E-value=2.2e-34  Score=250.50  Aligned_cols=333  Identities=15%  Similarity=0.131  Sum_probs=243.8

Q ss_pred             CCCC-EEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             8983-341567867887888999999999980878888788889889999999999864886788670788248727899
Q T0591            37 EGRP-VDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        37 ~~~~-i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      ...+ +-|+-|   +...+|.+++++    .....++|.|.  ..++++.+.+++++.+|.+   .++|++|+|+++++.
T Consensus         6 ~~~~~~~~~pG---P~~~~~~v~~A~----~~~~~~h~~~~--~~~~~~~~~~~l~~~~~~~---~~~i~~t~g~t~a~~   73 (392)
T 2z9v_A            6 HADPVITLTAG---PVNAYPEVLRGL----GRTVLYDYDPA--FQLLYEKVVDKAQKAMRLS---NKPVILHGEPVLGLE   73 (392)
T ss_dssp             TSCCSEECSSS---CCCCCHHHHHHT----TSCCCCTTSHH--HHHHHHHHHHHHHHHTTCS---SCCEEESSCTHHHHH
T ss_pred             CCCCEEEECCC---CCCCCHHHHHHH----CCCCCCCCCHH--HHHHHHHHHHHHHHHHCCC---CCEEEEECCHHHHHH
T ss_conf             89982671389---989859999983----86024667899--9999999999999985889---987999186999999


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHH--HHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC--CCCEEEECCCCCCCC
Q ss_conf             9999997200101013105513--899999829969998604466677666778899999850--254034215666432
Q T0591           116 LAVAATVARGDKVAIVQPDYFA--NRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK--AGARVFLFSNPNNPA  191 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~--~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~--~~~k~i~l~~P~NPT  191 (406)
                      .++.++++|||+|++++|+|++  +...++..|.+++.++.+      .++.+|+++++++++  +++|++++++|+|||
T Consensus        74 ~~~~~l~~pGD~vlv~~~~~~~~~~~~~~~~~g~~v~~~~~~------~~~~~d~~~l~~~l~~~~~~~~v~~~~~~n~t  147 (392)
T 2z9v_A           74 AAAASLISPDDVVLNLASGVYGKGFGYWAKRYSPHLLEIEVP------YNEAIDPQAVADMLKAHPEITVVSVCHHDTPS  147 (392)
T ss_dssp             HHHHHHCCTTCCEEEEESSHHHHHHHHHHHHHCSCEEEEECC------TTSCCCHHHHHHHHHHCTTCCEEEEESEEGGG
T ss_pred             HHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCEEEECCCC------CCCCCCHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             999985389998999658713799999999809768971577------89977999999988519880574134789988


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHH
Q ss_conf             33443789999999986378757841750235568887652233210267868998504001046311211433258999
Q T0591           192 GVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAII  271 (406)
Q Consensus       192 G~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i  271 (406)
                      |.+++   +++|+++|++||+++++|++|+...++..    ...     ....+++.|.+|.++.| ..+|+++++++.+
T Consensus       148 G~~~~---l~~i~~la~~~g~~~ivD~~~~~~~~~~~----~~~-----~~~d~~~~s~~K~l~~~-~G~g~l~~~~~~~  214 (392)
T 2z9v_A          148 GTINP---IDAIGALVSAHGAYLIVDAVSSFGGMKTH----PED-----CKADIYVTGPNKCLGAP-PGLTMMGVSERAW  214 (392)
T ss_dssp             TEECC---HHHHHHHHHHTTCEEEEECTTTBTTBSCC----GGG-----GTCSEEEECSSSTTCCC-SCCEEEEECHHHH
T ss_pred             CEECC---HHHHHHHHHHCCCCEEECCCCCCCCCCCC----CCC-----CCCEEEEECCCCCCCCC-CCEEEEEECHHHH
T ss_conf             48777---99999997531431220120124676775----335-----69829996264524689-9769999868999


Q ss_pred             HHHHHHHHH--------------------CCCCHHHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             999987520--------------------36761245799999998565-258999999999999999999972799455
Q T0591           272 ARMEKLQAI--------------------VSLRAAGYSQAVLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFA  330 (406)
Q Consensus       272 ~~l~~~~~~--------------------~~~~~~~~~q~a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~  330 (406)
                      +++......                    .....+...|.++..+++.. ...+++..++++++++.+.+.|.++ |+++
T Consensus       215 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~al~~al~~~~~~~~~~~~~~~~~~a~~~~~~l~~~-G~~~  293 (392)
T 2z9v_A          215 AKMKANPLAPRASMLSIVDWENAWSRDKPFPFTPSVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTAM-GLSV  293 (392)
T ss_dssp             HHHHTCTTSCCSSTTCSGGGTTTTSTTSCCSSCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHT-TCCB
T ss_pred             HHHHCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCEE
T ss_conf             875235767640111267775430235666778889999999999999876459999999999999999999856-9886


Q ss_pred             ECCCCCEE----EEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEE---CCCHHHHHHHHHHHHHHHHH
Q ss_conf             35887307----877668878898999999998689189616102679998589985---09979999999999999998
Q T0591           331 RTPQAGSY----LFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNF---SQDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       331 ~~p~gg~~----~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~---~~~~e~l~~al~rl~~~~~~  403 (406)
                      ..|+++++    +|+.+|+ +.+..+|+++|++++||.+.||..+.  .++++||+.   ...++++.+++++|.+.+++
T Consensus       294 ~~~~~~~~~~~v~~~~~p~-g~d~~~~~~~L~~~~gI~v~pG~~~~--~~~~~Ri~~~g~~~~~~~~~~~l~~l~~~L~~  370 (392)
T 2z9v_A          294 WAASDSIASPTTTAVRTPD-GVDEKALRQAARARYGVVFSSGRGET--LGKLTRIGHMGPTAQPIYAIAALTALGGAMNA  370 (392)
T ss_dssp             SSSSGGGBCTTEEEEECCT-TCCHHHHHHHHHHHHCEECEECCGGG--TTTEEEEECCGGGCSHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHCCEEEEEECCC-CCCHHHHHHHHHHCCCEEEECCCCCC--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             3788022087189998999-98999999999854999997886545--79879981665769999999999999999997


Q ss_pred             H
Q ss_conf             5
Q T0591           404 Y  404 (406)
Q Consensus       404 ~  404 (406)
                      +
T Consensus       371 ~  371 (392)
T 2z9v_A          371 A  371 (392)
T ss_dssp             T
T ss_pred             C
T ss_conf             6


No 65 
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A*
Probab=100.00  E-value=1.8e-34  Score=251.19  Aligned_cols=320  Identities=13%  Similarity=0.075  Sum_probs=220.5

Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHH
Q ss_conf             34156786788788899999999998087888878888988999999999986488678867078824872789999999
Q T0591            41 VDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAA  120 (406)
Q Consensus        41 i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~  120 (406)
                      +|++ |......+.....    +.+.    ..|++..|.+++|+.++.++..      ++.++|++|+|+++++..++.+
T Consensus        31 ~~~~-gl~~~~~~~~~~~----~~~~----~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~g~~~a~~~~~~a   95 (374)
T 2aeu_A           31 YDLS-GLSGGFLIDEKDK----ALLN----TYIGSSYFAEKVNEYGLKHLGG------DENDKCVGFNRTSSAILATILA   95 (374)
T ss_dssp             EECS-SCCCCCCCCHHHH----HHHT----STTHHHHHHHHHHHHHHHHHTC------CTTEEEEEESSHHHHHHHHHHH
T ss_pred             HHCC-CCCCCCCCHHHHH----HHHH----HHCCCCCCCHHHHHHHHHHHCC------CCCCEEEEECCHHHHHHHHHHH
T ss_conf             3002-7888876448999----9999----8608633338999999997157------9852399979849999999983


Q ss_pred             HHHCCHHHHH-HHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCC-CCCCCCCCCHH
Q ss_conf             9720010101-310551389999982996999860446667766677889999985025403421566-64323344378
Q T0591           121 TVARGDKVAI-VQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNP-NNPAGVVYSAE  198 (406)
Q Consensus       121 l~~pGd~Vl~-~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P-~NPTG~~~s~~  198 (406)
                      +..++|.+++ +.|+|+.+...+++.|++.+  ..           .|+++++++++++||++++++| |||||..   +
T Consensus        96 l~~~~~~iv~~~~~~~~~~~~~~~~~~~~~~--~~-----------~~~~~l~~~i~~~tk~i~~~~~~~~~~~~~---~  159 (374)
T 2aeu_A           96 LKPKKVIHYLPELPGHPSIERSCKIVNAKYF--ES-----------DKVGEILNKIDKDTLVIITGSTMDLKVIEL---E  159 (374)
T ss_dssp             HCCSEEEEECSSSSCCTHHHHHHHHTTCEEE--EE-----------SCHHHHHTTCCTTEEEEEECBCTTSCBCCH---H
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCEEE--CC-----------CCHHHHHHCCCCCCEEEEECCCCCCCCCCH---H
T ss_conf             2899849993378875238878864260577--79-----------859999732777846999814888983279---8


Q ss_pred             HHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999863787578417502355688876522332102678689985040010463112114332589999999875
Q T0591           199 EIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQ  278 (406)
Q Consensus       199 ~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~  278 (406)
                      ++++|+++|++||++|++||+|+.+.|++..........   .+  ++++|+||.  ++|+|+||+++++++++.+...+
T Consensus       160 ~l~~i~~~a~~~~~~~i~Dea~~~~~~~~~~~~~~~~~~---~d--i~~~S~sK~--~~g~~~G~~~~~~~li~~~~~~~  232 (374)
T 2aeu_A          160 NFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKLG---AD--LVVTSTDKL--MEGPRGGLLAGKKELVDKIYIEG  232 (374)
T ss_dssp             HHHHHHHHHHHHTCCEEEECTTHHHHHHHTTCCCHHHHT---CS--EEEEETTSS--SSSCSCEEEEEEHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCEEEEEEECCCCCCCCCCCCCCCHHHCC---CE--EEEECCCCC--CCCCCEEEEEEHHHHHHHHHHHH
T ss_conf             899999998766279999445235311234789979929---64--999658523--23452159985267799999997


Q ss_pred             HHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH-------HHHHHHHHHCCCCE--EECCCCCEEEEEECCCCC--
Q ss_conf             2036761245799999998565258999999999999-------99999997279945--535887307877668878--
Q T0591           279 AIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIR-------DELLHVLRGCEGVF--ARTPQAGSYLFPRLPKLA--  347 (406)
Q Consensus       279 ~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r-------~~l~~~L~~~~g~~--~~~p~gg~~~w~~~~~~~--  347 (406)
                      .....+++++.|.++...++...  ...+.+.+++++       +.+...+....+..  +....+.++++.......  
T Consensus       233 ~~~~~~~~~~~~~aa~~al~~~~--~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  310 (374)
T 2aeu_A          233 TKFGLEAQPPLLAGIYRALKNFN--LERIRKAFERAKNFDLSKIEKLNKELKAIDDNINIVYERTPTGFVIKRVYKDDTI  310 (374)
T ss_dssp             HTTTCBCCHHHHHHHHHHHHHCC--HHHHHHHHHHHHHCCCHHHHHHHHHHTTTCTTEEEEEEECSSEEEEEEEESSHHH
T ss_pred             HCCCCCCCHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCCCEEEE
T ss_conf             42121353899999999998850--8999999999999999998631222343677667540005303442366651343


Q ss_pred             --CCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECC------CHHHHHHHH-HHHHHHH
Q ss_conf             --89899999999868918961610267999858998509------979999999-9999999
Q T0591           348 --VAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQ------DHEAAVAAA-RRIVTLV  401 (406)
Q Consensus       348 --~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~------~~e~l~~al-~rl~~~~  401 (406)
                        ..+.+++.+|++++||+++||..| +.+++++|+||+.      ++|++.+++ +.|++++
T Consensus       311 ~~~~~~e~a~~Ll~~~gV~~ip~~~~-p~~~~~lRis~~~~~~~~i~~e~l~~ai~~~lk~~f  372 (374)
T 2aeu_A          311 NIKKLIEIGFNLLKNYGIITITVAGM-PGASKSLRIDLTSRDAERIDDNYIIKAIVESIKMAF  372 (374)
T ss_dssp             HHHHHHHHHHHHHHHHCEECSTTSSS-CSSCCSEEEETTSGGGGGSCHHHHHHHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCC-CCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             32368999999998498899977988-999885998527455423799999999999999996


No 66 
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S beta lyase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A*
Probab=99.97  E-value=2.6e-28  Score=209.40  Aligned_cols=322  Identities=11%  Similarity=0.089  Sum_probs=210.8

Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCC-----------HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHH
Q ss_conf             7888999999999980878888788889-----------88999999999986488678867078824872789999999
Q T0591            52 EPTPGAFDLFSAGVQSGGVQAYTEYRGD-----------LGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAA  120 (406)
Q Consensus        52 ~p~~~~~~~~~~~~~~~~~~~Y~~~~G~-----------~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~  120 (406)
                      ++++.+.+++.+.+.+.    |++..|.           .+.|+.++++    .|.  ++ ++|++|+|++++++.++.+
T Consensus        12 ~~~~~v~~a~~~~~~~~----~~~~~~~~~~~~~~~~~~~~ar~~la~~----~ga--~~-~~v~~~~g~t~al~~~~~~   80 (384)
T 1eg5_A           12 RVDDRVLEEMIVFYREK----YGNPNSAHGMGIEANLHMEKAREKVAKV----LGV--SP-SEIFFTSCATESINWILKT   80 (384)
T ss_dssp             CCCHHHHHHHHHHHHTC----CCCTTCSSHHHHHHHHHHHHHHHHHHHH----HTS--CG-GGEEEESCHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHC----CCCCCCHHHHHHHHHHHHHHHHHHHHHH----HCC--CC-CEEEECCCHHHHHHHHHHH
T ss_conf             69999999999999973----7986521089999999999999999998----398--96-7299919989999999999


Q ss_pred             H----HHCCHHHHHHHCCCHHHHHHHH---HHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             9----7200101013105513899999---82996999860446667766677889999985025403421566643233
Q T0591           121 T----VARGDKVAIVQPDYFANRKLVE---FFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGV  193 (406)
Q Consensus       121 l----~~pGd~Vl~~~P~y~~~~~~~~---~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~  193 (406)
                      +    ..+||.|++..+.|+.+....+   ..|.++..+|++      .++.+|+++++++++++|+++++++|+||||.
T Consensus        81 l~~~~~~~g~~vi~~~~~~~~~~~~~~~~~~~g~~v~~v~~~------~~~~~d~e~le~~i~~~t~~v~v~~~~n~tG~  154 (384)
T 1eg5_A           81 VAETFEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVD------SRGVVKLEELEKLVDEDTFLVSIMAANNEVGT  154 (384)
T ss_dssp             HHHHTTTTCCEEEECTTSCHHHHHHHHHHHHTTCEEEECCBC------TTSCBCHHHHHHHCCTTEEEEEEESBCTTTCB
T ss_pred             HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEECCC------CCCCCCHHHHHHHCCCCCEEEEEECCCCCCCC
T ss_conf             998615899989988985277999999998649889997039------98875899998533679569999776478885


Q ss_pred             CCCHHHHHHHHHHHHHCC--CEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHH
Q ss_conf             443789999999986378--757841750235568887652233210267868998504001046311211433258999
Q T0591           194 VYSAEEIGQIAALAARYG--ATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAII  271 (406)
Q Consensus       194 ~~s~~~l~~i~~~a~~~~--~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i  271 (406)
                      .++   +++|.++|+++|  +++++|.++..    +..+..+..     ..-.+++.|++|.++.+|++++|+.....+.
T Consensus       155 ~~~---l~~i~~la~~~g~~vl~~~D~a~~~----g~~~~~~~~-----~~~d~~~~s~~K~~gp~G~g~~~~~~~~~~~  222 (384)
T 1eg5_A          155 IQP---VEDVTRIVKKKNKETLVHVDAVQTI----GKIPFSLEK-----LEVDYASFSAHKFHGPKGVGITYIRKGVPIR  222 (384)
T ss_dssp             BCC---HHHHHHHHHHHCTTCEEEEECTTTT----TTSCCCCTT-----TCCSEEEEEGGGGTSCTTCEEEEECTTSCCC
T ss_pred             CCC---HHHHHHHHHHCCCEEEEEECCCEEC----CEEEEEHHH-----CCCCEEEECCCCCCCCCCCEEEEEECCHHHH
T ss_conf             010---1379999997299499993231122----545665655-----3986899568632489977368982650211


Q ss_pred             HHHHHH---HHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCE--EEEEECCCC
Q ss_conf             999987---520367612457999999985652589999999999999999999727994553588730--787766887
Q T0591           272 ARMEKL---QAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGS--YLFPRLPKL  346 (406)
Q Consensus       272 ~~l~~~---~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~--~~w~~~~~~  346 (406)
                      ......   ........+...+.++...+......+.+...+++++++.+.+.|.++....+..++...  ++.+.++  
T Consensus       223 ~~~~~~~~~~~~~~gt~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~L~~l~~~~~~~~~~~~~~~~~~~~~--  300 (384)
T 1eg5_A          223 PLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFP--  300 (384)
T ss_dssp             CSBCSSCTTTTTBCSCCCHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHTTTCEECSCTTSBCTTEEEEECT--
T ss_pred             HHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCHHHCCCCEEEEEEC--
T ss_conf             455337876730367742999999999999876369999999999999999999856988916801057967999838--


Q ss_pred             CCCHHHHHHHHHHHCCEEEEECCCCCCC-----------------CCCEEEEEEC--CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8898999999998689189616102679-----------------9985899850--997999999999999999856
Q T0591           347 AVAPAEFVKILRLQAGVVVTPGTEFSPH-----------------TADSVRLNFS--QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       347 ~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~-----------------~~~~iRis~~--~~~e~l~~al~rl~~~~~~~r  405 (406)
                      +.+..++... +.++||.+.+|+.+.+.                 .++++|+|++  +++|+++..++.|+++++++.
T Consensus       301 ~~~~~~~~~~-L~~~gI~v~~G~~~~~~~~~~~~~l~~~g~~~~~~~~~iRis~~~~~t~edvd~~v~~l~~i~~~l~  377 (384)
T 1eg5_A          301 NIRGSTLQNL-LSGYGIYVSTSSACTSKDERLRHVLDAMGVDRRIAQGAIRISLCKYNTEEEVDYFLKKIEEILSFLD  377 (384)
T ss_dssp             TCCHHHHHHH-HHHTTEECBC------------CHHHHTTCCHHHHHHEEEEECCTTCCHHHHHHHHHHHHHHHHHC-
T ss_pred             CCCHHHHHHH-HHHCCEEEECCCHHCCCCCCHHHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9799999999-9759929963711038764204799973998444696799964788999999999999999999874


No 67 
>3f0h_A Aminotransferase; RER070207000802, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE LLP; 1.70A {Eubacterium rectale}
Probab=99.96  E-value=9.8e-27  Score=198.76  Aligned_cols=329  Identities=15%  Similarity=0.130  Sum_probs=217.2

Q ss_pred             CCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHH---HHHHHHHHHHCCCCCCCCCEEEEECCCCHHH
Q ss_conf             9833415678678878889999999999808788887888898899---9999999986488678867078824872789
Q T0591            38 GRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIR---DLLAPRLAAFTGAPVDARDGLIITPGTQGAL  114 (406)
Q Consensus        38 ~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr---~aia~~~~~~~g~~~~~~~~I~it~G~~~~l  114 (406)
                      ...+.|+-| |   .+.|   +.+.+++.....++-     .+++.   +.+.+.+.+..+.+-+ ..-|++|.|+|+++
T Consensus        18 ~~~~~f~pG-P---~~~~---~~V~~a~~~~~~~hr-----~~~f~~~~~~~~~~l~~~~~~~~~-~~~i~~~gsgT~a~   84 (376)
T 3f0h_A           18 QGMLNFTVG-P---VMSS---EEVRAIGAEQVPYFR-----TTEFSSTMLENEKFMLEYAKAPEG-SKAVFMTCSSTGSM   84 (376)
T ss_dssp             SSCEECSSS-S---CCCC---HHHHHHHTSCCCCCS-----SHHHHHHHHHHHHHHHHHHTCCTT-CEEEEESSCHHHHH
T ss_pred             CCCEEEECC-C---CCCC---HHHHHHHCCCCCCCC-----CHHHHHHHHHHHHHHHHHHCCCCC-CEEEEEECCHHHHH
T ss_conf             662685189-9---8886---999997377788878-----889999999999999999589999-75999908799999


Q ss_pred             HHHHHHHHHCCHHHHHHHCCCHHHH--HHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9999999720010101310551389--99998299699986044666776667788999998502540342156664323
Q T0591           115 FLAVAATVARGDKVAIVQPDYFANR--KLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAG  192 (406)
Q Consensus       115 ~~~~~~l~~pGd~Vl~~~P~y~~~~--~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG  192 (406)
                      ..++..+++|||+|++.+++|++..  ..++.+|.+++.++.+.      +..+|++++++++++++|++++++++||||
T Consensus        85 ea~~~~l~~~gd~vlv~~~G~f~~~~~~ia~~~G~~v~~i~~~~------g~~~d~e~i~~~i~~~~k~v~~~~~~t~TG  158 (376)
T 3f0h_A           85 EAVVMNCFTKKDKVLVIDGGSFGHRFVQLCEIHEIPYVALKLEH------GKKLTKEKLYEYDNQNFTGLLVNVDETSTA  158 (376)
T ss_dssp             HHHHHHHCCTTCCEEEEESSHHHHHHHHHHHHTTCCEEEEECCT------TCCCCHHHHHTTTTSCCCEEEEESEETTTT
T ss_pred             HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCC------CCCCCHHHHHHHHCCCCCEEEEECCCCCCC
T ss_conf             99999847995989999598889999999998199744631689------987798999987255884899834678654


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCC-CCCCCHHHHHHHHHH
Q ss_conf             3443789999999986378757841750235568887652233210267868998504001046-311211433258999
Q T0591           193 VVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESL-SGYRLGVAFGSRAII  271 (406)
Q Consensus       193 ~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~-~GlRiG~~~~~~~~i  271 (406)
                      .+.+   +++|.++|+++|+++++|.+++...   .+ -.+...     .--+++.|..|.++. ||  +|+++.+++.+
T Consensus       159 ~~~d---i~~I~~i~~~~~~~lvvD~v~s~g~---~p-i~~~~~-----~id~~~~~~~K~l~~p~G--~~~~~~~~~~~  224 (376)
T 3f0h_A          159 VLYD---TMMIGEFCKKNNMFFVCDCVSAFLA---DP-FNMNEC-----GADVMITGSQKVLACPPG--ISVIVLAPRGV  224 (376)
T ss_dssp             EECC---HHHHHHHHHHTTCEEEEECTTTTTT---SC-CCHHHH-----TCSEEEEETTTTTCCCSS--CEEEEECHHHH
T ss_pred             CCCC---HHHHHHHHHHCCCEEEEECCCCCCC---CC-CCCCCE-----EEEEHHCCCCCEECCCCC--EEEEEECHHHH
T ss_conf             0377---3676766640595589865433567---65-434322-----321001136621015896--05787479999


Q ss_pred             HHHHHHH----------------HHCCCCH-HHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             9999875----------------2036761-245799999998565--25899999999999999999997279945535
Q T0591           272 ARMEKLQ----------------AIVSLRA-AGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEGVFART  332 (406)
Q Consensus       272 ~~l~~~~----------------~~~~~~~-~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~  332 (406)
                      ..+....                ...+.++ +.....++...++..  +..++...++++++++.+.+.|.++ |++...
T Consensus       225 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~T~~~~~i~al~~aL~~l~~e~g~~~~~~r~~~~~~~l~~~L~~l-Gl~~~~  303 (376)
T 3f0h_A          225 ERVEKSKVRTMYFDLKDALKNQERGQTPFTPAVGILLQINERLKEIKKHGGADAEVARIASQAADFRAKIKDL-PFELVS  303 (376)
T ss_dssp             HHHHTCCCCCSTTCHHHHHHHHTTTCCSSCCCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHTTTS-SEEECC
T ss_pred             HHHHCCCCCCCCCCHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHC-CCEECC
T ss_conf             9764058876422066765411345777765446789999999998860339999999999999999999965-986256


Q ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEE--CCCHHHHHHHHHHHHHHHHH
Q ss_conf             887307877668878898999999998689189616102679998589985--09979999999999999998
Q T0591           333 PQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNF--SQDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       333 p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~--~~~~e~l~~al~rl~~~~~~  403 (406)
                      ++.+..++.-.++ +.++.++..+|++++||.+.||  +|....+++||+.  ..++++++..++.|++++++
T Consensus       304 ~~~~~~v~~~~~~-~~~~~~~~~~l~~~~gi~i~~g--~g~~~~~~~RI~~mg~~t~~di~~l~~al~~~l~~  373 (376)
T 3f0h_A          304 ESPANGVTSVHPT-TANAYDIFLKLKDEYGIWICPN--GGEMKDTIFRVGHIGALTHEDNTTLVNAFKDLQKR  373 (376)
T ss_dssp             SSBBTTEEEEEES-SSCHHHHHHHHHHHSSEECEEC--CGGGTTTCEEEECCSSCCHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCEEEEEECC-CCCHHHHHHHHHHCCCEEEECC--CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             6778708999799-9998999999997099999778--74447978999678869999999999999999972


No 68 
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics, NPPSFA; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A*
Probab=99.95  E-value=2.3e-26  Score=196.20  Aligned_cols=336  Identities=13%  Similarity=0.114  Sum_probs=202.0

Q ss_pred             CCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCC-----CHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCH
Q ss_conf             98334156786788788899999999998087888878888-----9889999999999864886788670788248727
Q T0591            38 GRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRG-----DLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQG  112 (406)
Q Consensus        38 ~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G-----~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~  112 (406)
                      .+.||+.-+.+... .+|++.+++.+....-....|....+     .+++.+.+.+.+.+..|.     +++++|+|+++
T Consensus         7 ~~~in~~p~~~~~~-~~~~~~~a~~~~~~~~~~~~~~~~~~ld~~~~~~~~~~le~~~a~~~g~-----e~~~~~~~~~~   80 (371)
T 2e7j_A            7 KDFINIDPLQTGGK-LTEEARQALLEWGDGYSVCDFCTTGRLDEIKTPPIHDFIHNQLPKFLGC-----DVARVTNGARE   80 (371)
T ss_dssp             -CCEECCHHHHTCC-CCHHHHHHHHHC--------------------CCHHHHHHTHHHHHTTS-----SEEEEESSHHH
T ss_pred             CCCCCCCCCCCCCC-CCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC-----CEEEEECCHHH
T ss_conf             00325785323796-8899999999983477400034667655456716999999999998688-----97999895999


Q ss_pred             HHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCC-----CEEEECCCC
Q ss_conf             899999999720010101310551389999982996999860446667766677889999985025-----403421566
Q T0591           113 ALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAG-----ARVFLFSNP  187 (406)
Q Consensus       113 ~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~-----~k~i~l~~P  187 (406)
                      ++..++.++++|||.|+++.++|.+....++..|++++.+|.+    +..++.+|++++++++++.     ++++++++|
T Consensus        81 a~~~~~~~~~~~gd~vi~~~~~h~s~~~~~~~~g~~~~~~~~~----~~~~~~~~~~~l~~~i~~~~~~~~~~lv~~~~~  156 (371)
T 2e7j_A           81 AKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKT----DYPDYAITPENFAQTIEETKKRGEVVLALITYP  156 (371)
T ss_dssp             HHHHHHHHHCCTTCEEEEETTCCHHHHHHHHHTTCEEEEECCC----CTTTCCCCHHHHHHHHHHHTTTSCEEEEEEESS
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCEEEECCCC----CCCCCCCCHHHHHHHHHHCCCCCCCEEEEEECC
T ss_conf             9999999962899999980774199999999849989964554----566677799999999875423578389999589


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHH
Q ss_conf             64323344378999999998637875784175023556888765223321026786899850400104631121143325
Q T0591           188 NNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS  267 (406)
Q Consensus       188 ~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~  267 (406)
                      +||||.+.+   +++|+++|++||+++++|++|+.-.+    ........   .+  ++++|+||.++.+| ++||++++
T Consensus       157 ~~~~G~~~~---l~~i~~~~~~~~~~~~~D~a~~~g~~----~~~~~~~g---~D--~~~~S~~K~l~~~g-~~G~l~~~  223 (371)
T 2e7j_A          157 DGNYGNLPD---VKKIAKVCSEYDVPLLVNGAYAIGRM----PVSLKEIG---AD--FIVGSGHKSMAASG-PIGVMGMK  223 (371)
T ss_dssp             CTTTCCCCC---HHHHHHHHHTTTCCEEEECTTTBTTB----CCCHHHHT---CS--EEEEEHHHHSSCCS-SCEEEEEC
T ss_pred             CCCCCEEEH---HHHHHHHHHCCCCEEEECCCCCCCEE----EECCCCCC---CC--CCCCCCCCCCCCCC-CEEEEEEC
T ss_conf             899854231---99999986311642887354444424----21123310---24--45677750137767-88999987


Q ss_pred             HHHHHHHHHHHHHC--------CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEE--CCCCCE
Q ss_conf             89999999875203--------67612457999999985652589999999999999999999727994553--588730
Q T0591           268 RAIIARMEKLQAIV--------SLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFAR--TPQAGS  337 (406)
Q Consensus       268 ~~~i~~l~~~~~~~--------~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~--~p~gg~  337 (406)
                      +++++.+.+.....        ....+......+.+.++...+.++...... ++...+.+.|.++ |+...  .|....
T Consensus       224 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~l~~~~~~~~~~~~~~-~~~~~~~~~l~~~-g~~~~~~~~~~~~  301 (371)
T 2e7j_A          224 EEWAEIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEEV-EKARRFAAEMEKL-GIKQLGDNPHNHD  301 (371)
T ss_dssp             TTTTTTTTCBCSSCTTSBGGGTTCCCCSHHHHHHHHHHHHHHHHGGGHHHHH-HHHHHHHHHHHHT-TCEEESSSSCCSS
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHC-CCEECCCCCCCCC
T ss_conf             7999998741566666632221101453799999999999999999999999-9999999999856-9965577888764


Q ss_pred             EEEEECCCC-------CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE-ECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             787766887-------889899999999868918961610267999858998-5099799999999999999985
Q T0591           338 YLFPRLPKL-------AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN-FSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       338 ~~w~~~~~~-------~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis-~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      .++...+..       ......+... +.+.++...   ..+  ....+|++ +..++|+++..++.|++.+++|
T Consensus       302 ~~~~~~~~~~~i~~~~~~~~~~~~~~-l~~~~~~~i---~~g--~~~~~~~~~~~~t~eeid~li~al~eI~~~y  370 (371)
T 2e7j_A          302 LMFFHAEVLYEISKKAKGGRFFLYRE-LKSRKIHGI---KPG--LTRYFKLSTYGLSDEEVDYVLNAFKEIIEKY  370 (371)
T ss_dssp             EEEEECHHHHHHHHHSSSGGGHHHHH-HHHTTEECS---CTT--CCSEEEEECTTCCHHHHHHHHHHHHHHHHHC
T ss_pred             EEEECCCCHHHHHHHHHCCCHHHHHH-HHHCCCEEE---ECC--CCCEEEEECCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             69852620367777751153688988-876485367---137--7625888457799999999999999999985


No 69 
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocysteine, aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A*
Probab=99.95  E-value=2.1e-25  Score=189.82  Aligned_cols=332  Identities=15%  Similarity=0.101  Sum_probs=206.5

Q ss_pred             HCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHC---CCCCCCCCCCC----CHHHHHHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             0378983341567867887888999999999980---87888878888----9889999999999864886788670788
Q T0591            34 APIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQS---GGVQAYTEYRG----DLGIRDLLAPRLAAFTGAPVDARDGLII  106 (406)
Q Consensus        34 ~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~---~~~~~Y~~~~G----~~~Lr~aia~~~~~~~g~~~~~~~~I~i  106 (406)
                      .|.....+-|..+...  +++..+.+++.+.+..   .+...|.....    ..++|+.||++    .|.  ++ ++|++
T Consensus        11 fp~~~~~~yln~a~~~--~~p~~v~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~iA~~----~g~--~~-~~v~~   81 (390)
T 1elu_A           11 FPGLANKTYFNFGGQG--ILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAET----FNV--DP-NTITI   81 (390)
T ss_dssp             CGGGTTSEECCTTTCC--CCCHHHHHHHHHHHHHHHHHCSSSHHHHHHHHHHHHHHHHHHHHH----TTS--CG-GGEEE
T ss_pred             CCCCCCCEEEECCCCC--CCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHH----CCC--CC-CCEEE
T ss_conf             8888998997697325--799999999999999745278763056789999999999999998----099--96-73999


Q ss_pred             ECCCCHHHHHHHHHH-HHCCHHHHHHHCCCHHHHHHH----HHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEE
Q ss_conf             248727899999999-720010101310551389999----982996999860446667766677889999985025403
Q T0591           107 TPGTQGALFLAVAAT-VARGDKVAIVQPDYFANRKLV----EFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARV  181 (406)
Q Consensus       107 t~G~~~~l~~~~~~l-~~pGd~Vl~~~P~y~~~~~~~----~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~  181 (406)
                      |+|+|+++++++.++ ++|||+|++.+..|++....+    +..|++++.+|++..    .+...+.+.++++++++||+
T Consensus        82 ~~~~T~a~~~~~~~l~~~~gd~Vv~~~~~~~s~~~~~~~la~~~g~~v~~vp~~~~----~~~~~~~~~l~~~~~~~t~l  157 (390)
T 1elu_A           82 TDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIAIVQAIAARFGITYRFFPVAAT----LNQGDAAAVLANHLGPKTRL  157 (390)
T ss_dssp             ESSHHHHHHHHHHHSCCCTTCEEEEETTCCHHHHHHHHHHHHHHCCEEEEECCGGG----SSSSCHHHHHHTTCCTTEEE
T ss_pred             ECCHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCEEEEECCCCCC----CCCCHHHHHHHHHCCCCCEE
T ss_conf             89889999999981735898989988897875899999998718859998043035----77221799999717999369


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHC----CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCC
Q ss_conf             42156664323344378999999998637----87578417502355688876522332102678689985040010463
Q T0591           182 FLFSNPNNPAGVVYSAEEIGQIAALAARY----GATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLS  257 (406)
Q Consensus       182 i~l~~P~NPTG~~~s~~~l~~i~~~a~~~----~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~  257 (406)
                      +++++++||||.+++   +++|+++|+++    ++++++|.+++.    |..+..+...   ..+  +++.|..|.++.|
T Consensus       158 v~~~~~~n~tG~~~p---i~~i~~l~~~~~~~~~~~~~vD~a~~~----g~~~~d~~~~---~~D--~~~~s~hK~l~gp  225 (390)
T 1elu_A          158 VILSHLLWNTGQVLP---LAEIMAVCRRHQGNYPVRVLVDGAQSA----GSLPLDFSRL---EVD--YYAFTGHKWFAGP  225 (390)
T ss_dssp             EEEESBCTTTCCBCC---HHHHHHHHHHCCSSSCCEEEEECTTTB----TTBCCCTTTS---CCS--EEEEESSSTTCCC
T ss_pred             EEEECCCCCCCEECC---HHHHHHHHHHHCCCCCCEEEEECCCCC----CCCCCCHHHH---CCC--EEEECCCCCCCCC
T ss_conf             999788778851246---898889999854678964999666556----6544674561---898--9998780236788


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHH---------------------HCCCCHHHHHHHH-HHHHHHCCC--HHHHHHHHHHHH
Q ss_conf             1121143325899999998752---------------------0367612457999-999985652--589999999999
Q T0591           258 GYRLGVAFGSRAIIARMEKLQA---------------------IVSLRAAGYSQAV-LRGWFDEAP--GWMEDRIARHQA  313 (406)
Q Consensus       258 GlRiG~~~~~~~~i~~l~~~~~---------------------~~~~~~~~~~q~a-~~~~l~~~~--~~~~~~~~~~~~  313 (406)
                       ..+|+++.++++++.+.....                     ....+++...+.+ +..+++-..  ...+...+++.+
T Consensus       226 -~G~G~l~v~~~~~~~~~p~~~g~~~~~~~~~~~~~~~~~~~~r~~~gt~~~~~~~~l~~al~~~~~~g~~~~~~~~~~~  304 (390)
T 1elu_A          226 -AGVGGLYIHGDCLGEINPTYVGWRSITYGAKGEPTGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGTAEERYQAICQ  304 (390)
T ss_dssp             -TTCEEEEECTTTGGGCCCCSCCTTTEEECTTSCEEEECSGGGGGCCSCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
T ss_pred             -CCCEEEEECHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             -9776689768899755863468875345543564532332011145788799999999999999962839999999999


Q ss_pred             HHHHHHHHHHHCCCCEEECC---CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC--CCHH
Q ss_conf             99999999972799455358---873078776688788989999999986891896161026799985899850--9979
Q T0591           314 IRDELLHVLRGCEGVFARTP---QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS--QDHE  388 (406)
Q Consensus       314 ~r~~l~~~L~~~~g~~~~~p---~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~--~~~e  388 (406)
                      +++.+.+.|.+++|+++..+   .+++ +.+.++. ..+..++... |+++||.+..   +  ..++++|+|+.  +++|
T Consensus       305 ~~~~l~~~L~~~~g~~~~~~~~~~~~i-v~f~~~~-~~~~~~~~~~-L~~~gi~v~~---~--~~~~~lRis~~~~nt~e  376 (390)
T 1elu_A          305 RSEFLWRGLNQLPHVHCLATSAPQAGL-VSFTVDS-PLGHRAIVQK-LEEQRIYLRT---I--ADPDCIRACCHYITDEE  376 (390)
T ss_dssp             HHHHHHHHHHHSTTEEESCSSCCSSSE-EEEEECS-SSCHHHHHHH-HHHTTEECEE---E--TTTTEEEEECCTTCCHH
T ss_pred             HHHHHHHHHHCCCCEEECCCCCCCCEE-EEEEECC-CCCHHHHHHH-HHHCCEEEEE---C--CCCCEEEEECCCCCCHH
T ss_conf             999999998639986976888877428-9998089-8899999999-9978918983---4--89998999767889999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q T0591           389 AAVAAARRIVT  399 (406)
Q Consensus       389 ~l~~al~rl~~  399 (406)
                      +++..++.|++
T Consensus       377 did~l~~~L~e  387 (390)
T 1elu_A          377 EINHLLARLAD  387 (390)
T ss_dssp             HHHHHHHHHTT
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999997


No 70 
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus HB8} PDB: 2yri_A*
Probab=99.95  E-value=3.6e-25  Score=188.21  Aligned_cols=325  Identities=16%  Similarity=0.115  Sum_probs=208.7

Q ss_pred             EEECCCCCCCCCCC-HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEC-CCCHHHHHHH
Q ss_conf             34156786788788-899999999998087888878888988999999999986488678867078824-8727899999
Q T0591            41 VDFSHGDVDAHEPT-PGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITP-GTQGALFLAV  118 (406)
Q Consensus        41 i~ls~G~pd~~~p~-~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~-G~~~~l~~~~  118 (406)
                      ++|+-| |   .|. |.+.    +++.+....+|++  +..++.+.+.+++.+.+|.+.  ++.+++.+ ++++++.+++
T Consensus         2 ~~~~pg-P---~~~~~~v~----~A~~~~~~~~~~~--~~~~~~~~~r~~la~~~g~~~--~~~~~~~~~s~t~a~~~~~   69 (353)
T 2yrr_A            2 LLLTPG-P---TPIPERVQ----KALLRPMRGHLDP--EVLRVNRAIQERLAALFDPGE--GALVAALAGSGSLGMEAGL   69 (353)
T ss_dssp             EECSSS-S---CCCCHHHH----GGGGSCCCCTTCH--HHHHHHHHHHHHHHHHHCCCT--TCEEEEESSCHHHHHHHHH
T ss_pred             CCCCCC-C---CCCHHHHH----HHHHHHCCCCCHH--HHHHHHHHHHHHHHHHHCCCC--CCEEEEECCHHHHHHHHHH
T ss_conf             415689-8---79859999----9841330565609--999999999999999849799--8889996857999999999


Q ss_pred             HHHHHCCHHHHHHHCCCHHHH-HHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CCCEEEECCCCCCCCCCCCC
Q ss_conf             999720010101310551389-9999829969998604466677666778899999850-25403421566643233443
Q T0591           119 AATVARGDKVAIVQPDYFANR-KLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AGARVFLFSNPNNPAGVVYS  196 (406)
Q Consensus       119 ~~l~~pGd~Vl~~~P~y~~~~-~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~~P~NPTG~~~s  196 (406)
                      .. +.+||.|+++.++|..+. ......+.++..++.+      .+..+|++.++++++ ++++++++++++||||.+++
T Consensus        70 ~~-~~~g~~vv~~~~~~~~~~~~~~~~~~~~v~~~~~~------~~~~~~~~~l~~ai~~~~~~~v~~~~~~n~tG~~~~  142 (353)
T 2yrr_A           70 AN-LDRGPVLVLVNGAFSQRVAEMAALHGLDPEVLDFP------PGEPVDPEAVARALKRRRYRMVALVHGETSTGVLNP  142 (353)
T ss_dssp             HT-CSCCCEEEEECSHHHHHHHHHHHHTTCCEEEEECC------TTSCCCHHHHHHHHHHSCCSEEEEESEETTTTEECC
T ss_pred             HH-CCCCCEEEEECCHHHHHHHHHHHHHCCCCEECCCC------CCCCCCHHHHHHHHCCCCCEEEEEECCCCCCCEECC
T ss_conf             85-78982899978748899999999829953541789------799869999999734599649999788897568715


Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             78999999998637875784175023556888765223321026786899850400104631121143325899999998
Q T0591           197 AEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEK  276 (406)
Q Consensus       197 ~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~  276 (406)
                         +++|.++|+++|+++++|++|....++.    ..... .  .  .+++.|.+|.++. +..+|+++..++++..+..
T Consensus       143 ---l~~I~~~~~~~g~~~~vD~~~~~~~~~~----~~~~~-~--~--d~~~~~~~K~l~~-~~g~g~l~~~~~~~~~~~~  209 (353)
T 2yrr_A          143 ---AEAIGALAKEAGALFFLDAVTTLGMLPF----SMRAM-G--V--DYAFTGSQKCLSA-PPGLAPIAASLEARKAFTG  209 (353)
T ss_dssp             ---HHHHHHHHHHHTCEEEEECTTTTTTSCC----CHHHH-T--C--SEEECCTTSTTCC-CSSCEEEEECHHHHHHCCC
T ss_pred             ---HHHHHHHHCCCCCEEEEEECCCCCEEEE----ECCCC-E--E--EEEEECCCCCCCC-CCCEEEEEEEHHHHHHHCC
T ss_conf             ---9999656334793799950333325776----22674-5--7--8999438774667-9987999984789887247


Q ss_pred             HH--------------HHCC-CCHHHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCC--CEE
Q ss_conf             75--------------2036-761245799999998565-25899999999999999999997279945535887--307
Q T0591           277 LQ--------------AIVS-LRAAGYSQAVLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQA--GSY  338 (406)
Q Consensus       277 ~~--------------~~~~-~~~~~~~q~a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~g--g~~  338 (406)
                      ..              .... .......+.++.+.+... +......+++....++.+.+.|... |+....++.  ...
T Consensus       210 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~a~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~-g~~~~~~~~~~~~~  288 (353)
T 2yrr_A          210 KRGWYLDLARVAEHWERGGYHHTTPVLLHYALLEALDLVLEEGVAARERRAREVYAWVLEELKAR-GFRPYPKASPLPTV  288 (353)
T ss_dssp             CSCSTTCHHHHHHHHTTCCCSSCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHT-TCEESCSSSBCTTE
T ss_pred             CCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCEE
T ss_conf             87767688888766532776677635799999999999998679999999999999999999865-97636875568659


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE---ECCCHHHHHHHHHHHHHHHH
Q ss_conf             87766887889899999999868918961610267999858998---50997999999999999999
Q T0591           339 LFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN---FSQDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       339 ~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis---~~~~~e~l~~al~rl~~~~~  402 (406)
                      +++.+|+ +.+..++++.| .++||.|.||...  ..++++|+|   +..++|++++.++.|++++.
T Consensus       289 ~~~~~p~-~~~~~~l~~~L-~~~gI~v~~G~~~--~~~~~iRvs~~g~~~t~edv~~~l~al~~~La  351 (353)
T 2yrr_A          289 LVVRPPE-GVDADRLVRAL-YAEGVAVAGGIGP--TRGQVLRLGLMGEGARREAYQAFLKALDRALA  351 (353)
T ss_dssp             EEEECCT-TCCHHHHHHHH-HHTTEECEECCGG--GTTTCEEEECSGGGSCHHHHHHHHHHHHHHHH
T ss_pred             EEEECCC-CCCHHHHHHHH-HHCCCEEECCCCC--CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             9997899-99999999999-8789599846501--37998999788888999999999999999985


No 71 
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, PLP, virulence, acyltransferase, aminotransferase, pyridoxal phosphate, transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A
Probab=99.95  E-value=2.3e-24  Score=182.78  Aligned_cols=330  Identities=12%  Similarity=0.060  Sum_probs=218.1

Q ss_pred             CCEEECCCCC-CCCCCCHHHHHHHHHHHHCCCCC------CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCC
Q ss_conf             8334156786-78878889999999999808788------8878888988999999999986488678867078824872
Q T0591            39 RPVDFSHGDV-DAHEPTPGAFDLFSAGVQSGGVQ------AYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQ  111 (406)
Q Consensus        39 ~~i~ls~G~p-d~~~p~~~~~~~~~~~~~~~~~~------~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~  111 (406)
                      +.|+|+.-+. .+ .-.|.+.+++.+++.+-+..      -|+......+|.+.+|+|+    |.    ++ .++++.++
T Consensus        60 ~~i~~~sndYLgl-~~hp~v~~a~~~a~~~~g~~~~~s~~~~g~~~~~~~LE~~lA~~~----G~----E~-al~~~SG~  129 (409)
T 3kki_A           60 DDIILQSNDYLAL-ANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFT----GF----DE-CLLSQSGW  129 (409)
T ss_dssp             TSEECCCSCTTCC-TTCHHHHHHHHHHHHSCCCCCCSBGGGGCSTTTSCHHHHHHHHHH----TC----SE-EEEESCHH
T ss_pred             CEEEEECCCCCCC-CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHH----CC----CE-EEEECCHH
T ss_conf             8688588665576-789999999999999828998766863688769999999999987----89----82-99987889


Q ss_pred             HHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CCCEEEECCCCCCC
Q ss_conf             78999999997200101013105513899999829969998604466677666778899999850-25403421566643
Q T0591           112 GALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AGARVFLFSNPNNP  190 (406)
Q Consensus       112 ~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~~P~NP  190 (406)
                      .+...++.++++|||.|++...++......+.+.+.+.+.++           ..|++.+++.+. .+++++++.+++++
T Consensus       130 ~An~~~i~al~~~gd~Vi~d~~~H~s~~~~~~~~~~~~~~~~-----------h~d~~~l~~~l~~~~~~~Ivve~~~s~  198 (409)
T 3kki_A          130 NANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFM-----------HNNCDHLRMLIQRHGPGIIVVDSIYST  198 (409)
T ss_dssp             HHHHHHHHHHCCTTCEEEEETTSCHHHHHHHHHTTCEEEEEC-----------TTCHHHHHHHHHHHCSCEEEEESBCTT
T ss_pred             HHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHCCCEEEEEC-----------CCCHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             999999999973898899538725878877874288059978-----------999899999986259838985798789


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHH
Q ss_conf             23344378999999998637875784175023556888765223321026786899850400104631121143325899
Q T0591           191 AGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAI  270 (406)
Q Consensus       191 TG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~  270 (406)
                      +|.+.+   +++|+++|+++|+++++||+|+...+.. .-..+...........+++.|+||.|+.+|   ||+++++++
T Consensus       199 ~G~i~~---L~~i~~la~~~ga~livDeah~~g~~G~-~g~G~~~~~~~~~~~di~~~tlsKalG~~g---G~v~~~~~~  271 (409)
T 3kki_A          199 LGTIAP---LAELVNISKEFGCALLVDESHSLGTHGP-NGAGLLAELGLTREVHFMTASLAKTFAYRA---GAIWCNNEV  271 (409)
T ss_dssp             TCCBCC---HHHHHHHHHHHTCEEEEECTTTTTTSSG-GGCCHHHHHTCGGGCSEEEEESSSTTCSSC---EEEEESSSG
T ss_pred             CCCCCC---HHHHHHHHHHHCCCCCCHHHHHCCCCCC-CCCCCCCCCCCCCCCCCEECCCCCCCCCCE---EEEECCHHH
T ss_conf             987547---9999999998584302115540466578-887631002323333311013566776523---799626058


Q ss_pred             HHHHHHHHH-HCCCCHHHHHH-HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCC
Q ss_conf             999998752-03676124579-9999998565258999999999999999999972799455358873078776688788
Q T0591           271 IARMEKLQA-IVSLRAAGYSQ-AVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAV  348 (406)
Q Consensus       271 i~~l~~~~~-~~~~~~~~~~q-~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~  348 (406)
                      ++.++.... ........+.+ .++.+.++-.. ...+.+++++++.+++.+.|.++ |+.+.. + +..+.+.+.+ ..
T Consensus       272 i~~l~~~~~~~~~s~~~~p~~aaa~~aaL~~l~-~~~~~r~~l~~~~~~l~~~L~~~-G~~i~~-~-s~Iv~v~~g~-~~  346 (409)
T 3kki_A          272 NRCVPFISYPAIFSSTLLPYEAAGLETTLEIIE-SADNRRQHLDRMARKLRIGLSQL-GLTIRS-E-SQIIGLETGD-ER  346 (409)
T ss_dssp             GGTHHHHCHHHHHSBCCCHHHHHHHHHHHHHHH-HCHHHHHHHHHHHHHHHHHHHTT-TCCCCC-S-SSEEEEEEES-HH
T ss_pred             HHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHH-CCHHHHHHHHHHHHHHHHHHHHC-CCCCCC-C-CCEEEEEECC-HH
T ss_conf             999987265643346778899999999899985-28899999999999999999977-998799-9-9979999698-89


Q ss_pred             CHHHHHHHHHHHCCEEEEECCCCCC---CCCCEEEEEEC--CCHHHHHHHHHHHHHHHHHH
Q ss_conf             9899999999868918961610267---99985899850--99799999999999999985
Q T0591           349 APAEFVKILRLQAGVVVTPGTEFSP---HTADSVRLNFS--QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       349 ~~~~~~~~Ll~~~gV~v~pG~~Fg~---~~~~~iRis~~--~~~e~l~~al~rl~~~~~~~  404 (406)
                      ...++++.| .++||.+.+-  ..|   .+...+|+++.  .++|++++.++.|++++++.
T Consensus       347 ~a~~~~~~L-~e~GI~v~~i--~~P~vp~g~~~lR~~~~~~~t~edId~~i~~l~e~l~~~  404 (409)
T 3kki_A          347 NTEKVRDYL-ESNGVFGSVF--CRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYG  404 (409)
T ss_dssp             HHHHHHHHH-HHTTEECEEE--CTTSSCTTCEEEEEECCTTCCHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHH-HHCCCEEEEE--CCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             999999999-9789638657--999989997259998088899999999999999999635


No 72 
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A*
Probab=99.93  E-value=3.6e-24  Score=181.43  Aligned_cols=328  Identities=16%  Similarity=0.146  Sum_probs=217.8

Q ss_pred             CEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHH
Q ss_conf             33415678678878889999999999808788887888898899999999998648867886707882487278999999
Q T0591            40 PVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVA  119 (406)
Q Consensus        40 ~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~  119 (406)
                      .|||+.-  ....|+|++++++.++.  .+...|++.....+|++.+|+++    |.    + .++++++++++...++.
T Consensus         5 ~~~~~~~--~~~~psp~~~~A~~~a~--~g~~~yg~~p~~~~le~~lAe~~----G~----e-~~~~~~sGt~A~~~ai~   71 (347)
T 1jg8_A            5 MIDLRSD--TVTKPTEEMRKAMAQAE--VGDDVYGEDPTINELERLAAETF----GK----E-AALFVPSGTMGNQVSIM   71 (347)
T ss_dssp             CEECSCG--GGCCCCHHHHHHHHTCC--CCCGGGTCCHHHHHHHHHHHHHH----TC----S-EEEEESCHHHHHHHHHH
T ss_pred             EEECCCC--CCCCCCHHHHHHHHHHH--CCCCCCCCCHHHHHHHHHHHHHH----CC----C-CEEEECCHHHHHHHHHH
T ss_conf             1775667--39999999999999645--47852489869999999999988----89----9-19997588999999999


Q ss_pred             HHHHCCHHHHHHHCCCHHHHHHH---HHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCC------CCEEEECCCCCC-
Q ss_conf             99720010101310551389999---98299699986044666776667788999998502------540342156664-
Q T0591           120 ATVARGDKVAIVQPDYFANRKLV---EFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKA------GARVFLFSNPNN-  189 (406)
Q Consensus       120 ~l~~pGd~Vl~~~P~y~~~~~~~---~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~------~~k~i~l~~P~N-  189 (406)
                      +++.+||.+++..+.+..+....   ...+.....++.+       .+..|++.+++.+..      ++++++++++.| 
T Consensus        72 a~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  144 (347)
T 1jg8_A           72 AHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGK-------NGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNR  144 (347)
T ss_dssp             HHCCTTCEEEEETTCHHHHSSTTHHHHHTCCEEEEECEE-------TTEECHHHHHHHSCCSCTTSCCEEEEEEESSBTT
T ss_pred             HHHCCCCEEEECCCCCEEEECCCCCCCCCCEEEECCCCC-------CCCCCHHHHHHHHHHHHHCCCCCCEEEECCEEEC
T ss_conf             864469648633654303211232102354067455675-------6766989999998664221566413552240202


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHH
Q ss_conf             32334437899999999863787578417502355688876522332102678689985040010463112114332589
Q T0591           190 PAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRA  269 (406)
Q Consensus       190 PTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~  269 (406)
                      +.+...+.++++++.++|++|+++++.|+++......+........  ...  ..  ..+++|..+..|.+.|+.....+
T Consensus       145 ~g~~~~~~~~l~~~~~~~~~~g~~l~~D~a~~~~~~~~~~~~~~~~--~~~--~~--~~~~~~~~~~~~~~~~~~~~~~~  218 (347)
T 1jg8_A          145 SGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEY--AGY--AD--SVMFCLSKGLCAPVGSVVVGDRD  218 (347)
T ss_dssp             TTSBCCCHHHHHHHHHHHHHHTCEEEEEETTHHHHHHHHCCCHHHH--HHT--CS--EEEEESSSTTCCSSCEEEEECHH
T ss_pred             CCCEECCHHHHHHHHHHHHHCEEEEEEECCCCCCCCCCCCCCHHHH--CCC--CE--EEEECCCCCCCCCCCHHHHCCHH
T ss_conf             5862225889999999987522799840221023003565666763--553--20--36753677777765313215598


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHH--HHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCC
Q ss_conf             99999987520367612457999999--9856525899999999999999999997279945535887307877668878
Q T0591           270 IIARMEKLQAIVSLRAAGYSQAVLRG--WFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLA  347 (406)
Q Consensus       270 ~i~~l~~~~~~~~~~~~~~~q~a~~~--~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~  347 (406)
                      ++............+.+.....++..  .++....    ..+...++++.+.+.|.++.+.....|..++++|++++...
T Consensus       219 ~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~----~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~~~~  294 (347)
T 1jg8_A          219 FIERARKARKMLGGGMRQAGVLAAAGIIALTKMVD----RLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLK  294 (347)
T ss_dssp             HHHHHHHHHHHHTCCCSSTHHHHHHHHHHHHHSST----THHHHHHHHHHHHHHHHHHTCBCCGGGCCSSEEEEECTTSS
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCC
T ss_conf             88777621777776605678889899988887788----89999999987777888617776668987559999817975


Q ss_pred             CCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC--CCHHHHHHHHHHHHHHHHHH
Q ss_conf             8989999999986891896161026799985899850--99799999999999999985
Q T0591           348 VAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS--QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       348 ~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~--~~~e~l~~al~rl~~~~~~~  404 (406)
                      .+..+++++|. ++||.+.|.      +++++|+++.  .++|++++.++.|+++++|+
T Consensus       295 ~~a~~l~~~L~-~~Gi~v~~~------~~~~iRl~~~~~~t~edid~~i~al~~v~~e~  346 (347)
T 1jg8_A          295 VNAHGFIEALR-NSGVLANAV------SDTEIRLVTHKDVSRNDIEEALNIFEKLFRKF  346 (347)
T ss_dssp             SCHHHHHHHHH-HHTEECEEE------ETTEEEEECCTTSCHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHH-HCCCEEECC------CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             31999999999-789989517------98989998899999999999999999999975


No 73 
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic protozoa, SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1
Probab=99.93  E-value=9.3e-24  Score=178.61  Aligned_cols=331  Identities=15%  Similarity=0.148  Sum_probs=207.3

Q ss_pred             CCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHH
Q ss_conf             98334156786788788899999999998087888878888988999999999986488678867078824872789999
Q T0591            38 GRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLA  117 (406)
Q Consensus        38 ~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~  117 (406)
                      +.+.+|..-+  +..++|.+++++.++... ...+|++..-..++|+.|+++    +|.+   .++|++|+|++++...+
T Consensus        13 ~~~~~f~nd~--~~g~hP~v~eA~~~a~~~-~~~~yg~d~~~~~lr~~ia~~----~g~~---~~~v~f~~~Gtean~~a   82 (359)
T 1svv_A           13 PKPYSFVNDY--SVGMHPKILDLMARDNMT-QHAGYGQDSHCAKAARLIGEL----LERP---DADVHFISGGTQTNLIA   82 (359)
T ss_dssp             --CEECSCSC--SSCCCHHHHHHHHHHTTC-CCCSTTCSHHHHHHHHHHHHH----HTCT---TSEEEEESCHHHHHHHH
T ss_pred             CCCCCCCCCC--CCCCCHHHHHHHHHHHCC-CCCCCCCCHHHHHHHHHHHHH----HCCC---CCEEEECCCHHHHHHHH
T ss_conf             8877756667--888899999999988615-677878998999999999998----5999---62599838679999999


Q ss_pred             HHHHHHCCHHHHHHHCCCHHHH--HHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCC------CEEEECCCCCC
Q ss_conf             9999720010101310551389--999982996999860446667766677889999985025------40342156664
Q T0591           118 VAATVARGDKVAIVQPDYFANR--KLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAG------ARVFLFSNPNN  189 (406)
Q Consensus       118 ~~~l~~pGd~Vl~~~P~y~~~~--~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~------~k~i~l~~P~N  189 (406)
                      +.+++.+||.+++..+.+....  ......+.....++..       .+..|++..+++....      ...+++++++|
T Consensus        83 ~~~~~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~  155 (359)
T 1svv_A           83 CSLALRPWEAVIATQLGHISTHETGAIEATGHKVVTAPCP-------DGKLRVADIESALHENRSEHMVIPKLVYISNTT  155 (359)
T ss_dssp             HHHHCCTTEEEEEETTSHHHHSSTTHHHHTTCCEEEECCT-------TSCCCHHHHHHHHHHSCSTTSCEEEEEEEESSC
T ss_pred             HHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCEEEEECCC-------CCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCC
T ss_conf             9972378884222344422442013433355137741144-------444568899997543320467761132101222


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCC-CCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHH
Q ss_conf             32334437899999999863787578417502355688876-52233210267868998504001046311211433258
Q T0591           190 PAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASY-THLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSR  268 (406)
Q Consensus       190 PTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~-~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~  268 (406)
                      ++|.+++.++++++.++|++|++++++|++|....+..... .......   ....+...+++|.+++++  .++.+...
T Consensus       156 ~~g~~~~~~~l~~i~~l~~~~~~~~~~D~a~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~k~~~~~~--~~~~~~~~  230 (359)
T 1svv_A          156 EVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLADIA---RLTDMFYIGATKAGGMFG--EALIILND  230 (359)
T ss_dssp             TTSCCCCHHHHHHHHHHHHHHTCEEEEECTTHHHHHTSTTCCCCHHHHH---HHCSEEEEECTTTTCSSC--EEEEECSG
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEECCCCCCCCCCCC---CCCCEEECCCCCCCCCCC--CCCCCCCC
T ss_conf             3333310677777888876641431120001112661166433322455---454146303555554543--33223441


Q ss_pred             HHHHHHHHHH--HHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCC
Q ss_conf             9999999875--20367612457999999985652589999999999999999999727994553588730787766887
Q T0591           269 AIIARMEKLQ--AIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL  346 (406)
Q Consensus       269 ~~i~~l~~~~--~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~  346 (406)
                      ..........  .......+.....++..++.+  ........+...+++.+.+.|++. |+.+..|..++++|+++++ 
T Consensus       231 ~~~~~~~~~~~~~~~~~~~~~~~~aa~~~~~~~--~~~~~~~~~~~~~a~~l~~~l~~~-g~~~~~p~~~n~v~~~~~~-  306 (359)
T 1svv_A          231 ALKPNARHLIKQRGALMAKGWLLGIQFEVLMKD--NLFFELGAHSNKMAAILKAGLEAC-GIRLAWPSASNQLFPILEN-  306 (359)
T ss_dssp             GGCTTHHHHHHHTTCCCTTTHHHHHHHHHHTST--THHHHHHHHHHHHHHHHHHHHHHT-TCCBSSCCSSSEECBEEEH-
T ss_pred             CCCCHHHHHCCCCCCCCCHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHCC-CCEEECCCCCCEEEEECCH-
T ss_conf             000001200246567633189999999997300--156789999999777788888608-9777369977388785698-


Q ss_pred             CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC--CCHHHHHHHHHHHHHHHH
Q ss_conf             88989999999986891896161026799985899850--997999999999999999
Q T0591           347 AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS--QDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       347 ~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~--~~~e~l~~al~rl~~~~~  402 (406)
                           +.+..|.++..+...+..   ..+.+.+|++++  ++++++++.++.|++++.
T Consensus       307 -----~~~~~l~~~~~~~~i~~~---~~~~~~iR~~~~~~~TeedId~~v~al~~~la  356 (359)
T 1svv_A          307 -----TMIAELNNDFDMYTVEPL---KDGTCIMRLCTSWATEEKECHRFVEVLKRLVA  356 (359)
T ss_dssp             -----HHHHHHTTTEECEEEEEE---TTTEEEEEEECCTTCCHHHHHHHHHHHHHC--
T ss_pred             -----HHHHHHHHHHHHHCCCCC---CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
T ss_conf             -----999999971245073554---79983799988999999999999999999985


No 74 
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum}
Probab=99.93  E-value=9.7e-25  Score=185.28  Aligned_cols=318  Identities=12%  Similarity=0.026  Sum_probs=201.4

Q ss_pred             HHHHHHHHHHHHCCC----CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHH
Q ss_conf             899999999998087----8888788889889999999999864886788670788248727899999999720010101
Q T0591            55 PGAFDLFSAGVQSGG----VQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAI  130 (406)
Q Consensus        55 ~~~~~~~~~~~~~~~----~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~  130 (406)
                      |..++++.+++..-+    ...|+...-..+|.+.+|+|+    |.    ++-|++++| ++++.++++++++|||+|++
T Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~yg~~p~v~~lE~~~A~~~----G~----e~al~~~SG-t~An~~Al~al~~~Gd~viV   91 (357)
T 3lws_A           21 KRNVGVLKTAFAAVADEMASDQYGTGAIIEPFEQKFADVL----GM----DDAVFFPSG-TMAQQVALRIWSDETDNRTV   91 (357)
T ss_dssp             CCBHHHHHHHHTTSCTTCBCEETTEETTHHHHHHHHHHHH----TC----SEEEEESCH-HHHHHHHHHHHHHHHTCCEE
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHH----CC----CCEEEECCH-HHHHHHHHHHHHCCCCEEEE
T ss_conf             7789999999998547767883689989999999999986----99----969993289-99999999998289984899


Q ss_pred             HHCCCHHHH-----HHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCC-CCCHHHHHHHH
Q ss_conf             310551389-----999982996999860446667766677889999985025403421566643233-44378999999
Q T0591           131 VQPDYFANR-----KLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGV-VYSAEEIGQIA  204 (406)
Q Consensus       131 ~~P~y~~~~-----~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~-~~s~~~l~~i~  204 (406)
                      ..+.|....     ......+.....++..       ....+.+  .....+++|++++++|+||+|. +++.+++++|.
T Consensus        92 ~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~--~~~~~~~~~~v~~~~~~~~~g~~~~~~~~l~~i~  162 (357)
T 3lws_A           92 AYHPLCHLEIHEQDGLKELHPIETILVGAA-------DRLMTLD--EIKALPDIACLLLELPQREIGGVAPAFSELETIS  162 (357)
T ss_dssp             EECTTCHHHHSSTTHHHHHSSCEEEECSCT-------TSCCCHH--HHHTCCSCSEEEEESSBGGGTSBCCCHHHHHHHH
T ss_pred             EECCCHHHHHHHHCCHHHCCCEEEEEECCC-------CCHHHHH--HHCCCCCCEEEEEEEEECCCCCCCCCHHHHHHHH
T ss_conf             855504799985000553366058863033-------3223344--3014886316999801026787154399999988


Q ss_pred             HHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99863787578417502355688876522332102678689985040010463112114332589999999875203676
Q T0591           205 ALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLR  284 (406)
Q Consensus       205 ~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~  284 (406)
                      ++|++|++++++|++|....+..........    .....++..|++|.++..+  .++++++.+++..++..+.....+
T Consensus       163 ~~a~~~~~~li~D~a~~~g~~~~~~~~~~~~----~~~~d~~~~~~~k~~~~~~--g~~~~~~~~~~~~~~~~~~~~g~~  236 (357)
T 3lws_A          163 RYCRERGIRLHLDGARLFEMLPYYEKTAAEI----AGLFDSIYISFYKGLGGIA--GAILAGPAAFCQTARIWKRRYGGD  236 (357)
T ss_dssp             HHHHHTTCEEEEEETTHHHHHHHHTCCHHHH----HTTSSEEEEESSSTTCCSS--CEEEEECHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHCCCCEEECCHHHCCCCCCCCCCCHHC----CCCCEEEEEECCCCCCCCC--EEEEECCHHHHHHHHHHHHHHCCC
T ss_conf             8776549731322211046532345560002----4444069985047755565--399980489999999999982886


Q ss_pred             HHHH-HHHH-HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC-CCEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             1245-7999-999985652589999999999999999999727994553588-730787766887889899999999868
Q T0591           285 AAGY-SQAV-LRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ-AGSYLFPRLPKLAVAPAEFVKILRLQA  361 (406)
Q Consensus       285 ~~~~-~q~a-~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~-gg~~~w~~~~~~~~~~~~~~~~Ll~~~  361 (406)
                      .... .+.+ ....++    ...+....++++++.+.+.|.+++|+.+..+. ++.++|+.++....+..++..++++++
T Consensus       237 ~~~~~~~~a~~~~~~~----~~~~~~~~~~~~a~~la~~L~~~~gv~~~~~~~~t~~v~~~~~~~~~~~~~~l~~~L~~~  312 (357)
T 3lws_A          237 LISLYPYIVSADYYYE----LRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISPKLEQVQEET  312 (357)
T ss_dssp             CSCCHHHHHHHHHHHH----HHTTCHHHHHHHHHHHHHHHHTSTTEEEESSSCSSSEEEEEEESCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCEEEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             5677999999998988----515777799999999999886479854067999862899994795688999999999849


Q ss_pred             CEEEEECCCCCCCCCCEEEEEEC-----CCHHHHHHHHHHHHHHH
Q ss_conf             91896161026799985899850-----99799999999999999
Q T0591           362 GVVVTPGTEFSPHTADSVRLNFS-----QDHEAAVAAARRIVTLV  401 (406)
Q Consensus       362 gV~v~pG~~Fg~~~~~~iRis~~-----~~~e~l~~al~rl~~~~  401 (406)
                      ||.+.|+... +.+...+|+++.     .+.+++.++++||++++
T Consensus       313 GI~~~~~~~~-~~~~~~~r~~v~~~~~~~~~e~~~~a~~rl~~a~  356 (357)
T 3lws_A          313 GLGFVGYLVD-KDGYCSTEISVGDAYGELDQQTRDAGFARLRQAF  356 (357)
T ss_dssp             CEESCSCCEE-CSSEEEEEEEBCTTGGGSCHHHHHHHHHHHHHHC
T ss_pred             CEEEECCCCC-CCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9899653689-9977999996165345667999999999999963


No 75 
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B*
Probab=99.92  E-value=4.7e-23  Score=173.84  Aligned_cols=338  Identities=16%  Similarity=0.151  Sum_probs=206.2

Q ss_pred             HHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC-CC-C----------HHHHHHHHHHHHHHCCCCCC
Q ss_conf             630378983341567867887888999999999980878888788-88-9----------88999999999986488678
Q T0591            32 RGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEY-RG-D----------LGIRDLLAPRLAAFTGAPVD   99 (406)
Q Consensus        32 ~~~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~-~G-~----------~~Lr~aia~~~~~~~g~~~~   99 (406)
                      ...+.-.-||=|.....-  ++++.+++++.+.+....  .|+++ .| +          .+.|+.+|++    .|.  +
T Consensus        15 ~~~~~~~~pIYlD~aatt--~~~~~V~~~~~~~l~~~~--~~gNp~s~~h~~~~~a~~~~e~aR~~iA~~----lga--~   84 (423)
T 3lvm_A           15 GVYRAMKLPIYLDYSATT--PVDPRVAEKMMQFMTMDG--TFGNPASRSHRFGWQAEEAVDIARNQIADL----VGA--D   84 (423)
T ss_dssp             -----CCSSEECBTTTCC--CCCHHHHHHHTTSSSTTS--CCSCTTCTTSHHHHHHHHHHHHHHHHHHHH----HTC--C
T ss_pred             HHHHHCCCCEEEECCCCC--CCCHHHHHHHHHHHHHCC--CCCCCCHHHHHHHHHHHHHHHHHHHHHHHH----HCC--C
T ss_conf             013324887881473347--899999999999998647--756874045099999999999999999998----199--9


Q ss_pred             CCCEEEEECCCCHHHHHHHHHH----HHCCHHHHHHHCCCHHHHHHHH---HHCCEEEEEEECCCCCCCCCCCCCHHHHH
Q ss_conf             8670788248727899999999----7200101013105513899999---82996999860446667766677889999
Q T0591           100 ARDGLIITPGTQGALFLAVAAT----VARGDKVAIVQPDYFANRKLVE---FFEGEMVPVQLDYVSADETRAGLDLTGLE  172 (406)
Q Consensus       100 ~~~~I~it~G~~~~l~~~~~~l----~~pGd~Vl~~~P~y~~~~~~~~---~~g~~~v~v~~~~~~~~~~~~~~d~~~l~  172 (406)
                      + ++|++|+|+|+++++++..+    ..+||+|++..+.|++....+.   ..|+++..++.+      .+..+|+++++
T Consensus        85 ~-~eI~ft~~~Tealn~~~~~~~~~~~~~gd~vi~~~~eh~s~~~~~~~l~~~G~~v~~v~~~------~~g~id~~~l~  157 (423)
T 3lvm_A           85 P-REIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQ------RNGIIDLKELE  157 (423)
T ss_dssp             G-GGEEEESSHHHHHHHHHHHHHHHHTTTCCEEEEETTSCHHHHHHHHHHHHTTCEEEEECCC------TTSCCCHHHHH
T ss_pred             C-CCEEEECCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCC------CCCEECHHHHH
T ss_conf             7-8199979879999999986467426899989995573115799999999779789997789------99808899999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCH
Q ss_conf             98502540342156664323344378999999998637875784175023556888765223321026786899850400
Q T0591           173 EAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSK  252 (406)
Q Consensus       173 ~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK  252 (406)
                      ++++++||+++++.+||+||.+.+   +++|.++|+++|+++++|.++..    +..+..+...   ..  -+++.|..|
T Consensus       158 ~~i~~~T~lv~~~~~sn~tG~i~p---i~~I~~~~~~~g~~~~vDa~q~~----g~~~id~~~~---~~--D~~~~s~hK  225 (423)
T 3lvm_A          158 AAMRDDTILVSIMHVNNEIGVVQD---IAAIGEMCRARGIIYHVDATQSV----GKLPIDLSQL---KV--DLMSFSGHK  225 (423)
T ss_dssp             HHCCTTEEEEECCSBCTTTCBBCC---HHHHHHHHHHHTCEEEEECTTTT----TTSCCCTTTS---CC--SEEEEESTT
T ss_pred             HHCCCCCEEEEEECCCCCCCCCCC---HHHHHHHHHHCCCEEEEECCCCC----CCCCCCCCCC---CC--CCCCCCCCE
T ss_conf             757999679999789888720069---99999998553987997354244----8735320101---14--411002300


Q ss_pred             HCCCCCCCCHHHHHHHHHHHHHHHHH------HHCCCCH-HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             10463112114332589999999875------2036761-2457999999985652589999999999999999999727
Q T0591           253 TESLSGYRLGVAFGSRAIIARMEKLQ------AIVSLRA-AGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGC  325 (406)
Q Consensus       253 ~~~~~GlRiG~~~~~~~~i~~l~~~~------~~~~~~~-~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~  325 (406)
                      .+|.+|  +|+++..++....+....      .....+. ......++...+............+....++.+.+.|.+.
T Consensus       226 ~~Gp~G--~G~l~v~~~~~~~~~p~~~gg~~~~~~~~g~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~L~~~  303 (423)
T 3lvm_A          226 IYGPKG--IGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDI  303 (423)
T ss_dssp             TTSCSS--CEEEEECBTTBCCCCCSSCSSCTTTTTCCSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ECCCCC--CEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             137897--089998364102577753488886776579854678988999999999878999999999999999874115


Q ss_pred             CCCEEECCC--CC-EEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC-----------------CCCEEEEEEC-
Q ss_conf             994553588--73-07877668878898999999998689189616102679-----------------9985899850-
Q T0591           326 EGVFARTPQ--AG-SYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH-----------------TADSVRLNFS-  384 (406)
Q Consensus       326 ~g~~~~~p~--gg-~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~-----------------~~~~iRis~~-  384 (406)
                      .........  .. .-+-+.++  ...+..+.   ....++.+..|+.+...                 ..+.||+|++ 
T Consensus       304 ~~~~~~~~~~~~~~~i~~~~~~--~~~~~~~~---~~~~~i~v~~g~~c~~~~~~~~~vl~~~G~~~~~~~g~vRiS~~~  378 (423)
T 3lvm_A          304 EEVYLNGDLEHGAPNILNVSFN--YVEGESLI---MALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGR  378 (423)
T ss_dssp             TTEEEESCSTTBCTTEEEEEET--TSCHHHHH---HHTTTEECBCCCC-----CCCCHHHHHHTCCHHHHHTEEEEECCT
T ss_pred             CCCCCCCCCCCCCCCEEEEECC--CCCHHHHH---HHHCCCEEECCHHHCCCCCCHHHHHHHCCCCCCCCCCEEEEECCC
T ss_conf             6633368734578718999748--99879999---872898898050113886650499997399833369889996689


Q ss_pred             -CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             -997999999999999999856
Q T0591           385 -QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       385 -~~~e~l~~al~rl~~~~~~~r  405 (406)
                       +++|+++..++.|+++++++|
T Consensus       379 ~nT~edId~~i~aL~~~v~~lr  400 (423)
T 3lvm_A          379 FTTEEEIDYTIELVRKSIGRLR  400 (423)
T ss_dssp             TCCHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999999999999998


No 76 
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1
Probab=99.92  E-value=1.6e-22  Score=170.30  Aligned_cols=338  Identities=14%  Similarity=0.094  Sum_probs=205.1

Q ss_pred             CCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             89833415678678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            37 EGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      .+..+||+.-+  ...++|.+++++.++.. +...+|++.    ++.+++.+++.+.+|.+    .++++|+|++++...
T Consensus         6 ~~~~~~f~sdn--~~~~~P~Vi~A~~~~~~-~~~~~yg~~----~~~~~l~~~la~~~g~~----~~~~ft~sGteAn~~   74 (356)
T 1v72_A            6 RPPALGFSSDN--IAGASPEVAQALVKHSS-GQAGPYGTD----ELTAQVKRKFCEIFERD----VEVFLVPTGTAANAL   74 (356)
T ss_dssp             CCCCCBCSCGG--GCCCCHHHHHHHHHTTS-SCCCSTTCS----HHHHHHHHHHHHHHTSC----CEEEEESCHHHHHHH
T ss_pred             CCCEEECCCCC--CCCCCHHHHHHHHHHHC-CCCCCCCCC----HHHHHHHHHHHHHHCCC----CEEEECCCHHHHHHH
T ss_conf             98700010688--87779999999999866-487766889----99999999999876999----679989949999999


Q ss_pred             HHHHHHHCCHHHHHHHCCCHHHH---HHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCC------CEE-EECCC
Q ss_conf             99999720010101310551389---999982996999860446667766677889999985025------403-42156
Q T0591           117 AVAATVARGDKVAIVQPDYFANR---KLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAG------ARV-FLFSN  186 (406)
Q Consensus       117 ~~~~l~~pGd~Vl~~~P~y~~~~---~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~------~k~-i~l~~  186 (406)
                      ++.+++.+|+.+++..+.+..+.   ......+.....+...      .....+++.++......      +.. ++.+.
T Consensus        75 ai~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~  148 (356)
T 1v72_A           75 CLSAMTPPWGNIYCHPASHINNDECGAPEFFSNGAKLMTVDG------PAAKLDIVRLRERTREKVGDVHTTQPACVSIT  148 (356)
T ss_dssp             HHHTSCCTTEEEEECTTSHHHHSSTTHHHHHTTSCEEEECCC------GGGCCCHHHHHHHTTSSTTCTTSCEEEEEEEE
T ss_pred             HHHHHHHCCCCCCCCCCCCEEEECCHHHHHHCCCEEECCCCC------CCCCCCHHHHHHHHCCCCCCCCCCCCEEEECC
T ss_conf             999998538865435544237521122322122001012466------43446677753232012323345441343111


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHH
Q ss_conf             66432334437899999999863787578417502355688876522332102678689985040010463112114332
Q T0591           187 PNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFG  266 (406)
Q Consensus       187 P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~  266 (406)
                      .+|+++.+.+.++++++.++|++||+++++|++|..+.+............ . ......+.+..|..+.+  ..++...
T Consensus       149 ~~~~~~~~~~~~~~~~i~~~~~~~g~~~~~D~a~~~~~~~~~~~~~~~~~~-~-~~~~~~~~~~~~~~~~~--~~~~~~~  224 (356)
T 1v72_A          149 QATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEMTW-K-AGVDALSFGATKNGVLA--AEAIVLF  224 (356)
T ss_dssp             SSCTTSCCCCHHHHHHHHHHHHHTTCEEEEEETTHHHHHHHHTCCTTTTTG-G-GTCCEEEECCGGGTCSS--CEEEEES
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC-C-CCCCCEEECCCCCCCCC--CCCCCCC
T ss_conf             221123214478765456677765477764010000102332345432113-4-45320230456565314--6654322


Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCC
Q ss_conf             58999999987520367612457999999985652589999999999999999999727994553588730787766887
Q T0591           267 SRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL  346 (406)
Q Consensus       267 ~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~  346 (406)
                      .........................++....................+++.+.+.+.+++|+.+..|..++++|+++++ 
T Consensus       225 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~v~~~~~~-  303 (356)
T 1v72_A          225 NTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDS-  303 (356)
T ss_dssp             SGGGHHHHHHHHHHTTCCCSSTHHHHHHHHHHTSTTHHHHHHHHHHHHHHHHHHHHTTCTTEEEESCCCSSEEEEEECH-
T ss_pred             CHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCH-
T ss_conf             0676654220134544554411777766677777666543022101367888988763499176058974089998599-


Q ss_pred             CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC--CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             88989999999986891896161026799985899850--9979999999999999998569
Q T0591           347 AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS--QDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       347 ~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~--~~~e~l~~al~rl~~~~~~~ra  406 (406)
                           ++++.|+ +.|+.+.++    +.+++++|+++.  +++|++++.++.|+++++++|+
T Consensus       304 -----~~~~~L~-~~Gi~v~~~----~~~~~~iR~~~~~~~t~edId~~l~~lk~~~~~~~~  355 (356)
T 1v72_A          304 -----AMIDALL-KAGFGFYHD----RWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQE  355 (356)
T ss_dssp             -----HHHHHHH-HTTCBCBCS----SSSTTEEEEECCTTCCHHHHHHHHHHHHHTC-----
T ss_pred             -----HHHHHHH-HCCCCCCCC----CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             -----9999999-779973133----789997999899989899999999999999999847


No 77 
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, coenzyme A, transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4
Probab=99.91  E-value=2.8e-22  Score=168.60  Aligned_cols=342  Identities=15%  Similarity=0.101  Sum_probs=208.4

Q ss_pred             CCC-CEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC---CCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCH
Q ss_conf             898-3341567867887888999999999980878888788---889889999999999864886788670788248727
Q T0591            37 EGR-PVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEY---RGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQG  112 (406)
Q Consensus        37 ~~~-~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~---~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~  112 (406)
                      +|+ .|||+.-++=....+|++++++.+++.+.+ ++|+.+   .|..+..+++++.+...+|.     +.+++++++++
T Consensus        43 dG~~~iDf~s~~~LG~~~hP~V~~A~~~~l~~~~-~~~~~sr~~~g~~~~~~~le~~la~~~g~-----~~~~~~~sGt~  116 (401)
T 1fc4_A           43 DGSHVINFCANNYLGLANHPDLIAAAKAGMDSHG-FGMASVRFICGTQDSHKELEQKLAAFLGM-----EDAILYSSCFD  116 (401)
T ss_dssp             TSCEEEECCCSCTTSCTTCHHHHHHHHHHHHHHC-SCCCSCHHHHCCBHHHHHHHHHHHHHHTC-----SEEEEESCHHH
T ss_pred             CCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHC-CCCCCCCCCCCCHHHHHHHHHHHHHHHCC-----CEEEEECCHHH
T ss_conf             9989999614686556599999999999999719-77676453558809999999999888699-----86999688999


Q ss_pred             HHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHH---CCCCEEEECCCCCC
Q ss_conf             899999999720010101310551389999982996999860446667766677889999985---02540342156664
Q T0591           113 ALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAF---KAGARVFLFSNPNN  189 (406)
Q Consensus       113 ~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~---~~~~k~i~l~~P~N  189 (406)
                      ++..+++++..+||.|+++.++|..+.......+.+...++.           .|++.+++.+   ........+..+.|
T Consensus       117 A~~~~~~~~~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~-----------~d~~~~~~~l~~~~~~~~~~~~~~~~~  185 (401)
T 1fc4_A          117 ANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYAN-----------NDMQELEARLKEAREAGARHVLIATDG  185 (401)
T ss_dssp             HHHTTHHHHCCTTCEEEEETTCCHHHHHHHHTSCSEEEEECT-----------TCHHHHHHHHHHHHHTTCSSEEEEEES
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCC-----------CCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             999999984489988997687407899999862897534214-----------877889999875454135146775126


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCC-CCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHH
Q ss_conf             323344378999999998637875784175023556-8887652233210267868998504001046311211433258
Q T0591           190 PAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRY-AGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSR  268 (406)
Q Consensus       190 PTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~-~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~  268 (406)
                      |+|...+...+++++++|+++|+++|+||++....+ .+..... .. ....++..++..+++|.++.++  .|++..+.
T Consensus       186 ~~~~~~~~~~~~~~~~~~~~~g~~li~Dd~~~~g~~~~g~~~~~-~~-~~~~~~~~~i~~~~~~~~~~~~--g~~i~~~~  261 (401)
T 1fc4_A          186 VFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSH-EY-CDVMGRVDIITGTLGKALGGAS--GGYTAARK  261 (401)
T ss_dssp             EETTTTEECCHHHHHHHHHHTTEEEEEECTTTTTTSSTTSCCHH-HH-TTCTTCCSEEEEESSSTTCSSS--CEEEEECH
T ss_pred             CCCCCCCCCCHHHHHHHHHHHCCEEEEECHHHCCCCCCCCCCCH-HH-CCCCCCCEEEEECCCCCCCCCC--EEEEECHH
T ss_conf             66775755408899999998398899734232394557874300-10-2665641178503445567663--02774137


Q ss_pred             HHHHHHHHHHH--HCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCC
Q ss_conf             99999998752--0367612457999999985652589999999999999999999727994553588730787766887
Q T0591           269 AIIARMEKLQA--IVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL  346 (406)
Q Consensus       269 ~~i~~l~~~~~--~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~  346 (406)
                      ...+.......  ..+...+.....++...++.. ....+..+..++.++.+.+.+... |+....+ .+.++++.+++ 
T Consensus       262 ~~~~~~~~~~~~~~~~~~~~~~a~~aa~~~~~~l-~~~~~~~~~~~~~~~~l~~~~~~~-g~~~~~~-~~~~~~i~~~d-  337 (401)
T 1fc4_A          262 EVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMV-EAGSELRDRLWANARQFREQMSAA-GFTLAGA-DHAIIPVMLGD-  337 (401)
T ss_dssp             HHHHHHHHHCHHHHHSCCCCHHHHHHHHHHHHHH-HTCHHHHHHHHHHHHHHHHHHHHT-TCCBCCS-SSSEEEEEEEC-
T ss_pred             HHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHCC-CCCCCCC-CCCEEEEEECC-
T ss_conf             7888743122234678750589999999999767-668999999999999999750506-9622689-98789999598-


Q ss_pred             CCCHHHHHHHHHHHCCEEEEECCCC-CCCCCCEEEEEEC--CCHHHHHHHHHHHHHHHHHH
Q ss_conf             8898999999998689189616102-6799985899850--99799999999999999985
Q T0591           347 AVAPAEFVKILRLQAGVVVTPGTEF-SPHTADSVRLNFS--QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       347 ~~~~~~~~~~Ll~~~gV~v~pG~~F-g~~~~~~iRis~~--~~~e~l~~al~rl~~~~~~~  404 (406)
                      ..+..++++.|+ ++||.+.|.... .+.+.+.+|++++  .++|+++.+++.|+++++++
T Consensus       338 ~~~a~~l~~~l~-e~Gv~v~~~~~p~v~~g~~~iR~~~~~~~T~edid~~~~al~~v~~el  397 (401)
T 1fc4_A          338 AVVAQKFARELQ-KEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQL  397 (401)
T ss_dssp             HHHHHHHHHHHH-HTTEECCEECTTSSCTTCEEEEEECCTTCCHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHH-HCCCEEEEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             789999999999-789789766798778998359997488899999999999999999985


No 78 
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum}
Probab=99.91  E-value=8e-24  Score=179.07  Aligned_cols=306  Identities=13%  Similarity=0.114  Sum_probs=191.4

Q ss_pred             HHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH-HHCCHHHHHHHCCCHHH
Q ss_conf             99999980878888788889889999999999864886788670788248727899999999-72001010131055138
Q T0591            60 LFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT-VARGDKVAIVQPDYFAN  138 (406)
Q Consensus        60 ~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l-~~pGd~Vl~~~P~y~~~  138 (406)
                      .+.+.+.+ +.+.++|  -..+|++.+|+++    |.    + ++++++++++|+.++++++ ++|||+|+++.++|+.+
T Consensus        22 ~~~~~~~~-~~~~~G~--~~~~lE~~lA~~~----g~----~-~~i~~~sGt~Al~~al~al~~~~Gd~Vi~~~~~~~~~   89 (373)
T 3frk_A           22 KFEEIYKR-NWFILGD--EDKKFEQEFADYC----NV----N-YCIGCGNGLDALHLILKGYDIGFGDEVIVPSNTFIAT   89 (373)
T ss_dssp             HHHHHHHH-TCCSSSH--HHHHHHHHHHHHH----TS----S-EEEEESCHHHHHHHHHHHTTCCTTCEEEEETTSCTHH
T ss_pred             HHHHHHHC-CCCCCCH--HHHHHHHHHHHHH----CC----C-EEEEECCHHHHHHHHHHHHCCCCCCEEEECCCCCHHH
T ss_conf             99999975-9951498--9999999999986----95----9-7999567999999999981789999899489722889


Q ss_pred             HHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECC
Q ss_conf             99999829969998604466677666778899999850254034215666432334437899999999863787578417
Q T0591           139 RKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQ  218 (406)
Q Consensus       139 ~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De  218 (406)
                      ...+...|++++.++++.     ..+.+|++.++++++++++++++   .|++|...+   +++|.++|+++|+++|+|+
T Consensus        90 ~~a~~~~G~~~~~~~v~~-----~~~~~d~~~le~~i~~~t~~v~~---~~~~G~~~d---l~~l~~ia~~~gi~li~D~  158 (373)
T 3frk_A           90 ALAVSYTGAKPIFVEPDI-----RTYNIDPSLIESAITEKTKAIIA---VHLYGQPAD---MDEIKRIAKKYNLKLIEDA  158 (373)
T ss_dssp             HHHHHHHSCEEEEECEET-----TTTEECGGGTGGGCCTTEEEEEE---ECCTTCCCC---HHHHHHHHHHHTCEEEEEC
T ss_pred             HHHHHHCCCEEEEEEECC-----CCCCCCHHHHHHHCCCCCEEEEC---CCCCCCCCC---HHHHHHHHHHCCCEEEEEC
T ss_conf             999998699899975268-----86778999997543678447732---555466667---9999999997298799976


Q ss_pred             CCCCCCC-CCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCC----------CC--H
Q ss_conf             5023556-888765223321026786899850400104631121143325899999998752036----------76--1
Q T0591           219 LYSRLRY-AGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVS----------LR--A  285 (406)
Q Consensus       219 ~Y~~l~~-~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~----------~~--~  285 (406)
                      +|+.-.. .+..     .  ....+..++..+.+|.++.+|..-++++.++++++.++.++....          .+  .
T Consensus       159 a~a~g~~~~~~~-----~--~~~~d~~~~s~~~~K~~~~~g~gG~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~  231 (373)
T 3frk_A          159 AQAHGSLYKGMK-----V--GSLGDAAGFSFYPAKNLGSLGDGGAVVTNDKDLAEKIKALSNYGSEKKYHHIYKGFNSRL  231 (373)
T ss_dssp             TTCTTCEETTEE-----T--TSSSSEEEEECCTTSSSCCSSSCEEEEESCHHHHHHHHHHHBTTCSBTTBCCSCCCBCCC
T ss_pred             HHHHCCCCCCCC-----C--CCCCCEEEEECCCCEEECCCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCEECCCCCCCC
T ss_conf             012036258810-----1--356647999655984877777726998376999999999852688876322014767786


Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEE
Q ss_conf             24579999999856525899999999999999999997279945535887307877668878898999999998689189
Q T0591           286 AGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVV  365 (406)
Q Consensus       286 ~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v  365 (406)
                      +..........++    .+.+..++.+++.+++.+.|.+..+.....+++....|..++-...+..++.+.| +++||.+
T Consensus       232 ~~~~aa~~~~~L~----~~~~~~~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~L-~~~gI~~  306 (373)
T 3frk_A          232 DELQAGFLRVKLK----YLDKWNEERRKIAQKYIAGINNPNVIIPVEADYAKHVWYTFVIRSEKRDELQKYL-NNNGIGT  306 (373)
T ss_dssp             CHHHHHHHHHHHH----THHHHHHHHHHHHHHHHHHCCCTTEECCCCCTTEECCCSSEEEEESSHHHHHHHH-HHTTBCC
T ss_pred             CHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHH-HHCCCCE
T ss_conf             7899999999998----7999999999999999985768992236779988434589872365899999999-9679988


Q ss_pred             EECCC--------C---CCC-C---------CCEEEEEEC--CCHHHHHHHHHHHHHH
Q ss_conf             61610--------2---679-9---------985899850--9979999999999999
Q T0591           366 TPGTE--------F---SPH-T---------ADSVRLNFS--QDHEAAVAAARRIVTL  400 (406)
Q Consensus       366 ~pG~~--------F---g~~-~---------~~~iRis~~--~~~e~l~~al~rl~~~  400 (406)
                      .++..        |   +.. +         .+.+||.+.  .++|+++..++.|+++
T Consensus       307 ~~~~~~~~~~~~~~~~~~~~~~~~~~a~~l~~~~l~LP~~~~lt~edid~iie~i~~~  364 (373)
T 3frk_A          307 LIHYPIPIHLQQAYKDLGFKTGNFPIAEKIANEILSIPIWYGMKNEEIEYVIDKINAW  364 (373)
T ss_dssp             BCSCSSCGGGSGGGGGGCCCTTSSHHHHHHHHHEEEECCCTTCCHHHHHHHHHHHHTC
T ss_pred             EEECCCCCCCCHHHHHCCCCCCCCHHHHHHHHCEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             6206875210756674599889987899998374982489999999999999999999


No 79 
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2
Probab=99.91  E-value=6.7e-21  Score=159.25  Aligned_cols=332  Identities=17%  Similarity=0.160  Sum_probs=208.0

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHC---
Q ss_conf             99999999980878888788889889999999999864886788670788248727899999999720010101310---
Q T0591            57 AFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQP---  133 (406)
Q Consensus        57 ~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P---  133 (406)
                      ..+++..++.. +...|+...+..+|++++++++    |.     +.++++++++++...++.+++++||.+++..+   
T Consensus        57 ~~~~~~a~~~~-gd~~y~~~~~~~~l~~~~a~~~----g~-----e~~~~~~sG~~A~~~a~~~~~~~~~~~~~~~~~~i  126 (467)
T 1ax4_A           57 MSDHQWAAMIT-GDEAYAGSRNYYDLKDKAKELF----NY-----DYIIPAHQGRGAENILFPVLLKYKQKEGKAKNPVF  126 (467)
T ss_dssp             EEHHHHHHHHT-CCCCSSSCHHHHHHHHHHHHHH----CC-----CEEEEESSHHHHHHHHHHHHHHHHHHTTCCSSCEE
T ss_pred             HHHHHHHHHHC-CCCCCCCCCHHHHHHHHHHHHH----CC-----CEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             68999997621-5642267823999999999997----99-----96998998599999999999975676089987489


Q ss_pred             ----CCHHHHHHHHHHCCEEEEEEECCC----CCCCCCCCCCHHHHHHHHCCC----CEEEECCCCCCCC-CCCCCHHHH
Q ss_conf             ----551389999982996999860446----667766677889999985025----4034215666432-334437899
Q T0591           134 ----DYFANRKLVEFFEGEMVPVQLDYV----SADETRAGLDLTGLEEAFKAG----ARVFLFSNPNNPA-GVVYSAEEI  200 (406)
Q Consensus       134 ----~y~~~~~~~~~~g~~~v~v~~~~~----~~~~~~~~~d~~~l~~~~~~~----~k~i~l~~P~NPT-G~~~s~~~l  200 (406)
                          .|.++...+...|+..+.++....    ..+...+.+|+++|++++++.    +.++++++++|.. |.+++.+++
T Consensus       127 ~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~d~~~l~~~i~~~~~~~~~~~~~~~~~~~~g~~~~~~~~l  206 (467)
T 1ax4_A          127 ISNFHFDTTAAHVELNGCKAINIVTEKAFDSETYDDWKGDFDIKKLKENIAQHGADNIVAIVSTVTCNSAGGQPVSMSNL  206 (467)
T ss_dssp             EESSCCHHHHHHHHHTTCEEEECBCGGGGCTTSCCTTTTCBCHHHHHHHHHHHCGGGEEEEEEESSBTTTTSBCCCHHHH
T ss_pred             ECCCCCCCHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEECCCCCCCEECCCHHHH
T ss_conf             54776542179998669803214345556776678877771999999998644876177887305536662353899999


Q ss_pred             HHHHHHHHHCCCEEEECCCCCC--CCCC--------CCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHH--
Q ss_conf             9999998637875784175023--5568--------887652233210267868998504001046311211433258--
Q T0591           201 GQIAALAARYGATVIADQLYSR--LRYA--------GASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSR--  268 (406)
Q Consensus       201 ~~i~~~a~~~~~~ii~De~Y~~--l~~~--------~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~--  268 (406)
                      ++|.++|++||+++++|+++..  ..+.        +..............+  ++..|++|..+.+|  .|+++.+.  
T Consensus       207 ~~i~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d--~~t~s~~K~~~~~~--gg~l~~~~~~  282 (467)
T 1ax4_A          207 KEVYEIAKQHGIFVVMDSARFCENAYFIKARDPKYKNATIKEVIFDMYKYAD--ALTMSAKKDPLLNI--GGLVAIRDNE  282 (467)
T ss_dssp             HHHHHHHHHHTCCEEEECTTHHHHHHHHHHHCGGGTTCCHHHHHHHHGGGCS--EEEEETTSTTCCSS--CEEEEESSCH
T ss_pred             HHHHHHHHHCCCEEEEECCCHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCC--EEEEECCCCCCCCC--CEEEECCCHH
T ss_conf             9999999983999999654255424212456710047743023333225577--58995446777787--5078607618


Q ss_pred             HHHHHHHHHHHH--CC---CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEEC
Q ss_conf             999999987520--36---7612457999999985652589999999999999999999727994553588730787766
Q T0591           269 AIIARMEKLQAI--VS---LRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRL  343 (406)
Q Consensus       269 ~~i~~l~~~~~~--~~---~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~  343 (406)
                      ++.+........  ..   .+.......++...+...  ..++...+...+.+.+.+.|.+. +..+..|.++++++++.
T Consensus       283 ~~~~~~~~~~~~~~~~~~~~~~~~~a~~a~~~~l~e~--~~~~~~~~r~~~~~~L~~~L~~~-g~~~~~~~g~~~~~~d~  359 (467)
T 1ax4_A          283 EIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEG--TEEEYLHYRIGQVKYLGDRLREA-GIPIQYPTGGHAVFVDC  359 (467)
T ss_dssp             HHHHHHHHHHHHHTCSTTTTTCCHHHHHHHHHHHHHT--TCHHHHHHHHHHHHHHHHHHHHT-TCCBCSSCCSSEEEEES
T ss_pred             HHHHHHHCCCCCEECCCCCCCHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCCEEEECH
T ss_conf             8998753246622157766317899999999986998--76999999999999999999866-99714467763146423


Q ss_pred             CCC-------CCCHHHHHHHHHHHCCEEEEECCCCC----C-------CCCCEEEEEEC---CCHHHHHHHHHHHHHHHH
Q ss_conf             887-------88989999999986891896161026----7-------99985899850---997999999999999999
Q T0591           344 PKL-------AVAPAEFVKILRLQAGVVVTPGTEFS----P-------HTADSVRLNFS---QDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       344 ~~~-------~~~~~~~~~~Ll~~~gV~v~pG~~Fg----~-------~~~~~iRis~~---~~~e~l~~al~rl~~~~~  402 (406)
                      ...       .....+++..|+.+.||.+.++..+.    .       ...+.+|+++-   .+.|+++..++.|.++.+
T Consensus       360 ~~~~~~~~~~~~~~~~~~~~Ll~~~GV~~~~~~~~~~~~~~~~g~~~~~~~~~vRlalP~~~~T~e~iD~v~eal~~i~e  439 (467)
T 1ax4_A          360 KKLVPQIPGDQFPAQAVINALYLESGVRAVEIGSFLLGRDPATGEQKHADMEFMRLTIARRVYTNDHMDYIADALIGLKE  439 (467)
T ss_dssp             TTTCTTSCGGGCHHHHHHHHHHHHHCEECEEESHHHHCBCTTTCSBCCCSCCEEEEECCTTSSCHHHHHHHHHHHHTTHH
T ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             34257876545424789999998629078506400345677788756676671588558899999999999999999999


Q ss_pred             HHC
Q ss_conf             856
Q T0591           403 RYR  405 (406)
Q Consensus       403 ~~r  405 (406)
                      +.+
T Consensus       440 ~~~  442 (467)
T 1ax4_A          440 KFA  442 (467)
T ss_dssp             HHT
T ss_pred             HHH
T ss_conf             998


No 80 
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain closure; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 1tpl_A 2tpl_A* 1c7g_A*
Probab=99.90  E-value=7.5e-21  Score=158.93  Aligned_cols=329  Identities=17%  Similarity=0.116  Sum_probs=210.8

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHH
Q ss_conf             99999999808788887888898899999999998648867886707882487278999999997200101013105513
Q T0591            58 FDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFA  137 (406)
Q Consensus        58 ~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~  137 (406)
                      .+++.+++.. +...|+.......|.+.+++++    |.     +.++.+++++.+..++++++++|||.|++.. .|..
T Consensus        57 ~~~~~aa~~~-GDd~Y~~dpt~~~Le~~va~l~----G~-----e~al~~~sGt~An~~a~~~l~~~gd~Vi~~~-~f~~  125 (456)
T 2ez2_A           57 SDKQWAGMMM-GDEAYAGSENFYHLERTVQELF----GF-----KHIVPTHQGRGAENLLSQLAIKPGQYVAGNM-YFTT  125 (456)
T ss_dssp             CHHHHHHHTT-CCCCSSSCHHHHHHHHHHHHHH----CC-----SEEEEESSHHHHHHHHHHHHCCTTCEEEESS-CCHH
T ss_pred             CHHHHHHHHC-CCCCCCCCCCHHHHHHHHHHHH----CC-----CEEEECCCHHHHHHHHHHHHCCCCCEECCCC-CHHH
T ss_conf             6989999871-7843068952999999999986----99-----8699899879999999998258997772672-5588


Q ss_pred             HHHHHHHHCCEEEEEEECC----CCCCCCCCCCCHHHHHHHHCC----CCEEEECCCCCCCC-CCCCCHHHHHHHHHHHH
Q ss_conf             8999998299699986044----666776667788999998502----54034215666432-33443789999999986
Q T0591           138 NRKLVEFFEGEMVPVQLDY----VSADETRAGLDLTGLEEAFKA----GARVFLFSNPNNPA-GVVYSAEEIGQIAALAA  208 (406)
Q Consensus       138 ~~~~~~~~g~~~v~v~~~~----~~~~~~~~~~d~~~l~~~~~~----~~k~i~l~~P~NPT-G~~~s~~~l~~i~~~a~  208 (406)
                      +...+...|+..+.+..+.    .......+.+|+++|++++++    .++++++.++||.. |.+++.+++++|.++|+
T Consensus       126 t~~~i~~~g~~~~~~~~~~~~~~~~~~~~~g~~d~~~l~~~i~~~~~~~~~~v~~~~~~n~~gG~~~~~~~l~~i~~ia~  205 (456)
T 2ez2_A          126 TRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTE  205 (456)
T ss_dssp             HHHHHHHTTCEEEECBCGGGGCTTCCCSCTTCBCHHHHHHHHHHHCGGGEEEEEEESSBTTTTSBCCCHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEEECCCCCCEEECCHHHHHHHHHHHH
T ss_conf             89999977974898873333256655688888199999998503387623589961011248632079999999999999


Q ss_pred             HCCCEEEECCCCCC----------CCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHH-HHHHHHHHHH
Q ss_conf             37875784175023----------556888765223321026786899850400104631121143325-8999999987
Q T0591           209 RYGATVIADQLYSR----------LRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS-RAIIARMEKL  277 (406)
Q Consensus       209 ~~~~~ii~De~Y~~----------l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~-~~~i~~l~~~  277 (406)
                      +||+.++.|.+...          ..|.+.....+........+  ++..|++|.++  |.+.|+++.+ +++.++++..
T Consensus       206 ~~gi~l~~D~ar~~~~~~~~~~~~~~~~~~~i~~i~~~~~~~~d--~~s~s~~K~~~--~~~GG~l~~~~~~~~~~~r~~  281 (456)
T 2ez2_A          206 AHGIKVFYDATRCVENAYFIKEQEQGFENKSIAEIVHEMFSYAD--GCTMSGKKDCL--VNIGGFLCMNDDEMFSSAKEL  281 (456)
T ss_dssp             HTTCCEEEECTTHHHHHHHHHHHSTTCTTSCHHHHHHHHHTTCS--EEEEETTTTTC--CSSCEEEEESCHHHHHHHHHH
T ss_pred             HCCCEEEEEHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCC--EEEEECCCCCC--CCCCEEEEECCHHHHHHHHHH
T ss_conf             75986998727764125553035544479867665555404676--89983775534--675217983789999999733


Q ss_pred             HHHC----CCCHHHHHH-HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECC----CC--
Q ss_conf             5203----676124579-999999856525899999999999999999997279945535887307877668----87--
Q T0591           278 QAIV----SLRAAGYSQ-AVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLP----KL--  346 (406)
Q Consensus       278 ~~~~----~~~~~~~~q-~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~----~~--  346 (406)
                      ....    ..+.....+ .+++..+.+...  .+...+..++.+.+.+.|.+. |+.+..|.++.++|++..    ..  
T Consensus       282 ~~~~~g~~~~g~~~~~~~~a~avgl~e~~~--~~~l~~r~~~~~~L~~~L~~~-g~~~v~p~g~~~v~vd~~~~~~~i~~  358 (456)
T 2ez2_A          282 VVVYEGMPSYGGLAGRDMEAMAIGLREAMQ--YEYIEHRVKQVRYLGDKLKAA-GVPIVEPVGGHAVFLDARRFCEHLTQ  358 (456)
T ss_dssp             HHHHTCCTTTTTCCHHHHHHHHHHHHHHTC--HHHHHHHHHHHHHHHHHHHHT-TCCBCSSCCSSEEEEEHHHHTTTSCG
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCCEEEEEHHHHCCCCCC
T ss_conf             552368763207888899999989988505--999999999999999999856-99611578874356641544589861


Q ss_pred             -CCCHHHHHHHHHHHCCEEEEECCCCCC-----------CCCCEEEEEEC--C-CHHHHHHHHHHHHHHHHHH
Q ss_conf             -889899999999868918961610267-----------99985899850--9-9799999999999999985
Q T0591           347 -AVAPAEFVKILRLQAGVVVTPGTEFSP-----------HTADSVRLNFS--Q-DHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       347 -~~~~~~~~~~Ll~~~gV~v~pG~~Fg~-----------~~~~~iRis~~--~-~~e~l~~al~rl~~~~~~~  404 (406)
                       ......++..|+.+.||...+...+..           ...+.+|+++.  . ++++++..++.|.++.++-
T Consensus       359 ~~~~~~~~~~~l~~~~GIr~~~~g~~~~~~~~~~g~~~~~~~e~vRLalpr~~~T~e~IDyVve~l~~v~~~~  431 (456)
T 2ez2_A          359 DEFPAQSLAASIYVETGVRSMERGIISAGRNNVTGEHHRPKLETVRLTIPRRVYTYAHMDVVADGIIKLYQHK  431 (456)
T ss_dssp             GGCHHHHHHHHHHHHHSEECEEESHHHHCBCTTTCSBCCCSCCEEEEECCTTTCCHHHHHHHHHHHHHHHHTG
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             1134789999999963943235766656757776777777545179757888899999999999999999728


No 81 
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A
Probab=99.90  E-value=6.6e-21  Score=159.30  Aligned_cols=323  Identities=12%  Similarity=0.072  Sum_probs=204.9

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCC---CCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHH
Q ss_conf             88999999999980878888788---889889999999999864886788670788248727899999999720010101
Q T0591            54 TPGAFDLFSAGVQSGGVQAYTEY---RGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAI  130 (406)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~Y~~~---~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~  130 (406)
                      +|.+.+++.+++..-+. +++-+   .|..++-+++-+.+.+.+|.    ++ .++++.++.+...++.+++++||.|++
T Consensus        80 ~p~v~~a~~~a~~~~G~-~~~~sR~~~G~~~~h~eLE~~LA~~~G~----e~-al~~sSG~~An~~ai~al~~~gd~vi~  153 (427)
T 2w8t_A           80 DPDVIAAGKEALEKFGS-GTCGSRMLNGTFHDHMEVEQALRDFYGT----TG-AIVFSTGYMANLGIISTLAGKGEYVIL  153 (427)
T ss_dssp             CHHHHHHHHHHHHHHCS-CCCSCTTTTCCCHHHHHHHHHHHHHHTC----SE-EEEESCHHHHHHHHHHHHSCTTCEEEE
T ss_pred             CHHHHHHHHHHHHHHCC-CCCCCCCCCCCHHHHHHHHHHHHHHHCC----CE-EEEECCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999999999998388-8877670748829999999999998789----96-999578999999999999726946996


Q ss_pred             HHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC----CCCEEEECCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             3105513899999829969998604466677666778899999850----254034215666432334437899999999
Q T0591           131 VQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK----AGARVFLFSNPNNPAGVVYSAEEIGQIAAL  206 (406)
Q Consensus       131 ~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~----~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~  206 (406)
                      ..-++......+.+.+.+...++           ..|.+.+++.+.    +.++++++....+.+|.+.+   +++|.++
T Consensus       154 d~~~h~s~~~~~~ls~~~~~~~~-----------h~D~~~l~~~l~~~~~~~~~~iv~e~v~s~~G~i~p---l~~l~~l  219 (427)
T 2w8t_A          154 DADSHASIYDGCQQGNAEIVRFR-----------HNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAP---LKEMVAV  219 (427)
T ss_dssp             ETTCCHHHHHHHHHSCSEEEEEC-----------TTCHHHHHHHHHTSCSSSCEEEEEESEETTTTEECC---HHHHHHH
T ss_pred             ECCCCHHHHCCCCCCCCCEEEEC-----------CCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCC---HHHHHHH
T ss_conf             26754702216323576169946-----------785789999998443468616872466578776687---9999999


Q ss_pred             HHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHH-HHCCCCH
Q ss_conf             863787578417502355688876522332102678689985040010463112114332589999999875-2036761
Q T0591           207 AARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQ-AIVSLRA  285 (406)
Q Consensus       207 a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~-~~~~~~~  285 (406)
                      |++||+++++||+++...+. ..-...........+..+++.|+||.++.+|   |+++++.++++.++... .+...+.
T Consensus       220 ~~~~ga~livDeahs~G~~G-~~g~g~~~~~g~~~~~dii~~t~sKa~g~~G---G~v~g~~~~i~~~~~~~~~~~~s~~  295 (427)
T 2w8t_A          220 AKKHGAMVLVDEAHSMGFFG-PNGRGVYEAQGLEGQIDFVVGTFSKSVGTVG---GFVVSNHPKFEAVRLACRPYIFTAS  295 (427)
T ss_dssp             HHHTTCEEEEECTTTTTTSS-TTSCCHHHHTTCTTCCSEEEEESSSTTCSCC---EEEEECCTTGGGGGGTCHHHHSSCC
T ss_pred             HHHCCCCHHHHHCCCCCCCC-CCCCCCHHHHCCCCCCCEEEECCHHHCCCCC---EEECCCCHHHHHHHHHCCCCEECCC
T ss_conf             99749541543320244246-7789848882888655468602410062152---3661562256777760676200578


Q ss_pred             HHHHH-HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCC-CEEEEEECCCCCCCHHHHHHHHHHHCCE
Q ss_conf             24579-999999856525899999999999999999997279945535887-3078776688788989999999986891
Q T0591           286 AGYSQ-AVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQA-GSYLFPRLPKLAVAPAEFVKILRLQAGV  363 (406)
Q Consensus       286 ~~~~q-~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~g-g~~~w~~~~~~~~~~~~~~~~Ll~~~gV  363 (406)
                      ..+.+ .++...++.... ..+.+++++++.+.+.+.|++. |+.+..+.. +-.+-+.+.+ .....+++++|+ ++||
T Consensus       296 ~~p~~~aaa~~aL~~l~~-~~~~~~~L~~~~~~l~~~L~~~-G~~~~~~~~~s~Iv~v~vg~-~~~a~~~~~~L~-e~GI  371 (427)
T 2w8t_A          296 LPPSVVATATTSIRKLMT-AHEKRERLWSNARALHGGLKAM-GFRLGTETCDSAIVAVMLED-QEQAAMMWQALL-DGGL  371 (427)
T ss_dssp             CCHHHHHHHHHHHHHHTS-CHHHHHHHHHHHHHHHHHHHHH-TCEESCSSCCSSEEEEEESS-HHHHHHHHHHHH-HTTE
T ss_pred             CCCHHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCEEEEEECC-HHHHHHHHHHHH-HCCC
T ss_conf             981658999999999864-9999999999999999999965-99768899999879999799-999999999998-3894


Q ss_pred             EEEECCCCC-CCCCCEEEEEEC--CCHHHHHHHHHHHHHHHHHH
Q ss_conf             896161026-799985899850--99799999999999999985
Q T0591           364 VVTPGTEFS-PHTADSVRLNFS--QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       364 ~v~pG~~Fg-~~~~~~iRis~~--~~~e~l~~al~rl~~~~~~~  404 (406)
                      .+.|...=. +.+...+|+++.  .++|+++..++.|+++.+++
T Consensus       372 ~v~~i~yPtvp~g~~rlRi~~sa~hT~edId~~v~~l~~v~k~l  415 (427)
T 2w8t_A          372 YVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAV  415 (427)
T ss_dssp             ECEEECTTTSCTTCEEEEEECCTTCCHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             18778999889997069998475589999999999999999984


No 82 
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii OT3}
Probab=99.90  E-value=5.1e-20  Score=153.32  Aligned_cols=329  Identities=13%  Similarity=0.123  Sum_probs=206.7

Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCE-EEEECCCCHHHHHHHH
Q ss_conf             341567867887888999999999980878888788889889999999999864886788670-7882487278999999
Q T0591            41 VDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDG-LIITPGTQGALFLAVA  119 (406)
Q Consensus        41 i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~-I~it~G~~~~l~~~~~  119 (406)
                      .-|+-|   +..-+|.+++++    .....+++++.  ...+-+.+.+.+.+..|.+   +++ |++|.|+|++++.++.
T Consensus        22 ~lf~pG---P~~v~~~V~~am----~~~~~~hr~~~--f~~~~~~~r~~l~~~l~~~---~~~~ii~~~sgT~~~~a~i~   89 (386)
T 2dr1_A           22 KLFTAG---PVACFPEVLEIM----KVQMFSHRSKE--YRKVHMDTVERLREFLEVE---KGEVLLVPSSGTGIMEASIR   89 (386)
T ss_dssp             EECCSS---SCCCCHHHHHHT----TSCCCCTTSHH--HHHHHHHHHHHHHHHHTCS---SSEEEEESSCHHHHHHHHHH
T ss_pred             CCCCCC---CCCCCHHHHHHH----CCCCCCCCCHH--HHHHHHHHHHHHHHHHCCC---CCCEEEEECCHHHHHHHHHH
T ss_conf             787389---948879999971----76578879989--9999999999999995979---99889995858999999997


Q ss_pred             HHHHCCHHHHHHHCCCHH--HHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHH--CCCCEEEECCCCCCCCCCCC
Q ss_conf             997200101013105513--89999982996999860446667766677889999985--02540342156664323344
Q T0591           120 ATVARGDKVAIVQPDYFA--NRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAF--KAGARVFLFSNPNNPAGVVY  195 (406)
Q Consensus       120 ~l~~pGd~Vl~~~P~y~~--~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~--~~~~k~i~l~~P~NPTG~~~  195 (406)
                      .++.|||+|++....+++  +....+.+|.++..+..+.      +...+++++++..  +++++++.++..+|.||...
T Consensus        90 ~l~~~g~~vlv~~~g~~~~~~~~~~~~~g~~v~~~~~~~------~~~~~~~~~~~~~~~~~~~~~v~~~h~~t~tG~~~  163 (386)
T 2dr1_A           90 NGVSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEP------GKAVKPEDLDDALRKNPDVEAVTITYNETSTGVLN  163 (386)
T ss_dssp             HHSCTTCEEEEEESSHHHHHHHHHHHHTTCEEEEEECCT------TCCCCHHHHHHHHHHCTTCCEEEEESEETTTTEEC
T ss_pred             HHHCCCCCEEEEECHHHCCCCCCCCCHHHHHCCCCCCCC------CCCCCCCCHHHHHCCCCCEEEEEEEEEEECCCCCC
T ss_conf             302268745885101211322121100122101234454------43322110012211243200038875312355540


Q ss_pred             CHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCC-CCCCCHHHHHHHHHHHHH
Q ss_conf             3789999999986378757841750235568887652233210267868998504001046-311211433258999999
Q T0591           196 SAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESL-SGYRLGVAFGSRAIIARM  274 (406)
Q Consensus       196 s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~-~GlRiG~~~~~~~~i~~l  274 (406)
                      +   +++|.++|+++|+++++|.+++...    .+..+..     .+--+++.|..|.++. +|  +|+++..++.+...
T Consensus       164 ~---i~~i~~~~~~~g~~~~vDa~qs~g~----~pid~~~-----~~vD~~~~s~~K~l~~p~G--~~~~~~~~~~~~~~  229 (386)
T 2dr1_A          164 P---LPELAKVAKEHDKLVFVDAVSAMGG----ADIKFDK-----WGLDVVFSSSQKAFGVPPG--LAIGAFSERFLEIA  229 (386)
T ss_dssp             C---HHHHHHHHHHTTCEEEEECTTTBTT----BCCCTTT-----TTCSEEEEETTSTTCCCSS--CEEEEECHHHHHHH
T ss_pred             C---HHHHHHHHHHCCEEEEEECCCCCCC----CCCCCCC-----CCCCEEECCCCCEECCCCC--EEEEEEEHHHHHHH
T ss_conf             2---4989887652331799860102475----6643334-----5641663144412307996--69998625556420


Q ss_pred             HH----------------HHH-HCCCC-HHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC
Q ss_conf             98----------------752-03676-1245799999998565--2589999999999999999999727994553588
Q T0591           275 EK----------------LQA-IVSLR-AAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ  334 (406)
Q Consensus       275 ~~----------------~~~-~~~~~-~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~  334 (406)
                      ..                .+. ....+ ++.....++..+++..  ........++++.+...+.+.+... |+....+.
T Consensus       230 ~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~al~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~-g~~~~~~~  308 (386)
T 2dr1_A          230 EKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQVFGINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREI-GLDILAEP  308 (386)
T ss_dssp             TTCTTCCSTTCHHHHHHHHHHHSSCSSCCCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHT-TCCBSSCT
T ss_pred             CCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-EEECCCCH
T ss_conf             23467754344412204443332345567805666789999999976567778999998755577765313-00003676


Q ss_pred             C---CEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC--CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             7---3078776688788989999999986891896161026799985899850--9979999999999999998569
Q T0591           335 A---GSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS--QDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       335 g---g~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~--~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      +   ..-+-+.+|+ +.++.++...| +++||.+.+|...  ...+.+|+|+.  +++++++..++.|+++++++|.
T Consensus       309 ~~~s~~v~~~~~p~-g~~~~~l~~~L-~~~gi~i~~G~~~--~~~~~iRis~~~~~t~edi~~lv~~l~~~l~~l~k  381 (386)
T 2dr1_A          309 GHESPTITAVLTPP-GIKGDEVYEAM-RKRGFELAKGYGS--VKEKTFRIGHMGYMKFEDIQEMLDNLREVINELKK  381 (386)
T ss_dssp             TCBCSSEEEEECCT-TCCHHHHHHHH-HHTTEECEECCGG--GTTTEEEEECCSSCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCEEEEECCC-CCCHHHHHHHH-HHCCCEEEECCHH--HCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             65498179996889-99999999999-9789499707664--47987998687749999999999999999999998


No 83 
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; X-RAY, aspartate aminotransferase, colitose, perosamine, O- antigen, PLP; HET: G4M; 1.70A {Escherichia coli O55} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A*
Probab=99.90  E-value=7.6e-21  Score=158.88  Aligned_cols=316  Identities=11%  Similarity=0.077  Sum_probs=197.9

Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHH
Q ss_conf             34156786788788899999999998087888878888988999999999986488678867078824872789999999
Q T0591            41 VDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAA  120 (406)
Q Consensus        41 i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~  120 (406)
                      |++-...|.+   ..+.++++.+.++++.   |+..+-..+|.+.+|+++    |.    + +.+.++++|+|+.+++++
T Consensus         4 ~~~~~~~~~~---~~~~~~~v~~~l~~~~---~~~G~~~~~~E~~~A~~~----g~----~-~ai~~~sGt~A~~~al~a   68 (390)
T 3b8x_A            4 INYPLASSTW---DDLEYKAIQSVLDSKM---FTMGEYVKQYETQFAKTF----GS----K-YAVMVSSGSTANLLMIAA   68 (390)
T ss_dssp             -CBCSCCCCC---CHHHHHHHHHHHHHTC---CSSCHHHHHHHHHHHHHH----TC----S-EEEEESCHHHHHHHHHHH
T ss_pred             EECCCCCCCC---CHHHHHHHHHHHHCCC---CCCCHHHHHHHHHHHHHH----CC----C-EEEEECCHHHHHHHHHHH
T ss_conf             6527899999---9999999999997798---547876999999999987----88----8-599968999999999999


Q ss_pred             H-------HHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             9-------720010101310551389999982996999860446667766677889999985025403421566643233
Q T0591           121 T-------VARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGV  193 (406)
Q Consensus       121 l-------~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~  193 (406)
                      +       ++|||+|+++.++|......+..+|++++.++++     .+.+.++++.+++.+++++|+++++++   .|.
T Consensus        69 l~~~~~~~l~~GD~Vi~~~~~~~~~~~~i~~~G~~~v~~dvd-----~~~~~~~~e~l~~~~~~~t~~v~~~~~---~g~  140 (390)
T 3b8x_A           69 LFFTKKPRLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDID-----INTLNIDIESLKEAVTDSTKAILTVNL---LGN  140 (390)
T ss_dssp             TTSSSSCSCCTTCEEEEESSSCHHHHHHHHHTTCEEEEECBC-----TTTCSBCHHHHHHHCCTTEEEEEEECG---GGC
T ss_pred             HHHHHHCCCCCCCEEEECCCCCHHHHHHHHHCCCEEEEECCC-----CCCCCCCHHHHHHHCCCCCCCCCCCCC---CCC
T ss_conf             875411278998999988986199999999859989997158-----774557999999760245343323346---787


Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCC-CCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHH-HHHHHH
Q ss_conf             44378999999998637875784175023556-8887652233210267868998504001046311211433-258999
Q T0591           194 VYSAEEIGQIAALAARYGATVIADQLYSRLRY-AGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAF-GSRAII  271 (406)
Q Consensus       194 ~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~-~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~-~~~~~i  271 (406)
                      ..   ++++|.++|++||+++|+|++++...+ .+.+   .    ....+..++..+.+|.++  +..-|+++ .++++.
T Consensus       141 ~~---dl~~I~~ia~~~gi~li~D~a~a~G~~~~~~~---~----g~~~d~~~~s~~~~K~l~--~~~GG~i~~~~~~l~  208 (390)
T 3b8x_A          141 PN---NFDEINKIIGGRDIILLEDNCESMGATFNNKC---A----GTFGLMGTFSSFYSNHIA--TMEGGCIVTDDEEIY  208 (390)
T ss_dssp             CC---CHHHHHHHHTTSCCEEEEECTTCTTCEETTEE---T----TSSSSEEEEECCTTSSSC--SSSCEEEEESCHHHH
T ss_pred             CC---CHHHHHHHHHHCCCCEEEECHHHCCCCCCCEE---C----CCCCCEEEEEEECCCCCC--CCCCEEEEECCHHHH
T ss_conf             33---79999999997699789444433056358804---2----467642678863577676--788128981899999


Q ss_pred             HHHHHHHHHCCC-------------------------------CHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             999987520367-------------------------------6124579999999856525899999999999999999
Q T0591           272 ARMEKLQAIVSL-------------------------------RAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       272 ~~l~~~~~~~~~-------------------------------~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      +.++.++.....                               ..+.+ +.+.  .+.. .+.+.+..++.+++.+.+.+
T Consensus       209 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~-~aa~--~~~~-l~~l~~~~~~r~~~a~~~~~  284 (390)
T 3b8x_A          209 HILLCIRAHGWTRNLPKKNKVTGVKSDDQFEESFKFVLPGYNVRPLEM-SGAI--GIEQ-LKKLPRFISVRRKNAEYFLD  284 (390)
T ss_dssp             HHHHHHTBTTBSTTSCSEETTTEECCSCTTTSSSCBCSCCCBCCCCHH-HHHH--HHHH-HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHEEEECCCCCCCCCHH-HHHH--HHHH-HCCCHHHHHHHHHHHHHHHH
T ss_conf             999998857967665433443333442011121022113734687999-9999--9986-15567999999999999999


Q ss_pred             HHHHCCCCEEECCCC--C--EE-EEEECCCCCCCHHHHHHHHHHHCCEEEEECC---CC---------C--CCC------
Q ss_conf             997279945535887--3--07-8776688788989999999986891896161---02---------6--799------
Q T0591           321 VLRGCEGVFARTPQA--G--SY-LFPRLPKLAVAPAEFVKILRLQAGVVVTPGT---EF---------S--PHT------  375 (406)
Q Consensus       321 ~L~~~~g~~~~~p~g--g--~~-~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~---~F---------g--~~~------  375 (406)
                      .|++++++.+..+.+  .  .| +++..+ .+.+..++.+.| ++.||.+.|..   .+         +  ..+      
T Consensus       285 ~L~~~~~~~~~~~~~~~~~~~~~i~~~~~-~~~~~~~l~~~L-~~~GI~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~a~  362 (390)
T 3b8x_A          285 KFKDHPYLDVQQETGESSWFGFSFIIKKD-SGVIRKQLVENL-NSAGIECRPIVTGNFLKNTDVLKYFDYTVHNNVDNAE  362 (390)
T ss_dssp             HHTTCSSEEECCCCSBCCCCEEEEEECTT-SCCCHHHHHHHH-HHTTBCCBCSTTSSGGGCHHHHTTCEEEESSCCHHHH
T ss_pred             HHHCCCCCCCCCCCCCCEEEEEEEEECCC-CCCCHHHHHHHH-HHCCCCEEECCCCCCCCCHHHHHHCCCCCCCCCHHHH
T ss_conf             96179982057899986148999998378-887899999999-9779967754677454356678742877778997999


Q ss_pred             ---CCEEEEEEC--CCHHHHHHHHHHH
Q ss_conf             ---985899850--9979999999999
Q T0591           376 ---ADSVRLNFS--QDHEAAVAAARRI  397 (406)
Q Consensus       376 ---~~~iRis~~--~~~e~l~~al~rl  397 (406)
                         .+.+||.+-  .++|+++..++.|
T Consensus       363 ~l~~~~l~lp~h~~~t~edid~i~~~l  389 (390)
T 3b8x_A          363 YLDKNGLFVGNHQIELFDEIDYLREVL  389 (390)
T ss_dssp             HHHHHEEEEECCSSCCHHHHHHHHHHT
T ss_pred             HHHHCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             997196982189999999999999973


No 84 
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis}
Probab=99.89  E-value=1.8e-20  Score=156.31  Aligned_cols=340  Identities=15%  Similarity=0.139  Sum_probs=206.6

Q ss_pred             HHHHHHHHCC-CCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC-------CCHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999963037-89833415678678878889999999999808788887888-------898899999999998648867
Q T0591            27 LEALIRGAPI-EGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYR-------GDLGIRDLLAPRLAAFTGAPV   98 (406)
Q Consensus        27 ~~~~~~~~~~-~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~-------G~~~Lr~aia~~~~~~~g~~~   98 (406)
                      +..+-...|. ....+-|..+.-  ..++..+++++.+.+.......++...       -..+.|+.+++++    |.  
T Consensus        13 ~~~~R~~fP~l~~~~~yld~a~~--~~~p~~v~~~~~~~~~~~~~n~~~~~~~~~~~~~~~e~~R~~ia~ll----ga--   84 (406)
T 3cai_A           13 VARVRGLHPSLGDGWVHFDAPAG--MLIPDSVATTVSTAFRRSGASTVGAHPSARRSAAVLDAAREAVADLV----NA--   84 (406)
T ss_dssp             HHHHHHTCTTTTSSCEECBGGGC--CCCCHHHHHHHHHHHHHCCSSSCSSSHHHHHHHHHHHHHHHHHHHHH----TC--
T ss_pred             HHHHHHHCCCCCCCCEEEECCCC--CCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH----CC--
T ss_conf             99999658368999387448532--58999999999999986699976637999999999999999999980----91--


Q ss_pred             CCCCEEEEECCCCHHHHHHHHHH---HHCCHHHHHHHCCCHHH----HHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHH
Q ss_conf             88670788248727899999999---72001010131055138----999998299699986044666776667788999
Q T0591            99 DARDGLIITPGTQGALFLAVAAT---VARGDKVAIVQPDYFAN----RKLVEFFEGEMVPVQLDYVSADETRAGLDLTGL  171 (406)
Q Consensus        99 ~~~~~I~it~G~~~~l~~~~~~l---~~pGd~Vl~~~P~y~~~----~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l  171 (406)
                      ++ ++|++++++++++.+++.++   ..+||+|++..-.|++.    ....+..|++++.++.+.     +.+..|++++
T Consensus        85 ~~-~~i~f~~~~t~~l~~v~~~~~~~~~~gd~Vi~~~~e~~s~~~~~~~~~~~~G~~~~~v~~~~-----~~~~~d~~~l  158 (406)
T 3cai_A           85 DP-GGVVLGADRAVLLSLLAEASSSRAGLGYEVIVSRLDDEANIAPWLRAAHRYGAKVKWAEVDI-----ETGELPTWQW  158 (406)
T ss_dssp             CG-GGEEEESCHHHHHHHHHHHTGGGGBTTCEEEEETTSCGGGTHHHHHHHHHHBCEEEEECCCT-----TTCCCCGGGH
T ss_pred             CC-CCEEEECCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHCCCEEEEEEECC-----CCCCCCHHHH
T ss_conf             95-55899189579999999874322599898999157002422089999986295589984156-----5587799999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECC
Q ss_conf             99850254034215666432334437899999999863787578417502355688876522332102678689985040
Q T0591           172 EEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPS  251 (406)
Q Consensus       172 ~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~S  251 (406)
                      +++++++||+++++.++|+||..++   +++|+++|+++|+++++|.+++.    +..+..+...   ..+  +++.|..
T Consensus       159 ~~~i~~~t~lv~i~~v~~~tG~~~~---i~~I~~~a~~~g~~~~vD~aqa~----g~~~id~~~~---~~D--~~~~s~h  226 (406)
T 3cai_A          159 ESLISKSTRLVAVNSASGTLGGVTD---LRAMTKLVHDVGALVVVDHSAAA----PYRLLDIRET---DAD--VVTVNAH  226 (406)
T ss_dssp             HHHCCTTEEEEEEESBCTTTCBBCC---CHHHHHHHHHTTCEEEEECTTTT----TTCCCCHHHH---CCS--EEEEEGG
T ss_pred             HHHHCCCCEEEEEECCCCCCCEECC---HHHHHHHHHHCCCCCCEEHHHHC----CCCCCCCCCC---CCC--EEEECCC
T ss_conf             9984589529984135567620056---99999887534633120623314----6766544443---352--7972165


Q ss_pred             HHCCCCCCCCH-HHHHHHHHHHHHHHHHH--------HCCCCHHHHHHHH----HHHHHHCC--------CH----HHHH
Q ss_conf             01046311211-43325899999998752--------0367612457999----99998565--------25----8999
Q T0591           252 KTESLSGYRLG-VAFGSRAIIARMEKLQA--------IVSLRAAGYSQAV----LRGWFDEA--------PG----WMED  306 (406)
Q Consensus       252 K~~~~~GlRiG-~~~~~~~~i~~l~~~~~--------~~~~~~~~~~q~a----~~~~l~~~--------~~----~~~~  306 (406)
                      |.++ |+  .| .++..++++..+.....        ....+++...+.+    ...++...        ..    -.+.
T Consensus       227 K~~g-p~--~g~l~~~~~~~~~~~~~~~~~~~~~~~~~~e~gt~~~~~~~g~~~~~~~~~~l~~~~~~~~~~~l~~~~~~  303 (406)
T 3cai_A          227 AWGG-PP--IGAMVFRDPSVMNSFGSVSTNPYATGPARLEIGVHQFGLLAGVVASIEYLAALDESARGSRRERLAVSMQS  303 (406)
T ss_dssp             GGTS-CS--CEEEEESCHHHHHTSCCCCSCTTCCGGGGGCCSCCCHHHHHHHHHHHHHHHTSSTTCCSSHHHHHHHHHHH
T ss_pred             CCCC-CC--EEEEEEECHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             4158-97--37999975788522202565655678543215754410164489999999997798876678876668999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEECC---CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCC------CC-CCC
Q ss_conf             999999999999999972799455358---87307877668878898999999998689189616102------67-999
Q T0591           307 RIARHQAIRDELLHVLRGCEGVFARTP---QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEF------SP-HTA  376 (406)
Q Consensus       307 ~~~~~~~~r~~l~~~L~~~~g~~~~~p---~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~F------g~-~~~  376 (406)
                      ..++.++..+.+.+.|.+++++++..+   .++... +.++  +.+..++...| .+.||.+..+..+      |. ..+
T Consensus       304 i~~~~~~L~~~l~~~L~~i~~v~l~~~~~~r~~~vs-f~~~--~~~~~~v~~~L-~~~gi~~~~~~~~~~~~~lg~~~~~  379 (406)
T 3cai_A          304 ADAYLNRVFDYLMVSLRSLPLVMLIGRPEAQIPVVS-FAVH--KVPADRVVQRL-ADNGILAIANTGSRVLDVLGVNDVG  379 (406)
T ss_dssp             HHHHHHHHHHHHHHHHHTCTTEEECCCCSSBCSEEE-EEET--TBCHHHHHHHH-HHTTEECEECCSCHHHHHHTTTTTT
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCEEE-EEEC--CCCHHHHHHHH-HHCCCEEEECCHHHHHHHCCCCCCC
T ss_conf             998877777788865322563699578554656799-9838--93999999999-7779999928476899974999989


Q ss_pred             CEEEEEEC--CCHHHHHHHHHHHHH
Q ss_conf             85899850--997999999999999
Q T0591           377 DSVRLNFS--QDHEAAVAAARRIVT  399 (406)
Q Consensus       377 ~~iRis~~--~~~e~l~~al~rl~~  399 (406)
                      +.+|+|+.  +++++++..++.|++
T Consensus       380 g~vRiS~~~ynt~~dId~li~aL~~  404 (406)
T 3cai_A          380 GAVTVGLAHYSTMAEVDQLVRALAS  404 (406)
T ss_dssp             CCEEEECCTTCCHHHHHHHHHHHHT
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             8899975898999999999999986


No 85 
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, pyridoxal phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum}
Probab=99.89  E-value=1.2e-19  Score=150.90  Aligned_cols=334  Identities=13%  Similarity=0.109  Sum_probs=213.5

Q ss_pred             CEEECCCCC-CCCCCCHHHHHHHHHHHHCCCCCCCCCC---CCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             334156786-7887888999999999980878888788---889889999999999864886788670788248727899
Q T0591            40 PVDFSHGDV-DAHEPTPGAFDLFSAGVQSGGVQAYTEY---RGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        40 ~i~ls~G~p-d~~~p~~~~~~~~~~~~~~~~~~~Y~~~---~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      .++|+.-+- .+. -+|.+.+++.+++..-+.. ++.+   .|...+-+.+-+.+...+|.    + ..++.+.+..+..
T Consensus        45 ~l~F~sndYLGL~-~~p~v~~a~~~a~~~~G~~-~~~Sr~~~G~~~~~~~lE~~la~~~g~----e-~al~~~SG~~An~  117 (398)
T 3a2b_A           45 VLMFGSNSYLGLT-TDTRIIKAAQDALEKYGTG-CAGSRFLNGTLDIHVELEEKLSAYVGK----E-AAILFSTGFQSNL  117 (398)
T ss_dssp             EEECSCSCTTCGG-GCHHHHHHHHHHHHHHCSC-CCSBTTTTCCCHHHHHHHHHHHHHHTC----S-EEEEESSHHHHHH
T ss_pred             EEEEECCCCCCCC-CCHHHHHHHHHHHHHHCCC-CCCCCEECCCHHHHHHHHHHHHHHHCC----C-CEEEEECCHHHHH
T ss_conf             9998653413678-9999999999999985899-875844305859999999999998599----8-2798613223345


Q ss_pred             HHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC----CCCEEEECCCCCCCC
Q ss_conf             9999997200101013105513899999829969998604466677666778899999850----254034215666432
Q T0591           116 LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK----AGARVFLFSNPNNPA  191 (406)
Q Consensus       116 ~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~----~~~k~i~l~~P~NPT  191 (406)
                      .++.++++++|.|+...-.+......+.+.+.+.+...           .-|.+.+++.++    ++.++++.....+-+
T Consensus       118 ~~i~~l~~~~d~v~~D~~~H~si~~g~~~s~~~~~~~~-----------h~d~~~l~~~l~~~~~~~~~~iv~egv~Sm~  186 (398)
T 3a2b_A          118 GPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYG-----------HNNMEDLRAKLSRLPEDSAKLICTDGIFSME  186 (398)
T ss_dssp             HHHHHSSCTTCEEEEETTCCHHHHHHHHHSSSEEEEEC-----------TTCHHHHHHHHHTSCSSSCEEEEEESBCTTT
T ss_pred             HHHHHCCCCCCEEEECHHCCHHHHHHHHHCCCCEEEEC-----------CCCHHHHHHHHHHCCCCCCCEEEECCCCCCC
T ss_conf             55431156787898610003977502654068535645-----------8887999988532012476058713666898


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHH
Q ss_conf             33443789999999986378757841750235568887652233210267868998504001046311211433258999
Q T0591           192 GVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAII  271 (406)
Q Consensus       192 G~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i  271 (406)
                      |.+.+   +++|+++|++||+++++||+|+.-++...-. .+........+..|++.||||.|+..|   |+++++.+++
T Consensus       187 G~~ap---L~~l~~L~~~y~~~LivDeAH~~Gv~G~~G~-G~~e~~g~~~~idi~~gtlsKa~g~~G---g~v~g~~~~i  259 (398)
T 3a2b_A          187 GDIVN---LPELTSIANEFDAAVMVDDAHSLGVIGHKGA-GTASHFGLNDDVDLIMGTFSKSLASLG---GFVAGDADVI  259 (398)
T ss_dssp             CCBCC---HHHHHHHHHHHTCEEEEECTTTTTTSSGGGC-CHHHHHTCGGGCSEEEEESSSTTCSSC---EEEEECHHHH
T ss_pred             CCCCC---HHHHHHHHHHHCEEEEEECCCCCCEECCCCC-CHHHHHCCCCCCEEEECCCCCCCCEEE---EEEEECHHHH
T ss_conf             87647---9999999997294899734110331147886-669981898886699821224565145---7998268987


Q ss_pred             HHHHHHHHH-CCC-CHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCCCC
Q ss_conf             999987520-367-612457999999985652589999999999999999999727994553588730787766887889
Q T0591           272 ARMEKLQAI-VSL-RAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVA  349 (406)
Q Consensus       272 ~~l~~~~~~-~~~-~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~~~  349 (406)
                      +.++..... ... ..+++...++...++... ...+.+++++++.+.+.+.|.+. |+.+..++.. -+-+.+.+ ...
T Consensus       260 ~~l~~~~~~~~~s~~l~p~~~~aa~~al~~~~-~~~~~~~~L~~n~~~~~~~l~~~-g~~~~~~~sp-I~~v~ig~-~~~  335 (398)
T 3a2b_A          260 DFLKHNARSVMFSASMTPASVASTLKALEIIQ-NEPEHIEKLWKNTDYAKAQLLDH-GFDLGATESP-ILPIFIRS-NEK  335 (398)
T ss_dssp             HHHHHHCHHHHSSBCCCHHHHHHHHHHHHHHH-HCTHHHHHHHHHHHHHHHHHHHT-TCCBCSCCSS-EEEEECCC-HHH
T ss_pred             HHHHHCCHHHHHCCCCCHHHHHHHHHHHHHHC-CCHHHHHHHHHHHHHHHHHHHCC-CCCCCCCCCC-EEEEEECC-HHH
T ss_conf             67675071133147886488899999987620-48999999998888877543203-8886899999-89999898-899


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCC---CCCEEEEEEC--CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8999999998689189616102679---9985899850--997999999999999999856
Q T0591           350 PAEFVKILRLQAGVVVTPGTEFSPH---TADSVRLNFS--QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       350 ~~~~~~~Ll~~~gV~v~pG~~Fg~~---~~~~iRis~~--~~~e~l~~al~rl~~~~~~~r  405 (406)
                      ..++.+.| .+.||.+.|..  .|.   +...+|+++.  .+++++++.++.|.++++++.
T Consensus       336 ~~~~~~~L-~~~Gi~v~~i~--~PtVp~g~~~lRi~l~a~hT~~dId~l~~~l~~v~~~~~  393 (398)
T 3a2b_A          336 TFWVTKML-QDDGVFVNPVV--SPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAE  393 (398)
T ss_dssp             HHHHHHHH-HHTTEECEEEC--TTTSCGGGCEEEEECCTTCCHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHH-HHCCEEEEEEC--CCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999-97892798888--998899980699998877999999999999999999839


No 86 
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural genomics, PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A*
Probab=99.89  E-value=2e-19  Score=149.21  Aligned_cols=317  Identities=17%  Similarity=0.171  Sum_probs=204.3

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCC-----------CHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             88899999999998087888878888-----------9889999999999864886788670788248727899999999
Q T0591            53 PTPGAFDLFSAGVQSGGVQAYTEYRG-----------DLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT  121 (406)
Q Consensus        53 p~~~~~~~~~~~~~~~~~~~Y~~~~G-----------~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l  121 (406)
                      +++.+++++.+.+.+...   .+..|           ..+.|+.++++    .|.. + +++|++|+|+|++++.++.++
T Consensus        35 ~p~~v~~a~~~~~~~~~~---n~~~~~~~~~~~~~~~~e~~R~~ia~~----l~~~-~-~~~i~f~~~~T~a~n~~~~~~  105 (406)
T 1kmj_A           35 KPSQVIDAEAEFYRHGYA---AVHRGIHTLSAQATEKMENVRKRASLF----INAR-S-AEELVFVRGTTEGINLVANSW  105 (406)
T ss_dssp             CCHHHHHHHHHHHHHTCC---CCSSCSSHHHHHHHHHHHHHHHHHHHH----TTCS-C-GGGEEEESSHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHHHCCC---CCCCCHHHHHHHHHHHHHHHHHHHHHH----HCCC-C-CCCEEEECCHHHHHHHHHHHH
T ss_conf             999999999999986679---876303199999999999999999998----1899-8-430576265789999999632


Q ss_pred             ----HHCCHHHHHHHCCCHHHHHHH----HHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             ----720010101310551389999----982996999860446667766677889999985025403421566643233
Q T0591           122 ----VARGDKVAIVQPDYFANRKLV----EFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGV  193 (406)
Q Consensus       122 ----~~pGd~Vl~~~P~y~~~~~~~----~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~  193 (406)
                          ..+||+|++..-.|++....+    +..|+++..+|++.      +..+|++.++++++++||++.++.-+|.||.
T Consensus       106 ~~~~~~~gd~iv~~~~eh~s~~~~~~~~a~~~G~~v~~~p~~~------~g~~~~~~~~~~i~~~t~lv~i~~vsn~~G~  179 (406)
T 1kmj_A          106 GNSNVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNP------DGTLQLETLPTLFDEKTRLLAITHVSNVLGT  179 (406)
T ss_dssp             HHHHCCTTCEEEEETTCCGGGTHHHHHHHHHHTCEEEEECBCT------TSCBCGGGHHHHCCTTEEEEEEESBCTTTCC
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEEECCCC------CCCCCHHHHHHHCCCCCEEEEEECCCCCCCE
T ss_conf             0120478988999706312269999999997496899986699------9848899999745799669999778878750


Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHH
Q ss_conf             44378999999998637875784175023556888765223321026786899850400104631121143325899999
Q T0591           194 VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIAR  273 (406)
Q Consensus       194 ~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~  273 (406)
                      ..+   +++|+++|+++|+++++|-+.+-    |.-+..+...   ..+  +++.|..|.+|-+|  +|++...+++.+.
T Consensus       180 ~~p---v~~i~~~~~~~g~~~~vDa~q~~----g~~~id~~~~---~~D--~~~~s~hK~~GP~G--~G~l~v~~~~~~~  245 (406)
T 1kmj_A          180 ENP---LAEMITLAHQHGAKVLVDGAQAV----MHHPVDVQAL---DCD--FYVFSGHKLYGPTG--IGILYVKEALLQE  245 (406)
T ss_dssp             BCC---HHHHHHHHHHTTCEEEEECTTTT----TTSCCCHHHH---TCS--EEEEEGGGTTSCTT--CEEEEECHHHHHH
T ss_pred             ECC---HHHHHHHHHHCCCEEEEEECCEE----CEECCCCCCC---CCC--EEEEEHHHCCCCCC--CCCEEECCCHHHH
T ss_conf             575---89999999874986999752330----1116862227---987--89980265369997--6130665213630


Q ss_pred             HHHHHH---------------------HCCCCHHH-HHHHHHHHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             998752---------------------03676124-579999999856525-8999999999999999999972799455
Q T0591           274 MEKLQA---------------------IVSLRAAG-YSQAVLRGWFDEAPG-WMEDRIARHQAIRDELLHVLRGCEGVFA  330 (406)
Q Consensus       274 l~~~~~---------------------~~~~~~~~-~~q~a~~~~l~~~~~-~~~~~~~~~~~~r~~l~~~L~~~~g~~~  330 (406)
                      +.....                     ....+++. +...++...++-... -.++..++.+...+.+.+.+..+++...
T Consensus       246 ~~p~~~g~~~~~~~~~~~~~~~~~~~~r~e~GT~n~~~~~~l~~al~~~~~~g~~~i~~~~~~L~~~~~~~~~~~~~~~~  325 (406)
T 1kmj_A          246 MPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTL  325 (406)
T ss_dssp             CCCSSCSTTSEEEEETTTEEEECCTTGGGCCSSCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHTTSTTEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             79611689865664534455545425655277876435999999999999709499999999999999987621896352


Q ss_pred             ECCC--CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCC------CCCCEEEEEEC--CCHHHHHHHHHHHHHH
Q ss_conf             3588--730787766887889899999999868918961610267------99985899850--9979999999999999
Q T0591           331 RTPQ--AGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSP------HTADSVRLNFS--QDHEAAVAAARRIVTL  400 (406)
Q Consensus       331 ~~p~--gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~------~~~~~iRis~~--~~~e~l~~al~rl~~~  400 (406)
                      ..|+  ++... +.++  +.++.++... +.++||.+..|+.+..      ..++.+|+|+.  ++.|+++..++.|+++
T Consensus       326 ~~~~~~~~ivs-f~~~--~~~~~~v~~~-L~~~gI~v~~G~~ca~~~~~~~~~~g~vRiS~~~ynt~eDid~l~~~l~~i  401 (406)
T 1kmj_A          326 YGPQNRLGVIA-FNLG--KHHAYDVGSF-LDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRI  401 (406)
T ss_dssp             ESCTTCCSEEE-EEET--TCCHHHHHHH-HHHTTEECEEECTTCHHHHHHTTCSCEEEEECCTTCCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCEEE-EECC--CCCHHHHHHH-HHHCCCEEECCCHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             58866675799-9738--9899999999-977895997560322567886189978999788989999999999999999


Q ss_pred             HH
Q ss_conf             99
Q T0591           401 VE  402 (406)
Q Consensus       401 ~~  402 (406)
                      .+
T Consensus       402 ~k  403 (406)
T 1kmj_A          402 HR  403 (406)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             98


No 87 
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A*
Probab=99.88  E-value=2.1e-19  Score=149.17  Aligned_cols=320  Identities=13%  Similarity=0.104  Sum_probs=195.0

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCC-CCH----------HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             8889999999999808788887888-898----------89999999999864886788670788248727899999999
Q T0591            53 PTPGAFDLFSAGVQSGGVQAYTEYR-GDL----------GIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT  121 (406)
Q Consensus        53 p~~~~~~~~~~~~~~~~~~~Y~~~~-G~~----------~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l  121 (406)
                      +++.+++++.+.+.+.    |+++. ++.          +.|+.|+++    .|.  +| ++|++|+|+|+++++++..+
T Consensus        30 ~~~~v~~a~~~~~~~~----~~Np~s~~~~~~~a~~~ie~aR~~ia~~----lga--~~-~eIvft~~aTea~n~v~~~~   98 (432)
T 3a9z_A           30 LEPEVIQAVTEAMKEA----WGNPSSSYVAGRKAKDIINTARASLAKM----IGG--KP-QDIIFTSGGTESNNLVIHST   98 (432)
T ss_dssp             CCHHHHHHHHHHHHHC----CSCTTCSSHHHHHHHHHHHHHHHHHHHH----HTC--CG-GGEEEESCHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHC----CCCCCCCCHHHHHHHHHHHHHHHHHHHH----HCC--CC-CCEEEECCHHHHHHHHHHHH
T ss_conf             9999999999999873----7997642199999999999999999998----199--97-86899088799999999999


Q ss_pred             H---------------------HCCHHHHHHHCCCHHHHHHH----HHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC
Q ss_conf             7---------------------20010101310551389999----9829969998604466677666778899999850
Q T0591           122 V---------------------ARGDKVAIVQPDYFANRKLV----EFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK  176 (406)
Q Consensus       122 ~---------------------~pGd~Vl~~~P~y~~~~~~~----~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~  176 (406)
                      .                     .+||+|++..--|++....+    +..|.+++.+|.+     ..+..+|++.++++++
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~vv~s~~Eh~s~~~~~~~~~~~~g~~v~~~~~~-----~~~g~id~~~l~~~i~  173 (432)
T 3a9z_A           99 VRCFHEQQTLQGRTVDQISPEEGTRPHFITCTVEHDSIRLPLEHLVEDQVAEVTFVPVS-----KVNGQVEVEDILAAVR  173 (432)
T ss_dssp             HHHHHHHHHHC------------CCCEEEEETTCCHHHHHHHHHHHHTTSCEEEEECCC-----TTTSSCCHHHHHHTCC
T ss_pred             HHHHHHHCCCCCCCCHHCCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCC-----CCCCCCCHHHHHHHCC
T ss_conf             99875402434431000033237888799815532055579999986287399975643-----7888287999997368


Q ss_pred             CCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC----------CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEE
Q ss_conf             2540342156664323344378999999998637----------875784175023556888765223321026786899
Q T0591           177 AGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY----------GATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVT  246 (406)
Q Consensus       177 ~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~----------~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~  246 (406)
                      ++|+++.++..||.||...+   +++|+++|+++          ++++++|-++..    |.-+..+...   ..+  ++
T Consensus       174 ~~t~lv~~~~vsn~tG~~~p---l~~I~~l~~~~~~~~~~~~~~gi~~~vDaaq~~----g~~~~d~~~~---~~D--~~  241 (432)
T 3a9z_A          174 PTTCLVTIMLANNETGVIMP---ISEISRRIKALNQIRAASGLPRVLVHTDAAQAL----GKRRVDVEDL---GVD--FL  241 (432)
T ss_dssp             TTEEEEECCSBCTTTCBBCC---HHHHHHHHHHHHHHHHHHTCCCCEEEEECTTTT----TTSCCCHHHH---CCS--EE
T ss_pred             CCCEEEEEECCCCCCCCCCC---HHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHHC----CCCCCCHHHH---CCC--EE
T ss_conf             99528998668878761679---999999998765556650688528997503325----8756577890---898--89


Q ss_pred             EEECCHHCCCCCCCCHHHHHHHHHHHHHHHHH------HHCCCCHHHHHHH-HHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             85040010463112114332589999999875------2036761245799-9999985652589999999999999999
Q T0591           247 IMGPSKTESLSGYRLGVAFGSRAIIARMEKLQ------AIVSLRAAGYSQA-VLRGWFDEAPGWMEDRIARHQAIRDELL  319 (406)
Q Consensus       247 ~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~------~~~~~~~~~~~q~-a~~~~l~~~~~~~~~~~~~~~~~r~~l~  319 (406)
                      +.|..|.++ ||. .|.++........+....      .....+++.+... ++..+++-....++....+.+..++.+.
T Consensus       242 ~~s~hK~~g-p~~-~gl~~~~~~~~~~l~p~~~~g~~~~~~e~GT~n~~~~~~l~~Al~~~~~g~~~i~~~~~~l~~~l~  319 (432)
T 3a9z_A          242 TIVGHKFYG-PRI-GALYVRGVGKLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHMRDIRDYLE  319 (432)
T ss_dssp             EEEGGGTTC-CSC-EEEEETTBTTTBCCCCSCCSSCGGGGTSCSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCCEECC-CCC-EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             811655348-982-499997110104578856688766774788855889999999999999889999999999999999


Q ss_pred             HHHHHCCCCEEE----CCC----CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC-----------------
Q ss_conf             999727994553----588----7307877668878898999999998689189616102679-----------------
Q T0591           320 HVLRGCEGVFAR----TPQ----AGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH-----------------  374 (406)
Q Consensus       320 ~~L~~~~g~~~~----~p~----gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~-----------------  374 (406)
                      +.|....+..+.    .+.    .+. +-+.++.  .+..++. .++..+||.+..|+.+...                 
T Consensus       320 ~~L~~~~~~~i~~~~~~~~~~~~~~i-~~f~~~~--~~~~~~~-~~l~~~gI~v~~G~aC~~~~~~~~s~vL~~~g~~~~  395 (432)
T 3a9z_A          320 ERLEAEFGKRIHLNSRFPGVERLPNT-CNFSIQG--SQLRGYM-VLAQCQTLLASVGASCHSDHEDRPSPVLLSCGIPVD  395 (432)
T ss_dssp             HHHHHHHGGGEEESSCCTTCCBCTTE-EEEEECS--TTCCHHH-HHHHCSSEECBSSCGGGGGGTTSCCHHHHHTTCCHH
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCE-EEEEECC--CCHHHHH-HHHCCCCCEEECCHHHCCCCCCCCCHHHHHCCCCHH
T ss_conf             99871469589956888654465877-9999679--9989999-983529979977132178998876699997599877


Q ss_pred             -CCCEEEEEEC--CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             -9985899850--9979999999999999998569
Q T0591           375 -TADSVRLNFS--QDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       375 -~~~~iRis~~--~~~e~l~~al~rl~~~~~~~ra  406 (406)
                       ..+.||+||.  +++++++..++.|++.++++|+
T Consensus       396 ~~~g~vRvS~~~~nt~~dId~li~al~~~v~~L~~  430 (432)
T 3a9z_A          396 VARNAVRLSVGRSTTRAEVDLIVQDLKQAVNQLEG  430 (432)
T ss_dssp             HHTTEEEEECCTTCCHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             81978999768999999999999999999998669


No 88 
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-amino-7-ketopelargonate synthase, transferase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A*
Probab=99.87  E-value=9.7e-19  Score=144.64  Aligned_cols=324  Identities=13%  Similarity=0.087  Sum_probs=206.0

Q ss_pred             CEEECCCCC-CCCCCCHHHHHHHHHHHHCCCCCCCC---CCCCCH----HHHHHHHHHHHHHCCCCCCCCCEEEEECCCC
Q ss_conf             334156786-78878889999999999808788887---888898----8999999999986488678867078824872
Q T0591            40 PVDFSHGDV-DAHEPTPGAFDLFSAGVQSGGVQAYT---EYRGDL----GIRDLLAPRLAAFTGAPVDARDGLIITPGTQ  111 (406)
Q Consensus        40 ~i~ls~G~p-d~~~p~~~~~~~~~~~~~~~~~~~Y~---~~~G~~----~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~  111 (406)
                      .+||+.-+- .+ .-+|.+.+++.+++.+-+.. .+   -..|..    +|-+.+|+|    +|.    + ..++.+.+.
T Consensus        41 ~~~f~s~dYLGL-~~~p~v~~a~~~a~~~~G~~-~~~sr~~~g~~~~~~~LE~~lA~~----~g~----e-~al~~~SG~  109 (384)
T 1bs0_A           41 YLNFSSNDYLGL-SHHPQIIRAWQQGAEQFGIG-SGGSGHVSGYSVVHQALEEELAEW----LGY----S-RALLFISGF  109 (384)
T ss_dssp             EEECSCCCTTSG-GGCHHHHHHHHHHHHHHCSC-CCSBTTTTCCCHHHHHHHHHHHHH----HTC----S-EEEEESCHH
T ss_pred             EEEEECCCCCCC-CCCHHHHHHHHHHHHHHCCC-CCCCCHHCCCHHHHHHHHHHHHHH----HCC----C-CEEEECCCC
T ss_conf             999876541355-78989999999999983898-765320126619999999999998----399----8-389960540


Q ss_pred             HHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHH---CCCCEEEECCCCC
Q ss_conf             7899999999720010101310551389999982996999860446667766677889999985---0254034215666
Q T0591           112 GALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAF---KAGARVFLFSNPN  188 (406)
Q Consensus       112 ~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~---~~~~k~i~l~~P~  188 (406)
                      .+...++.+++.++|.|++..-.+......++..+.+.+..+           ..|++.+++.+   .++++++++....
T Consensus       110 ~an~~~~~al~~~~~~i~~d~~~h~s~~~g~~~~~~~~~~~~-----------hnd~~~le~~l~~~~~~~~~iv~e~v~  178 (384)
T 1bs0_A          110 AANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFA-----------HNDVTHLARLLASPCPGQQMVVTEGVF  178 (384)
T ss_dssp             HHHHHHHHHHCCTTCEEEEETTCCHHHHHHHHTSSSEEEEEC-----------TTCHHHHHHHHHSCCSSCEEEEEESBC
T ss_pred             HHHHHHHHHHHCCCCCEECCCCCHHHHHHHHHCCCCEEEEEC-----------CCCHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             357899999725787210332004999863522786289957-----------898999998754038997699981898


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHH
Q ss_conf             43233443789999999986378757841750235568887652233210267868998504001046311211433258
Q T0591           189 NPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSR  268 (406)
Q Consensus       189 NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~  268 (406)
                      |.+|.+.+   +++|+++|++|++++++||+|+...+...-.. .....  .....|++.|+||.++.+|   |+++++.
T Consensus       179 sm~G~i~p---l~~l~~l~~~y~~~livDeAh~~gv~G~~g~G-~~~~~--~~~~~i~~~t~~ka~g~~g---g~v~~~~  249 (384)
T 1bs0_A          179 SMDGDSAP---LAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRG-SCWLQ--KVKPELLVVTFGKGFGVSG---AAVLCSS  249 (384)
T ss_dssp             TTTCCBCC---HHHHHHHHHHTTCEEEEECTTTTTTSSGGGCC-HHHHT--TCCCSEEEEESSSTTSSCC---EEEEECH
T ss_pred             CCCCCCCC---HHHHHHHHHHCCCEEEEECCCEECEECCCCCC-CHHHH--CCCEEEEECCHHHHCCCCC---CEEECCC
T ss_conf             88887416---99999999975978998343111003688876-08770--8730466435544056666---6043451


Q ss_pred             HHHHHHHHHH-HHCCCCHHHHHHH-HHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCC
Q ss_conf             9999999875-2036761245799-999998565-258999999999999999999972799455358873078776688
Q T0591           269 AIIARMEKLQ-AIVSLRAAGYSQA-VLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPK  345 (406)
Q Consensus       269 ~~i~~l~~~~-~~~~~~~~~~~q~-a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~  345 (406)
                      ++++.+.... ......+.++... ++.+.++-. .....+.+++++++...+.+.|.++ |+.+...+ +..+-+.+.+
T Consensus       250 ~~~~~l~~~~~~~~~s~~~~p~~~aa~~~al~~l~~~~~~~~~~~l~~~~~~~~~~l~~~-g~~~~~~~-s~I~~v~~g~  327 (384)
T 1bs0_A          250 TVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDL-PFTLADSC-SAIQPLIVGD  327 (384)
T ss_dssp             HHHHHHHHHCHHHHSSBCCCHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHTTS-SCEECSCC-SSBCCEEEES
T ss_pred             HHHHHHHHHCHHHHHCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCC-CCEEEEEECC
T ss_conf             347999871535554347438999999999999984605678989999999998767753-98657999-8879999798


Q ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCCCC---CCCCEEEEEEC--CCHHHHHHHHHHHHHH
Q ss_conf             7889899999999868918961610267---99985899850--9979999999999999
Q T0591           346 LAVAPAEFVKILRLQAGVVVTPGTEFSP---HTADSVRLNFS--QDHEAAVAAARRIVTL  400 (406)
Q Consensus       346 ~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~---~~~~~iRis~~--~~~e~l~~al~rl~~~  400 (406)
                       .....++.+.|+ ++||.+.|-. | |   .+..-+|+++.  .++|++++.++-|...
T Consensus       328 -~~~a~~~~~~L~-~~Gi~v~~i~-~-PtVp~g~~~lRi~i~a~ht~edId~l~~~L~~~  383 (384)
T 1bs0_A          328 -NSRALQLAEKLR-QQGCWVTAIR-P-PTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGN  383 (384)
T ss_dssp             -HHHHHHHHHHHH-HTTEECCEEC-T-TSSCTTCEEECCBCCTTCCHHHHHHHHHHHHHH
T ss_pred             -HHHHHHHHHHHH-HCCEEEEEEC-C-CCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             -899999999999-7790699976-8-978999845999978779999999999999864


No 89 
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A*
Probab=99.87  E-value=6.6e-19  Score=145.76  Aligned_cols=322  Identities=14%  Similarity=0.140  Sum_probs=205.0

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHC
Q ss_conf             88999999999980878888788889889999999999864886788670788248727899999999720010101310
Q T0591            54 TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQP  133 (406)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P  133 (406)
                      ++.++++    +.....+++++.  ..++-+.+.+.+.+..|.+  ..+.|+++.|+|.++..++..++.+||+|++..-
T Consensus        31 ~~~V~~a----m~~~~~~hr~~~--f~~~~~~~r~~l~~ll~~~--~~~~i~~~gsgT~a~~a~~~~~~~~g~~vl~~~~  102 (393)
T 2huf_A           31 PQRVLDA----MSRPILGHLHPE--TLKIMDDIKEGVRYLFQTN--NIATFCLSASGHGGMEATLCNLLEDGDVILIGHT  102 (393)
T ss_dssp             CHHHHHH----TTSCCCCTTSHH--HHHHHHHHHHHHHHHHTCC--CSEEEEESSCHHHHHHHHHHHHCCTTCEEEEEES
T ss_pred             CHHHHHH----HCCCCCCCCCHH--HHHHHHHHHHHHHHHHCCC--CCCEEEEECCHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             9999997----476778878899--9999999999999995999--9868999282899999999983689998999607


Q ss_pred             CCHHH--HHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHH-HCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             55138--999998299699986044666776667788999998-502540342156664323344378999999998637
Q T0591           134 DYFAN--RKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEA-FKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY  210 (406)
Q Consensus       134 ~y~~~--~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~-~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~  210 (406)
                      .+.+.  ...++..|..++.++.+.      +..+|+++++++ .+++++++.++.-+|.||...+   +++|.++|+++
T Consensus       103 g~~~~~~~~~~~~~g~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~V~i~h~~t~tG~i~p---i~~I~~~~~~~  173 (393)
T 2huf_A          103 GHWGDRSADMATRYGADVRVVKSKV------GQSLSLDEIRDALLIHKPSVLFLTQGDSSTGVLQG---LEGVGALCHQH  173 (393)
T ss_dssp             SHHHHHHHHHHHHTTCEEEEEECCT------TCCCCHHHHHHHHHHHCCSEEEEESEETTTTEECC---CTTHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHCCEEEEEECCC------CCCCCHHHHHHHHHCCCCEEEEEECCCCCCCCCCC---HHHHHHHHHHC
T ss_conf             6288899999998399157630378------88658799999863389649999876777654278---99999999866


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHC-CCCCCCCHHHHHHHHHHHHHHHHHHH---------
Q ss_conf             87578417502355688876522332102678689985040010-46311211433258999999987520---------
Q T0591           211 GATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTE-SLSGYRLGVAFGSRAIIARMEKLQAI---------  280 (406)
Q Consensus       211 ~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~-~~~GlRiG~~~~~~~~i~~l~~~~~~---------  280 (406)
                      |+++++|.+.+.-    ..+-.+...     .--+++.|-.|.+ +.+|  +|+++..++.++.+......         
T Consensus       174 g~~~~vDa~qs~g----~~pid~~~~-----g~D~~~~s~~K~l~gp~G--~g~l~~~~~~~~~~~~~~~~~~~~~~~~~  242 (393)
T 2huf_A          174 NCLLIVDTVASLG----GAPMFMDRW-----EIDAMYTGSQKVLGAPPG--ITPVSFSHRAVERYKRRNTKVKVYYWDMS  242 (393)
T ss_dssp             TCEEEEECTTTBT----TBCCCTTTT-----TCSEEECCSSSTTCCCSS--CEEEEECHHHHHHHHTCSSCCSCGGGCHH
T ss_pred             CCEEEEECCHHCC----CCCCCHHCC-----CCCEEEECCCCCCCCCCC--EEEECCCHHHHHHHHCCCCCCCCCCCCHH
T ss_conf             9769987532116----753232115-----773686035542579982--55420388999876304876530132066


Q ss_pred             -------------CCCCHHHHH-HHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC--CCEEEEEEC
Q ss_conf             -------------367612457-99999998565-2589999999999999999999727994553588--730787766
Q T0591           281 -------------VSLRAAGYS-QAVLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ--AGSYLFPRL  343 (406)
Q Consensus       281 -------------~~~~~~~~~-q~a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~--gg~~~w~~~  343 (406)
                                   ...+++... ..+....+... ..-++...+++++..+.+.+.|.++....+..|+  ...-+.+.+
T Consensus       243 ~~~~~~~~~~~~~~~~~t~~~~~~~~l~~a~~~~~~~g~~~~~~~~~~l~~~l~~~l~~~~~~~~~~~~~rs~~v~~~~~  322 (393)
T 2huf_A          243 LVGDYWGCFGRPRIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIKV  322 (393)
T ss_dssp             HHHHHTTCSSSCCCCSCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHTTCCBSSCGGGBCTTEEEEEC
T ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCEECCCHHHCCCEEEEEEC
T ss_conf             65320013578875564451679999999999999616999999999999999999996698433595770872899989


Q ss_pred             CCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE-EC--CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             887889899999999868918961610267999858998-50--9979999999999999998569
Q T0591           344 PKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN-FS--QDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       344 ~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis-~~--~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      |+ +.+..++...|+++++|.+..|..  ....+.+|+| ++  .++|+++..++.|+++++++|.
T Consensus       323 p~-g~~~~~~~~~l~~~~~i~v~~g~~--~~~~~~~Ris~~G~~~t~edid~li~al~e~l~~l~~  385 (393)
T 2huf_A          323 PQ-GVDWLKAAQYAMKTYLVEISGGLG--PTAGQVFRIGLMGQNATTERVDRVLQVFQEAVAAVKP  385 (393)
T ss_dssp             CT-TCCHHHHHHHHHHHHCEECBCCCG--GGTTTEEEEECCGGGCSHHHHHHHHHHHHHHHHHHCC
T ss_pred             CC-CCCHHHHHHHHHHCCCEEEECCCC--HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             99-999999999998549999976671--1029989983787779999999999999999998488


No 90 
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3
Probab=99.86  E-value=1.2e-17  Score=137.24  Aligned_cols=324  Identities=15%  Similarity=0.181  Sum_probs=209.3

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCC-H------HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH----
Q ss_conf             888999999999980878888788889-8------89999999999864886788670788248727899999999----
Q T0591            53 PTPGAFDLFSAGVQSGGVQAYTEYRGD-L------GIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT----  121 (406)
Q Consensus        53 p~~~~~~~~~~~~~~~~~~~Y~~~~G~-~------~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l----  121 (406)
                      ++..+++++.+.+.....   .+..|. .      ++.+...+.+.+..|.+  .+++|++++++++++.+++..+    
T Consensus        40 ~p~~v~~~~~~~~~~~~~---n~~~~~~~~~~~~~~~~e~aR~~ia~~lga~--~~~~ii~~~~tt~a~~~~~~~~~~~~  114 (420)
T 1t3i_A           40 KPRAVLEKLMHYYENDNA---NVHRGAHQLSVRATDAYEAVRNKVAKFINAR--SPREIVYTRNATEAINLVAYSWGMNN  114 (420)
T ss_dssp             CCHHHHHHHHHHHHHTCC---CC--CCSHHHHHHHHHHHHHHHHHHHHTTCS--CGGGEEEESSHHHHHHHHHHHTHHHH
T ss_pred             CCHHHHHHHHHHHHHCCC---CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCC--CCCCEEEECCCHHHHHHHHHHCCCCC
T ss_conf             999999999999986689---8762251999999999999999999970979--84356985261789999986400012


Q ss_pred             HHCCHHHHHHHCCCHHH----HHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCH
Q ss_conf             72001010131055138----99999829969998604466677666778899999850254034215666432334437
Q T0591           122 VARGDKVAIVQPDYFAN----RKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSA  197 (406)
Q Consensus       122 ~~pGd~Vl~~~P~y~~~----~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~  197 (406)
                      ..+||+|++..-.|++.    ....+..|+++..+|.+.      ....+.+.+++.++++|+++.++.-+|-||..++ 
T Consensus       115 ~~~g~~i~~s~~e~~s~~~~~~~~~~~~g~~v~~~~~~~------~~~~~~~~l~~~i~~~t~lv~i~~~~~~~G~~~p-  187 (420)
T 1t3i_A          115 LKAGDEIITTVMEHHSNLVPWQMVAAKTGAVLKFVQLDE------QESFDLEHFKTLLSEKTKLVTVVHISNTLGCVNP-  187 (420)
T ss_dssp             CCTTCEEEEETTCCGGGTHHHHHHHHHHCCEEEEECBCT------TSSBCHHHHHHHCCTTEEEEEEESBCTTTCBBCC-
T ss_pred             CCCCCEEEECCCCCCCEEEHHHHHHCCCCCEEEEECCCC------CCCCHHHHHHHCCCCCCEEEEEECCCCCCCCCCH-
T ss_conf             689986771035550101104332202682577531212------2310498874402789569999712456543580-


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             89999999986378757841750235568887652233210267868998504001046311211433258999999987
Q T0591           198 EEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKL  277 (406)
Q Consensus       198 ~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~  277 (406)
                        +++|.++|+++|+++++|-+.+-    |.-+..+...   ..+  +++.|..|.+|-+|  +|+++..+++...+...
T Consensus       188 --~~~i~~~~~~~g~~~~vDaaq~~----g~~~ld~~~~---~~D--~~~~s~hK~~gp~G--~g~l~v~~~~~~~~~p~  254 (420)
T 1t3i_A          188 --AEEIAQLAHQAGAKVLVDACQSA----PHYPLDVQLI---DCD--WLVASGHKMCAPTG--IGFLYGKEEILEAMPPF  254 (420)
T ss_dssp             --HHHHHHHHHHTTCEEEEECTTTT----TTSCCCHHHH---TCS--EEEEEGGGTTSCTT--CEEEEECHHHHHHSCCC
T ss_pred             --HHHHHHHHHCCCCCEEEEEEEEE----EEEEECCCCC---CCC--EEECCCCCCCCCCC--CCCEEEEHHHHHCCCCC
T ss_conf             --88888887505863687521130----0676422246---875--46423544558985--32400100134228853


Q ss_pred             HH--------------------HCCCCHHHHH-HHHHHHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC-
Q ss_conf             52--------------------0367612457-9999999856525-89999999999999999999727994553588-
Q T0591           278 QA--------------------IVSLRAAGYS-QAVLRGWFDEAPG-WMEDRIARHQAIRDELLHVLRGCEGVFARTPQ-  334 (406)
Q Consensus       278 ~~--------------------~~~~~~~~~~-q~a~~~~l~~~~~-~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~-  334 (406)
                      ..                    ....++..+. ..++...++...+ -.++...+.....+.+.+.+.+.+++....|. 
T Consensus       255 ~~g~~~~~~~~~~~~~~~~~~~r~e~GT~~~~~~~al~~al~~~~~~g~~~i~~~~~~l~~~l~~~~~~~~~~~~~~~~~  334 (420)
T 1t3i_A          255 FGGGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTDLGMENIHNYEVELTHYLWQGLGQIPQLRLYGPNP  334 (420)
T ss_dssp             SCSTTSEEEECSSCEEECCTTGGGCCSSCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHTCTTEEEESCCG
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             27865555544555546774343247857899999999999999970879999999988899987640021113435775


Q ss_pred             -----CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCC------CCCCEEEEEEC--CCHHHHHHHHHHHHHHH
Q ss_conf             -----730787766887889899999999868918961610267------99985899850--99799999999999999
Q T0591           335 -----AGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSP------HTADSVRLNFS--QDHEAAVAAARRIVTLV  401 (406)
Q Consensus       335 -----gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~------~~~~~iRis~~--~~~e~l~~al~rl~~~~  401 (406)
                           ++. +-+.++  +.++.++...| .++||.+..|+.|..      ..++++|+|+.  +++++++..++.|++.+
T Consensus       335 ~~~~~~~i-v~f~~~--~~~~~~v~~~L-~~~gI~v~~G~~c~~~~~~~~~~~g~iRvS~~~ynt~~Did~lv~~L~~~l  410 (420)
T 1t3i_A          335 KHGDRAAL-ASFNVA--GLHASDVATMV-DQDGIAIRSGHHCTQPLHRLFDASGSARASLYFYNTKEEIDLFLQSLQATI  410 (420)
T ss_dssp             GGSCBCSE-EEEEET--TBCHHHHHHHH-HTTTEECBCSCTTCHHHHHHTTCCCCEEEECCTTCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCCEE-EEEEEC--CCCHHHHHHHH-HHCCCEEECCCCCCCHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             44675418-999969--98999999999-669969966743255878860689629997989999999999999999999


Q ss_pred             HHHC
Q ss_conf             9856
Q T0591           402 ERYR  405 (406)
Q Consensus       402 ~~~r  405 (406)
                      +.++
T Consensus       411 ~~~~  414 (420)
T 1t3i_A          411 RFFS  414 (420)
T ss_dssp             HHTC
T ss_pred             HHHH
T ss_conf             9963


No 91 
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A*
Probab=99.85  E-value=1.2e-17  Score=137.28  Aligned_cols=324  Identities=15%  Similarity=0.156  Sum_probs=202.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCCCCC--CCC--HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH-H
Q ss_conf             67887888999999999980878888788--889--889999999999864886788670788248727899999999-7
Q T0591            48 VDAHEPTPGAFDLFSAGVQSGGVQAYTEY--RGD--LGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT-V  122 (406)
Q Consensus        48 pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~--~G~--~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l-~  122 (406)
                      |..+.......+++.+.+.++....++..  .|-  .++-+++|+++    |..     ..+.++.+|.||.+++.++ +
T Consensus         9 p~~P~~~~~~~~~v~~~l~sg~~~~~~~~~~~g~~~~~fE~~~a~~~----g~k-----~ai~~~sgT~Al~lal~~l~~   79 (418)
T 2c81_A            9 PEWPQHSDRTRRKIEEVFQSNRWAISGYWTGEESMERKFAKAFADFN----GVP-----YCVPTTSGSTALMLALEALGI   79 (418)
T ss_dssp             CCSSCCCHHHHHHHHHHHHHTCCSTTSBCCSSCCHHHHHHHHHHHHH----TCS-----EEEEESCHHHHHHHHHHHTTC
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHH----CCC-----EEEEECCHHHHHHHHHHHCCC
T ss_conf             88999899999999999970980034740588979999999999987----979-----599976889999999998598


Q ss_pred             HCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             20010101310551389999982996999860446667766677889999985025403421566643233443789999
Q T0591           123 ARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQ  202 (406)
Q Consensus       123 ~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~  202 (406)
                      .+||+|+++..+|.+....+...|++++.+.++     ++.+.+|++.+++.++++|++++++   |..|....   +++
T Consensus        80 ~~gdeVi~p~~t~~a~~~~i~~~g~~pv~~Di~-----~~~~~~~~~~~~~~~~~~t~ai~~v---~~~G~~~d---~~~  148 (418)
T 2c81_A           80 GEGDEVIVPSLTWIATATAVLNVNALPVFVDVE-----ADTYCIDPQLIKSAITDKTKAIIPV---HLFGSMAN---MDE  148 (418)
T ss_dssp             CTTCEEEEESSSCTHHHHHHHHTTCEEEEECBC-----TTTCSBCHHHHGGGCCTTEEEECCB---CCTTCCCC---HHH
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCHHHHHCCCCCCCCCEEE---ECCCCCCH---HHH
T ss_conf             984999969976665102221233332223433-----2212355202332125530121345---31765215---999


Q ss_pred             HHHHHHHCCCEEEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHH-HHHHHHHHHHHHHH
Q ss_conf             9999863787578417502355-688876522332102678689985040010463112114332-58999999987520
Q T0591           203 IAALAARYGATVIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFG-SRAIIARMEKLQAI  280 (406)
Q Consensus       203 i~~~a~~~~~~ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~-~~~~i~~l~~~~~~  280 (406)
                      |.++|++||++||+|.+++... +++....       ...+  +.++||+..-.+++-.-|.++. ++++.+.++.++..
T Consensus       149 I~~ia~k~~i~vIeDaa~a~g~~~~~~~~g-------~~gd--~~~fSf~~~K~i~~geGG~i~t~d~~l~~~~~~lr~~  219 (418)
T 2c81_A          149 INEIAQEHNLFVIEDCAQSHGSVWNNQRAG-------TIGD--IGAFSCQQGKVLTAGEGGIIVTKNPRLFELIQQLRAD  219 (418)
T ss_dssp             HHHHHHHTTCEEEEECTTCTTCEETTEETT-------SSSS--EEEEECCTTSSSCSSSCEEEEESCHHHHHHHHHHHBT
T ss_pred             HHHHHHHCCCEEECCCCCCCCCCCCCEECC-------CCCE--EEECCCCCCEEEEECCCCCCCCCCCCCCCCHHCEEEC
T ss_conf             999998639668636431357515881424-------4642--4202455645786667732442232310010000423


Q ss_pred             C------------------------CC--CHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC-C
Q ss_conf             3------------------------67--6124579999999856525899999999999999999997279945535-8
Q T0591           281 V------------------------SL--RAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFART-P  333 (406)
Q Consensus       281 ~------------------------~~--~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~-p  333 (406)
                      .                        ..  ..+. .|.++  .+.+ -+.+.+..++.+++.+.+.+.|++++++.+.. |
T Consensus       220 g~~~~~~~~~~~~~~~~~~~~~~~~G~n~rm~~-i~Aai--g~~q-L~~l~~~~~~R~~~a~~y~~~L~~~~~i~~~~~~  295 (418)
T 2c81_A          220 SRVYCDDSSELMHGDMQLVKKGDIQGSNYCLSE-FQSAI--LLDQ-LQELDDKNAIREKNAMFLNDALSKIDGIKVMKRP  295 (418)
T ss_dssp             TEEECSCGGGCCTTCBSEEECCSSCCCBCCCCH-HHHHH--HHHH-HTTHHHHHHHHHHHHHHHHHHHTTSTTEEECCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCHHH--HHHH-HHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             544566543223234443212100022223321-20234--5545-5432121011101455554332134312344433


Q ss_pred             -C---CCEEEE-EECCC---CCCCHHHHHHHHHHHC---CEEEEECC-------CC---CCC-----------------C
Q ss_conf             -8---730787-76688---7889899999999868---91896161-------02---679-----------------9
Q T0591           334 -Q---AGSYLF-PRLPK---LAVAPAEFVKILRLQA---GVVVTPGT-------EF---SPH-----------------T  375 (406)
Q Consensus       334 -~---gg~~~w-~~~~~---~~~~~~~~~~~Ll~~~---gV~v~pG~-------~F---g~~-----------------~  375 (406)
                       .   .++|.+ +.++.   .+.+..++.+.|.++.   ++...|+.       .|   +..                 -
T Consensus       296 ~~~~~~~~~~~~i~~~~~~~~~~~Rd~l~~~L~~~~~~~~~~~~~~~~Plh~qP~y~~~~~~~~~~~~~~~~~~~~~~~~  375 (418)
T 2c81_A          296 PQVSRQTYYGYVFRFDPVKFGGLNADQFCEILREKLNMGTFYLHPPYLPVHKNPLFCPWTKNRYLKSVRKTEAYWRGLHY  375 (418)
T ss_dssp             TTEEECCCSEEEEEECGGGTTTCCHHHHHHHHHHHHTCCTTTEECCCCCGGGCTTCCGGGCTTSCHHHHCCHHHHHTCCC
T ss_pred             CCCCCCCCEEEEEEEEHHHCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCHHHHCCCCCCCCCCHHHHHCCCCCCCC
T ss_conf             33344430378999843541667999999999837799817978774502128333213543332210223202556888


Q ss_pred             -------CCEEEEEEC---CCHHHHHHHHHHHHHHHHHH
Q ss_conf             -------985899850---99799999999999999985
Q T0591           376 -------ADSVRLNFS---QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       376 -------~~~iRis~~---~~~e~l~~al~rl~~~~~~~  404 (406)
                             ...+.|..-   +++++++.-++.|.+++++|
T Consensus       376 P~ae~l~~~~i~LP~~~~lt~~~~i~~ii~~i~kv~kk~  414 (418)
T 2c81_A          376 PVSERASGQSIVIHHAILLAEPSHLSLLVDAVAELARKF  414 (418)
T ss_dssp             HHHHHHHHHEEEEEGGGGGSCHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHCEEECCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             679999709699538988897999999999999999986


No 92 
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, cytoplasm, one-carbon metabolism, pyridoxal phosphate; HET: MSE; 1.80A {Salmonella typhimurium} PDB: 1dfo_A* 3g8m_A* 1eqb_A*
Probab=99.85  E-value=6.3e-19  Score=145.90  Aligned_cols=336  Identities=13%  Similarity=0.095  Sum_probs=196.7

Q ss_pred             CEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC---CCCHH--HHHHHH-HHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             3341567867887888999999999980878888788---88988--999999-99998648867886707882487278
Q T0591            40 PVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEY---RGDLG--IRDLLA-PRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        40 ~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~---~G~~~--Lr~aia-~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      -|+|-..+   ...+|.+.+++...+...-..+|+-.   .|...  ..|.+| +...+.+|.+   ..+|.+++| +++
T Consensus        32 ~l~l~ase---n~~s~~~~~~~~~~~~~~y~~g~~~~r~~~G~~~~~~~E~la~e~~~~lfga~---~a~v~~~SG-t~A  104 (420)
T 3gbx_A           32 HIELIASE---NYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGAD---YANVQPHSG-SQA  104 (420)
T ss_dssp             SEECCTTC---CCCCHHHHHHHTSGGGGCCC--------------CHHHHHHHHHHHHHHHTCS---EEECCCSSH-HHH
T ss_pred             CEEEECCC---CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC---CEEEEECCH-HHH
T ss_conf             85786068---87999999998577625366889976355764879999999999999983999---648981888-999


Q ss_pred             HHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHH-----CCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             99999999720010101310551389999982-----9969998604466677666778899999850254034215666
Q T0591           114 LFLAVAATVARGDKVAIVQPDYFANRKLVEFF-----EGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPN  188 (406)
Q Consensus       114 l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~-----g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~  188 (406)
                      ...++.++++|||+|++....+..+.......     ..+.++.+.      ...+.+|++++++.+.+.++.++++.+|
T Consensus       105 n~~~~~al~~pgd~il~~~~~h~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~iD~~~l~~~~~~~~~~vii~~~s  178 (420)
T 3gbx_A          105 NFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGI------DESGKIDYDEMAKLAKEHKPKMIIGGFS  178 (420)
T ss_dssp             HHHHHHHHCCTTCEEEEEEEC------------CHHHHSEEEEEEE------CTTCSCCHHHHHHHHHHHCCSEEEECCT
T ss_pred             HHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHHCCCEEEEEECCC------CCCCCCCHHHHHHHCCCCCCEEEEECCC
T ss_conf             9999999708998254466247999999999975487457865797------7223538999998544369879996478


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCC-CCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHH
Q ss_conf             4323344378999999998637875784175023-556888765223321026786899850400104631121143325
Q T0591           189 NPAGVVYSAEEIGQIAALAARYGATVIADQLYSR-LRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS  267 (406)
Q Consensus       189 NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~-l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~  267 (406)
                      |..+..    ++++|.++|+++|+++++|+++.. +.+.+....+.   .  ..  -++.+|++|.++.||  -|.++..
T Consensus       179 ~~~~~~----dl~~i~~ia~~~g~~l~~D~Ah~~G~~~~~~~~~~~---~--~a--Di~s~s~hK~l~~~~--Gg~i~~~  245 (420)
T 3gbx_A          179 AYSGVV----DWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPV---P--HA--HVVTTTTHKTLAGPR--GGLILAK  245 (420)
T ss_dssp             TCCSCC----CHHHHHHHHHHTTCEEEEECTTTHHHHHTTSSCCST---T--TS--SEEEEESSGGGCSCS--CEEEEES
T ss_pred             CCCCCC----CHHHHHHHHHHCCCEEECCHHHHCCCCCCCCCCCCC---C--EE--EEEEEECCCCCCCCC--CEEEEEE
T ss_conf             788752----899999778776978980123331451468778863---3--34--699932642357997--5699982


Q ss_pred             ---HHHHHHHHHHHHHCCCCHHHHH-HHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC-CCCCEEEEE
Q ss_conf             ---8999999987520367612457-999999985-6525899999999999999999997279945535-887307877
Q T0591           268 ---RAIIARMEKLQAIVSLRAAGYS-QAVLRGWFD-EAPGWMEDRIARHQAIRDELLHVLRGCEGVFART-PQAGSYLFP  341 (406)
Q Consensus       268 ---~~~i~~l~~~~~~~~~~~~~~~-q~a~~~~l~-~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~-p~gg~~~w~  341 (406)
                         ................+.+... ..+...++. .......+..++...+.+.+.+.+... ++.+.. +.....+|+
T Consensus       246 ~~~~~~~~~~~~~~~~~~~~~~~~~~iaa~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~-~~~v~~~~~~~~~v~~  324 (420)
T 3gbx_A          246 GGDEELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNR-GYKVVSGGTENHLFLL  324 (420)
T ss_dssp             SCCHHHHHHHHHHHC----CCCCHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHHHHHHHHHHT-TCEEGGGSCSSSEEEE
T ss_pred             CHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCCEEEEE
T ss_conf             508899887404516733378569999999999999847448999999999999999888754-9764689987748999


Q ss_pred             ECCCCCCCHHHHHHHHHHHCCEEEEEC----CCCCCCCCCEEEEEEC------CCHHHHHHHHHHHHHHHHH
Q ss_conf             668878898999999998689189616----1026799985899850------9979999999999999998
Q T0591           342 RLPKLAVAPAEFVKILRLQAGVVVTPG----TEFSPHTADSVRLNFS------QDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       342 ~~~~~~~~~~~~~~~Ll~~~gV~v~pG----~~Fg~~~~~~iRis~~------~~~e~l~~al~rl~~~~~~  403 (406)
                      ++...+.+..++.. +|+++||.+..+    ..-.+..+..+|+++.      ..++++++..+.|.++++.
T Consensus       325 ~~~~~~~~~~~~~~-~L~~~GI~v~~~~~p~~~~~~~~~~~lRig~~~~tt~G~~e~d~~~ia~~i~~~l~~  395 (420)
T 3gbx_A          325 DLVDKNLTGKEADA-ALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDN  395 (420)
T ss_dssp             ECGGGTCCHHHHHH-HHHHTTEECEEECCTTCSSCTTTCSEEEEECHHHHHTTCCHHHHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHH-HHHHCCCEECCCCCCCCCCCCCCCCCEEECCCHHHCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             83788989999999-999778988757777986776677742404606540799989999999999999961


No 93 
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate- loop, pyridoxal phosphate, selenocysteine synthase (SECS; HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A*
Probab=99.84  E-value=3.7e-19  Score=147.49  Aligned_cols=312  Identities=12%  Similarity=0.043  Sum_probs=188.3

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH-HHHHHHH---HCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEEC
Q ss_conf             889999999999864886788670788248727899-9999997---200101013105513899999829969998604
Q T0591            80 LGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF-LAVAATV---ARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLD  155 (406)
Q Consensus        80 ~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~-~~~~~l~---~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~  155 (406)
                      ..+...+..|+.+..|.+.. . ..++++|++++-. +++.++.   ..++.|+++...+.+....+..+|++++.|+..
T Consensus        97 ~~~~~~~~~~~~~~~g~~~~-~-~~~~~~~~tg~~~~~~l~a~~~~~~~~~~vi~~~~~h~s~~k~~~~~g~~~~~v~~~  174 (450)
T 3bc8_A           97 NKITNSLVLNVIKLAGVHSV-A-SCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENV  174 (450)
T ss_dssp             HHHHHHHHHHHHHHHTCTTC-C-EEEEESSCHHHHHHHHHHHHHHHCTTCCEEEEECCCCHHHHHHHHHTTCEEEEECCE
T ss_pred             HHHHHHHHHHHHHHCCCCCC-C-CEEEECCHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHCCCEEEEEEEE
T ss_conf             99999999999985299745-6-654607337999999999999837999989987411699999999849968999755


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCC----CCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             4666776667788999998502----540342156664323344378999999998637875784175023556888765
Q T0591           156 YVSADETRAGLDLTGLEEAFKA----GARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYT  231 (406)
Q Consensus       156 ~~~~~~~~~~~d~~~l~~~~~~----~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~  231 (406)
                      .   ++..+.+|+++|++++++    .+.+++.++|+|++|..-   ++++|.++|++||+++++|+||+....   ...
T Consensus       175 ~---~~~~~~~d~~~l~~~i~~~~~~~~~~v~~~~~~~~~g~~~---~l~~i~~i~~~~~~~l~vD~A~g~~~~---~~~  245 (450)
T 3bc8_A          175 L---EGDELRTDLKAVEAKIQELGPEHILCLHSTTACFAPRVPD---RLEELAVICANYDIPHVVNNAYGLQSS---KCM  245 (450)
T ss_dssp             E---ETTEEECCHHHHHHHHHHHCGGGEEEEEEESSCCTTBCCC---CHHHHHHHHHHHTCCEEEECTTTTTCH---HHH
T ss_pred             E---CCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCEEH---HHHHHHHHHHHHCCEEEEECCCHHHHH---HHH
T ss_conf             0---4744565999999999874556707999807988886142---699999999985987999657677755---403


Q ss_pred             CHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             22332102678689985040010463112114332589999999875203676124579999999856525899999999
Q T0591           232 HLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARH  311 (406)
Q Consensus       232 ~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~  311 (406)
                      ...........--++..|.+|.++.|+...+.+..++++++.+...........+...+.+....+.  ..-........
T Consensus       246 ~~~~~~~~~~~~d~~~~s~hK~~~~p~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~lg--~~~~~~~~~~~  323 (450)
T 3bc8_A          246 HLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLG--CSGYRKLLKER  323 (450)
T ss_dssp             HHHHHHHHHSCCCEEEEEHHHHHSCCSSCEEEEESCHHHHHHHHHHSCSCBCSHHHHHHHHHHHHHH--HHHHHHHHHHH
T ss_pred             HCCCCCCCCCCEEEEEECCCCCCCCCCCCEEEEECCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH--HHHHHHHHHHH
T ss_conf             1264556647612899528765667988515886698999999987167666762489999999998--86317899999


Q ss_pred             HHHHHHHHHHHHHC---CCCEEE-CCCC--CEEEEEE-CC-CCCCCHHHHHHHHHHHCCEEE----EEC----------C
Q ss_conf             99999999999727---994553-5887--3078776-68-878898999999998689189----616----------1
Q T0591           312 QAIRDELLHVLRGC---EGVFAR-TPQA--GSYLFPR-LP-KLAVAPAEFVKILRLQAGVVV----TPG----------T  369 (406)
Q Consensus       312 ~~~r~~l~~~L~~~---~g~~~~-~p~g--g~~~w~~-~~-~~~~~~~~~~~~Ll~~~gV~v----~pG----------~  369 (406)
                      .++.+.+.+.|..+   .+.... .|..  .+.+++. +. ..+.+..++...| .+.||..    .++          .
T Consensus       324 ~~~a~~l~~~L~~l~~~~~~~~l~~~~~~~s~~~~l~~~~~~~~~~~~~l~~~L-~~~gI~g~~v~~~~~~~~~~~~~~~  402 (450)
T 3bc8_A          324 KEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTQLGSML-FTRQVSGARAVPLGNVQTVSGHTFR  402 (450)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCBCCCTTCSSEEEEECTTTSSSSSCHHHHHHHHH-HHTTCCSCEEECSCCEEEETTEEEE
T ss_pred             HHHHHHHHHHHHHHHHHCCCEECCCCCCCCEEEEEEEEECCCCCCCHHHHHHHH-HHCCCCEEEEECCHHHCEECCEEEC
T ss_conf             999999999999888751825357877764268998740677877999999999-9539750233211201612435420


Q ss_pred             CCCCCC----CCEEEEEEC--CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             026799----985899850--997999999999999999856
Q T0591           370 EFSPHT----ADSVRLNFS--QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       370 ~Fg~~~----~~~iRis~~--~~~e~l~~al~rl~~~~~~~r  405 (406)
                      .|+...    ..++|++++  .++|+++..+++|+++++++|
T Consensus       403 ~~~~~~~~~~~~~i~i~~s~~~T~edID~~v~~L~kvl~~~r  444 (450)
T 3bc8_A          403 GFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIVR  444 (450)
T ss_dssp             TTTTTSSCCSSCEEEEECCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             345556667787699983489999999999999999999986


No 94 
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase, propargylglycine; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A*
Probab=99.84  E-value=4.8e-17  Score=133.16  Aligned_cols=290  Identities=15%  Similarity=0.123  Sum_probs=176.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHH----HHHC
Q ss_conf             888788889889999999999864886788670788248727899999999720010101310551389999----9829
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLV----EFFE  146 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~----~~~g  146 (406)
                      +-|+- .|.|. ++++.+.+....|.    + ..++++.++.|+..++.+++.|||+|++....|......+    ...|
T Consensus        54 ~~Y~R-~~nPt-~~~LE~~lA~leg~----e-~al~~sSGmaAi~~al~all~~GD~vv~~~~~~~~t~~~~~~~~~~~g  126 (404)
T 1e5e_A           54 YIYTR-LGNPT-VSNLEGKIAFLEKT----E-ACVATSSGMGAIAATVLTILKAGDHLISDECLYGCTHALFEHALTKFG  126 (404)
T ss_dssp             CCBTT-TCCHH-HHHHHHHHHHHHTC----S-EEEEESSHHHHHHHHHHHHCCTTCEEEEESCCCHHHHHHHHTHHHHTT
T ss_pred             CEECC-CCCHH-HHHHHHHHHHHHCC----C-EEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCC
T ss_conf             61338-98868-99999999998699----8-299977999999999999857999899827975068999998763468


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEECCCCCCCCC
Q ss_conf             9699986044666776667788999998502540342156664323344378999999998637-875784175023556
Q T0591           147 GEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY-GATVIADQLYSRLRY  225 (406)
Q Consensus       147 ~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~-~~~ii~De~Y~~l~~  225 (406)
                      .++..++           .-|++++++++++++|+|++.+|+||+|.+.+   +++|+++|+++ ++++++|+.+..-. 
T Consensus       127 v~v~~~d-----------~~d~e~i~~ai~~~tklV~~E~psnp~~~v~D---i~~ia~iA~~~~g~~vvvD~t~a~~~-  191 (404)
T 1e5e_A          127 IQVDFIN-----------TAIPGEVKKHMKPNTKIVYFETPANPTLKIID---MERVCKDAHSQEGVLVIADNTFCSPM-  191 (404)
T ss_dssp             CEEEEEC-----------TTSTTHHHHHCCTTEEEEEEESSCTTTCCCCC---HHHHHHHHHTSTTCEEEEECTTTCTT-
T ss_pred             EEEEECC-----------CCCHHHHHHHCCCCCCEEEEECCCCCCCCCCC---HHHHHHHHHHCCCCEEEEECCCCCCE-
T ss_conf             6999759-----------99999999746778868999689898875148---99999996342695899978978752-


Q ss_pred             CCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHHHHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHHCCCH
Q ss_conf             888765223321026786899850400104631-1211433258999999987520--3676124579999999856525
Q T0591           226 AGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAFGSRAIIARMEKLQAI--VSLRAAGYSQAVLRGWFDEAPG  302 (406)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~~~~~i~~l~~~~~~--~~~~~~~~~q~a~~~~l~~~~~  302 (406)
                         ...++ ..+ .|    |+++|+||.++-.| .-.|+++++++++..++.....  .....+..   .+..++.. -+
T Consensus       192 ---~~~p~-~~G-aD----ivv~S~tK~l~Gh~d~~gG~v~~~~~~i~~~r~~~~~~~~G~~l~p~---~A~ll~rg-l~  258 (404)
T 1e5e_A          192 ---ITNPV-DFG-VD----VVVHSATKYINGHTDVVAGLICGKADLLQQIRMVGIKDITGSVISPH---DAWLITRG-LS  258 (404)
T ss_dssp             ---TCCGG-GGT-CS----EEEEETTTTTTCSSCCCCEEEEECHHHHHHHHHTCCCCCCCCCCCHH---HHHHHHHH-HT
T ss_pred             ---ECCCC-CCC-EE----EEECCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCHH---HHHHHHCC-CC
T ss_conf             ---12543-013-37----99825733367888843589724231599999999863668858989---99999805-89


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCC-EEECCC-----------------CCEEEEEECCCCCCCHHHHHHHHHHHCCEE
Q ss_conf             89999999999999999999727994-553588-----------------730787766887889899999999868918
Q T0591           303 WMEDRIARHQAIRDELLHVLRGCEGV-FARTPQ-----------------AGSYLFPRLPKLAVAPAEFVKILRLQAGVV  364 (406)
Q Consensus       303 ~~~~~~~~~~~~r~~l~~~L~~~~g~-~~~~p~-----------------gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~  364 (406)
                      -+..+.++..++...+.+.|.+.+.+ ++..|.                 ||++.+ .+.    ++.+.+.++++.-.+.
T Consensus       259 tl~~R~~~~~~nA~~la~~L~~~p~V~~V~yp~l~s~p~~~~~~~~~~g~g~~~sf-~~~----~~~~~a~~f~~~l~l~  333 (404)
T 1e5e_A          259 TLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDHEGHDIAKKQMRMYGSMITF-ILK----SGFEGAKKLLDNLKLI  333 (404)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHTCTTEEEEECTTCSSSTTHHHHHHHCSSCCSEEEE-EET----THHHHHHHHHHTCSSS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHCCCCCCCEEE-EEC----CCHHHHHHHHHCCCCC
T ss_conf             78999999999999999999849993167468888883199999756689861388-876----8699999999728855


Q ss_pred             EEECCCCCC-------------------------CCCCEEEEEECC-CHH----HHHHHHHHHHHHH
Q ss_conf             961610267-------------------------999858998509-979----9999999999999
Q T0591           365 VTPGTEFSP-------------------------HTADSVRLNFSQ-DHE----AAVAAARRIVTLV  401 (406)
Q Consensus       365 v~pG~~Fg~-------------------------~~~~~iRis~~~-~~e----~l~~al~rl~~~~  401 (406)
                      - .|..+|.                         -.++.||||++. +.|    ++++|+++|.+..
T Consensus       334 ~-~~~slG~~~sLi~~~a~~~h~~~~~~~~~~~Gi~~~liRlSvGlE~~~dLi~Dl~~AL~a~~~~~  399 (404)
T 1e5e_A          334 T-LAVSLGGCESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLDALLRSH  399 (404)
T ss_dssp             E-ESSCCCSSSCEEECGGGTTTTTSCHHHHHHTTCCTTEEEEECCSSCHHHHHHHHHHHHHHHHCC-
T ss_pred             E-EEECCCCCCEEEECCCCCCCCCCCHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             4-85567777504448620055338999999769893949999256999999999999999998640


No 95 
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal phosphate dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A*
Probab=99.84  E-value=6e-17  Score=132.52  Aligned_cols=336  Identities=13%  Similarity=0.075  Sum_probs=198.7

Q ss_pred             CEEECCCCC-CCCCCCHHHHHHHHHHHHCCCCCCCC--CCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             334156786-78878889999999999808788887--888898899999999998648867886707882487278999
Q T0591            40 PVDFSHGDV-DAHEPTPGAFDLFSAGVQSGGVQAYT--EYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        40 ~i~ls~G~p-d~~~p~~~~~~~~~~~~~~~~~~~Y~--~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      .++|+.-+- .+. -.|.+.+++.++++.-+....+  -..|...+-+.+-+.+.+.+|.    ++-+++++| -.+-..
T Consensus        48 ~~~FsSndYLGL~-~~p~v~~a~~~a~~~~G~g~~~Sr~~~G~~~~h~~LE~~lA~~~g~----e~al~~~sG-~~an~~  121 (401)
T 2bwn_A           48 ITVWCGNDYLGMG-QHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQK----EAALVFSSA-YNANDA  121 (401)
T ss_dssp             EEECSCSCTTSGG-GCHHHHHHHHHHHHHHCSCCCSBTTTBCCBHHHHHHHHHHHHHTTC----SEEEEESCH-HHHHHH
T ss_pred             EEEEECCCCCCCC-CCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC----CCCCCCCCC-HHHHHH
T ss_conf             9998852001768-9999999999999985898746523328857899999999997699----850101221-477888


Q ss_pred             HHHHH--HHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHH---CCCCEEEECC-CCCCC
Q ss_conf             99999--720010101310551389999982996999860446667766677889999985---0254034215-66643
Q T0591           117 AVAAT--VARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAF---KAGARVFLFS-NPNNP  190 (406)
Q Consensus       117 ~~~~l--~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~---~~~~k~i~l~-~P~NP  190 (406)
                      ++.++  ..+||.|+...-.+.+....+++.+++.+...-           -|++.+++.+   .+..+.++++ .--.-
T Consensus       122 ~i~~l~~~~~~d~i~~D~~~HaSi~~g~~ls~a~~~~f~H-----------nd~~~l~~~~~~~~~~~~~~iv~egvySm  190 (401)
T 2bwn_A          122 TLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRH-----------NDVAHLRELIAADDPAAPKLIAFESVYSM  190 (401)
T ss_dssp             HHHHHHHHSTTCEEEEETTCCHHHHHHHHHSCCCEEEECT-----------TCHHHHHHHHHHSCTTSCEEEEEESBCTT
T ss_pred             HHHHHHHCCCCCCEECHHHHHHHCCHHHHHCCCCEEEEEC-----------CCHHHHHHHHHHHCCCCCEEEEEEEECCC
T ss_conf             9998872568984443524144112044305685367406-----------72676677666404656506999753057


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHH
Q ss_conf             23344378999999998637875784175023556888765223321026786899850400104631121143325899
Q T0591           191 AGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAI  270 (406)
Q Consensus       191 TG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~  270 (406)
                      +|.+.+   +.+|++++++|+.++++||+|+.-++...-........ ...+..|++.||||.||..|   ||+++++++
T Consensus       191 dGdiap---L~~l~~l~~~y~~~L~vDeAHs~Gv~G~~G~G~~~~~g-~~~~vdi~~~tlsKA~Gs~G---G~v~g~~~~  263 (401)
T 2bwn_A          191 DGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDG-LMHRIDIFNGTLAKAYGVFG---GYIAASARM  263 (401)
T ss_dssp             TCCBCC---HHHHHHHHHHHTCEEEEECTTTTTTSSTTSCCHHHHHT-CGGGCSEEEEESSSTTCSCC---EEEEECHHH
T ss_pred             CCCCCC---HHHHHHHHHCCCEEEEEECCEEEEEECCCCCCCHHHCC-CCCCCCEECCCCCCCCCCCC---CCCCHHHHH
T ss_conf             643364---38776654125328998432024410378874045409-85101200024555553356---412003789


Q ss_pred             HHHHHHHHH-HCCCCHHHHHHHH-HHHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCC
Q ss_conf             999998752-0367612457999-9999856-525899999999999999999997279945535887307877668878
Q T0591           271 IARMEKLQA-IVSLRAAGYSQAV-LRGWFDE-APGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLA  347 (406)
Q Consensus       271 i~~l~~~~~-~~~~~~~~~~q~a-~~~~l~~-~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~  347 (406)
                      ++.++.... ++.+.+.++.+.+ +...++- ......+.+..++.+.+.+...+... |+.+...+ +--+-+-+.+ .
T Consensus       264 i~~l~~~~~~~ifS~~lpp~~~aa~~~~l~l~~~~~~~~~r~~l~~~~~~~~~~l~~~-g~~~~~~~-spI~pi~~g~-~  340 (401)
T 2bwn_A          264 VDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL-GMPIIDHG-SHIVPVVIGD-P  340 (401)
T ss_dssp             HHHHHHHCHHHHTSBCCCHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHHHHHHHHHH-TCCBCCCS-SSCEEEECCC-H
T ss_pred             HHHHHHCCCHHHHCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCC-CCEEEEEECC-H
T ss_conf             9998740313441456878999999998766303117788887678999999999967-99868999-9979999699-9


Q ss_pred             CCHHHHHHHHHHHCCEEEEECCCC--CCCCCCEEEEEEC--CCHHHHHHHHHHHHHHHHH
Q ss_conf             898999999998689189616102--6799985899850--9979999999999999998
Q T0591           348 VAPAEFVKILRLQAGVVVTPGTEF--SPHTADSVRLNFS--QDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       348 ~~~~~~~~~Ll~~~gV~v~pG~~F--g~~~~~~iRis~~--~~~e~l~~al~rl~~~~~~  403 (406)
                      ....+++++|++++||.+.|-. |  =+.+...+|+++.  .++++++..++.|+++..|
T Consensus       341 ~~~~~~~~~lL~e~Gi~v~~i~-yPtVp~g~~rlRi~lsa~ht~~dId~l~~~L~~~~~~  399 (401)
T 2bwn_A          341 VHTKAVSDMLLSDYGVYVQPIN-FPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWAR  399 (401)
T ss_dssp             HHHHHHHHHHHHHHCEECCEEC-TTTSCTTCCEEEECCCTTSCHHHHHHHHHHHHHHC--
T ss_pred             HHHHHHHHHHHHHCCEEEEEEC-CCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             9999999999996898999976-8978999727999747668999999999999999985


No 96 
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579}
Probab=99.83  E-value=7.9e-20  Score=152.03  Aligned_cols=230  Identities=14%  Similarity=0.106  Sum_probs=155.5

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEE---EECCCCHHHHHHHHHHHHCCHHHHHHH-CCCHHHHHHHHH----------HCC
Q ss_conf             999999999986488678867078---824872789999999972001010131-055138999998----------299
Q T0591            82 IRDLLAPRLAAFTGAPVDARDGLI---ITPGTQGALFLAVAATVARGDKVAIVQ-PDYFANRKLVEF----------FEG  147 (406)
Q Consensus        82 Lr~aia~~~~~~~g~~~~~~~~I~---it~G~~~~l~~~~~~l~~pGd~Vl~~~-P~y~~~~~~~~~----------~g~  147 (406)
                      -|+++-+.+.+.+|.+    +-++   +++| ++++..++.+++.|||+|++.+ +.|..+...+..          .|.
T Consensus        66 gre~LE~~~A~l~GaE----aAlvrp~f~SG-t~Ai~~al~alL~pGDeVI~~~g~~y~tl~~vig~~~~~~~~L~~~Gi  140 (431)
T 3ht4_A           66 GRDTLEKVYADVFGAE----AGLVRPQIISG-THAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNI  140 (431)
T ss_dssp             HHHHHHHHHHHHTTCS----EECCBTTSCSH-HHHHHHHHHTTCCTTCEEEECSSSCCTTHHHHTTSSSCSSSCSGGGTC
T ss_pred             HHHHHHHHHHHHHCCC----CEEEECCCCCH-HHHHHHHHHHHCCCCCEEEEECCCCCCHHHHCCCCCCHHHHHHHHCCC
T ss_conf             4999999999972986----16763465776-999999999717899989993498763021002410112566886394


Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCC-CCCCCCCHHHHHHHHHHHHHC--CCEEEECCCCCCCC
Q ss_conf             699986044666776667788999998502540342156664-323344378999999998637--87578417502355
Q T0591           148 EMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNN-PAGVVYSAEEIGQIAALAARY--GATVIADQLYSRLR  224 (406)
Q Consensus       148 ~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~N-PTG~~~s~~~l~~i~~~a~~~--~~~ii~De~Y~~l~  224 (406)
                      +...+++.      .+...|++.++++++++||++++.+|+| +++.+++.+++++|+++|+++  ++++++|++|..+.
T Consensus       141 ~~~~v~~~------~~~~~Dle~l~~aI~~~TklV~Ie~s~ny~~~p~~~i~dI~~I~~lak~~~~~viv~vDn~~g~~~  214 (431)
T 3ht4_A          141 GYNAVPLT------EGGLVDFEAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFI  214 (431)
T ss_dssp             EEEECCBC------TTSSBCHHHHHHHCCTTEEEEEEECSCTTSSSCCCCHHHHHHHHHHHHHHCTTCEEEEECTTCTTS
T ss_pred             EEEECCCC------CCCCCCHHHHHHHCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             45511456------677448999997338878679998257767899777877999999999758998899546655532


Q ss_pred             CCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCH-HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHH
Q ss_conf             68887652233210267868998504001046311211-43325899999998752036761245799999998565258
Q T0591           225 YAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLG-VAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGW  303 (406)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG-~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~  303 (406)
                      ....+   +.  ..  .  -++++|+||.++..|.++| |+++++++++++.........+...-........+-.+-..
T Consensus       215 ~~~~P---l~--~G--a--Div~~SlsK~lgG~gap~GG~I~G~keLIe~~~~~ltapg~g~~~g~~~~~~~~~~~gl~~  285 (431)
T 3ht4_A          215 EEQEP---CH--VG--A--DLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFL  285 (431)
T ss_dssp             SSCCG---GG--TT--C--SEEEEETTSGGGTTTCSSCEEEEECHHHHHHHHHHHSCTTTTTSCSCCCSCSHHHHHHHHH
T ss_pred             CCCCC---HH--HC--C--CEEEEEEHHHCCCCCCCEEEEEECCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCHHH
T ss_conf             24560---76--47--7--7799970341677766655999828999999999842887554431377899998615788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             99999999999999999997279945535
Q T0591           304 MEDRIARHQAIRDELLHVLRGCEGVFART  332 (406)
Q Consensus       304 ~~~~~~~~~~~r~~l~~~L~~~~g~~~~~  332 (406)
                      ..++..+..+.+..+.+.|.++ |+.+.+
T Consensus       286 ap~~~~~a~k~a~~~a~~le~l-G~~v~P  313 (431)
T 3ht4_A          286 APHVAGQALKGAIFTAAFLEKL-GMNTSP  313 (431)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH-TCCEES
T ss_pred             HHHHHHHHHHHHHHHHHHHHHC-CCEECC
T ss_conf             9999999999899999999976-983079


No 97 
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, joint center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} PDB: 3kgx_A 1h0c_A* 1j04_A*
Probab=99.83  E-value=4.2e-17  Score=133.56  Aligned_cols=321  Identities=12%  Similarity=0.088  Sum_probs=203.0

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHC
Q ss_conf             88999999999980878888788889889999999999864886788670788248727899999999720010101310
Q T0591            54 TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQP  133 (406)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P  133 (406)
                      +|.+++++    .....+++++.  ..++-+.+.+.+.+..|.+-  ...|++|.|+|.++..++..++.+||+|++..-
T Consensus        35 ~~~Vl~am----~~~~i~hrs~e--f~~i~~~~r~~l~~l~~~~~--~~~iif~gsgT~a~~a~~~~~~~~~~~vl~~~~  106 (393)
T 3kgw_A           35 APRVLAAG----SLRMIGHMQKE--MLQIMEEIKQGIQYVFQTRN--PLTLVVSGSGHCAMETALFNLLEPGDSFLTGTN  106 (393)
T ss_dssp             CHHHHHHT----TCCCCCTTSHH--HHHHHHHHHHHHHHHHTCCC--SEEEEESCCTTTHHHHHHHHHCCTTCEEEEEES
T ss_pred             CHHHHHHH----CCCCCCCCCHH--HHHHHHHHHHHHHHHHCCCC--CCEEEECCCHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             99999974----76888878889--99999999999999968999--858997796899999999970277882443215


Q ss_pred             CCHHHH--HHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             551389--9999829969998604466677666778899999850-2540342156664323344378999999998637
Q T0591           134 DYFANR--KLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY  210 (406)
Q Consensus       134 ~y~~~~--~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~  210 (406)
                      .++...  ......+...+.+..+.      +...|.++.+..+. .++++++++.-+|.||...+   +++|.++|+++
T Consensus       107 g~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~v~~~~~~~~tG~~~p---i~~I~~~~~~~  177 (393)
T 3kgw_A          107 GIWGMRAAEIADRIGARVHQMIKKP------GEHYTLQEVEEGLAQHKPVLLFLVHGESSTGVVQP---LDGFGELCHRY  177 (393)
T ss_dssp             SHHHHHHHHHHHHTTCEEEEEECCT------TCCCCHHHHHHHHHHHCCSEEEEESEETTTTEECC---CTTHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHCCCEEEECCCC------CCCCCHHHHHHHHHCCCCCEEEEECEEEEEEECCC---HHHHHHHHHHC
T ss_conf             5146689999998099502204788------88779899999874599738998331331231377---99999999874


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCC-CCCCHHHHHHHHHHHHHHHHHH----------
Q ss_conf             87578417502355688876522332102678689985040010463-1121143325899999998752----------
Q T0591           211 GATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLS-GYRLGVAFGSRAIIARMEKLQA----------  279 (406)
Q Consensus       211 ~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~-GlRiG~~~~~~~~i~~l~~~~~----------  279 (406)
                      ++.+++|.+.+.-    .....+.     ..+--+++.|-.|.++.| |  +|+++..+...+.......          
T Consensus       178 g~~~~vD~~~s~g----~~~~~~~-----~~~~d~~~~s~~K~l~~p~G--~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  246 (393)
T 3kgw_A          178 QCLLLVDSVASLG----GVPIYMD-----QQGIDIMYSSSQKVLNAPPG--ISLISFNDKAKYKVYSRKTKPVSFYTDIT  246 (393)
T ss_dssp             TCEEEEECTTTTT----TSCCCTT-----TTTCCEEEEESSSTTCCCSS--CEEEEECHHHHHHHHTCSSCCSCSTTCHH
T ss_pred             CCEEEEEECCCCC----CEEECCC-----CCCCCEEEECCHHHCCCCCC--EEEEEECHHHHHHHHHCCCCCCCCCCCHH
T ss_conf             9807997134655----0000012-----36875897434132279986--79999767887533201246743222011


Q ss_pred             -----H-------CCCCH-HHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEE-CCC--CCEEEEEE
Q ss_conf             -----0-------36761-245799999998565-2589999999999999999999727994553-588--73078776
Q T0591           280 -----I-------VSLRA-AGYSQAVLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFAR-TPQ--AGSYLFPR  342 (406)
Q Consensus       280 -----~-------~~~~~-~~~~q~a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~-~p~--gg~~~w~~  342 (406)
                           .       ...++ +.....++...+... ..-+....++.+++.+.+.+.+......... .|.  ....+-+.
T Consensus       247 ~~~~~~~~~~~~~~~~~t~~~~~i~~~~~~l~~~~~~g~~~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~rs~~i~~~~  326 (393)
T 3kgw_A          247 YLAKLWGCEGETRVIHHTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLPTITTVT  326 (393)
T ss_dssp             HHHHHTTCSSSCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHTTCCBSSSSGGGBCSSEEEEE
T ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCEECCCCHHHCCCCEEEEE
T ss_conf             13444300024676478773668989999999999703068999999999999999985587000588676588089998


Q ss_pred             CCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE-EC--CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             6887889899999999868918961610267999858998-50--997999999999999999856
Q T0591           343 LPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN-FS--QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       343 ~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis-~~--~~~e~l~~al~rl~~~~~~~r  405 (406)
                      +|+ +.++.++...|++++||.+..|...  ...+.+|+| ++  ++.|+++..++.|++++++++
T Consensus       327 ~p~-~~~~~~~~~~l~~~~~I~v~~G~~~--~~~~~~Ris~~g~~~t~edi~~lv~alk~~l~~l~  389 (393)
T 3kgw_A          327 VPA-GYNWRDIVSYVLDHFSIEISGGLGP--TEERVLRIGLLGYNATTENVDRVAEALREALQHCP  389 (393)
T ss_dssp             CCT-TBCHHHHHHHHHHHHCEECBCCCGG--GTTTEEEEECCGGGCCHHHHHHHHHHHHHHHHHSC
T ss_pred             CCC-CCCHHHHHHHHHHCCCEEEECCCCC--CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             899-9899999999974399899567723--45998999577565999999999999999999876


No 98 
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3
Probab=99.82  E-value=1.9e-16  Score=129.19  Aligned_cols=283  Identities=18%  Similarity=0.208  Sum_probs=179.8

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHH----
Q ss_conf             7888878888988999999999986488678867078824872789999999972001010131055138999998----
Q T0591            69 GVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEF----  144 (406)
Q Consensus        69 ~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~----  144 (406)
                      ..+.|+- .|.|. ++++.+.+....|.    + ..++++.+..|+..++.+++.+||+|++....|......+..    
T Consensus        42 ~~~~Y~R-~~nPt-~~~le~~la~LEg~----~-~a~~fsSGMAAi~~~l~~ll~~gd~vv~~~~~yg~t~~~~~~~~~~  114 (386)
T 1cs1_A           42 RAHDYSR-RGNPT-RDVVQRALAELEGG----A-GAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKR  114 (386)
T ss_dssp             CSCSBTT-TCCHH-HHHHHHHHHHHHTC----S-EEEEESSHHHHHHHHHHHHCCTTCEEEEETTCCHHHHHHHHHHHTT
T ss_pred             CCCCCCC-CCCHH-HHHHHHHHHHHHCC----C-CEEEECCHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHCCC
T ss_conf             6874308-98878-99999999998399----8-3788357799999999972379988996167547548887520346


Q ss_pred             HCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCC
Q ss_conf             29969998604466677666778899999850254034215666432334437899999999863787578417502355
Q T0591           145 FEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLR  224 (406)
Q Consensus       145 ~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~  224 (406)
                      .|.+...+.           ..|.+.+++.++++||+||+-+|.|||..+..   +++|+++|+++|+++++|+.+.--.
T Consensus       115 ~gi~~~~~d-----------~~d~~~~~~~~~~~t~~i~~EtpsNP~l~v~D---i~~i~~ia~~~g~~~vVDnT~atP~  180 (386)
T 1cs1_A          115 GCYRVLFVD-----------QGDEQALRAALAEKPKLVLVESPSNPLLRVVD---IAKICHLAREVGAVSVVDNTFLSPA  180 (386)
T ss_dssp             TSCEEEEEC-----------TTCHHHHHHHHHTCCSEEEEECSCTTTCCCCC---HHHHHHHHHHTTCEEEEECTTTCTT
T ss_pred             CEEEEEEEC-----------CCCHHHHHHHCCCCCEEEEECCCCCCCCCCCC---HHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             549999702-----------89889999860888608997168997543355---8999888987498699978855813


Q ss_pred             CCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHHH-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCH
Q ss_conf             6888765223321026786899850400104631-12114332-589999999875203676124579999999856525
Q T0591           225 YAGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAFG-SRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPG  302 (406)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~-~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~  302 (406)
                      +    ..++ ..+ .|    |+++|.||.++-.| .=.|.+++ ++++.+.+...+.......+......+..-++    
T Consensus       181 ~----~~Pl-~~G-aD----ivvhS~TKy~~GhsDv~~G~v~~~~~~~~~~~~~~~~~~G~~~~p~da~ll~rgl~----  246 (386)
T 1cs1_A          181 L----QNPL-ALG-AD----LVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLR----  246 (386)
T ss_dssp             T----CCGG-GGT-CS----EEEEETTTTTTCSSCCCCEEEEESSHHHHHHHHHHHHHHTCBCCHHHHHHHHHHHT----
T ss_pred             C----CCCC-CCC-CC----EEEECCCEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCC----
T ss_conf             3----4441-148-98----99972551106887655675456846766566665412465454232899974213----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCE-EECC-----------------CCCEEEEEECCCCCCCHHHHHHHHHHHCCEE
Q ss_conf             899999999999999999997279945-5358-----------------8730787766887889899999999868918
Q T0591           303 WMEDRIARHQAIRDELLHVLRGCEGVF-ARTP-----------------QAGSYLFPRLPKLAVAPAEFVKILRLQAGVV  364 (406)
Q Consensus       303 ~~~~~~~~~~~~r~~l~~~L~~~~g~~-~~~p-----------------~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~  364 (406)
                      -+..+.++..++...+.+.|.+.+.+. +..|                 -||++.+. +.    .+.+-+.++++.-.+.
T Consensus       247 TL~lRm~~~~~nA~~lA~~L~~hp~V~~V~yPgl~s~p~h~l~~~~~~g~gg~~sf~-~~----~~~~~a~~f~~~l~l~  321 (386)
T 1cs1_A          247 TLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFE-LD----GDEQTLRRFLGGLSLF  321 (386)
T ss_dssp             THHHHHHHHHHHHHHHHHHHTTCTTEEEEECTTSTTSTTHHHHHHHCSSCCSEEEEE-ES----SCHHHHHHHHHTCSSS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHCCCCCCEEEEEE-EC----CCHHHHHHHHHHCCCC
T ss_conf             203189999999999999985089876885789888803777863158985277642-05----9899999999708826


Q ss_pred             EEECCCCCC-------------------------CCCCEEEEEECC-CHHHHHH
Q ss_conf             961610267-------------------------999858998509-9799999
Q T0591           365 VTPGTEFSP-------------------------HTADSVRLNFSQ-DHEAAVA  392 (406)
Q Consensus       365 v~pG~~Fg~-------------------------~~~~~iRis~~~-~~e~l~~  392 (406)
                      . .|..+|.                         -.++.||+|++. +.|+|.+
T Consensus       322 ~-~a~SlGg~eSLi~~p~~~th~~~~~e~r~~~Gi~~~liRlSvGlEd~eDLi~  374 (386)
T 1cs1_A          322 T-LAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIA  374 (386)
T ss_dssp             E-EBSCCCSSSCEEEEGGGTTTTTSCHHHHHHHTCCTTEEEEECCSSCHHHHHH
T ss_pred             E-ECCCCCCCCCEEECCCCCCCCCCCHHHHHHCCCCCCEEEEEECCCCHHHHHH
T ss_conf             4-5636687651430673124522799999866989296999970199999999


No 99 
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A*
Probab=99.82  E-value=4.6e-16  Score=126.50  Aligned_cols=289  Identities=17%  Similarity=0.213  Sum_probs=184.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHH----HHC
Q ss_conf             8887888898899999999998648867886707882487278999999997200101013105513899999----829
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVE----FFE  146 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~----~~g  146 (406)
                      +.|+-. |.|. ++++.+.+....|.    + ..++++.+..|+..++.+++.+||+|+++...|..-...+.    ..|
T Consensus        56 ~~YsR~-gnPT-~~~LE~~la~LEg~----~-~a~~~sSGmaAi~~~l~~l~~~Gd~vl~~~~~Yg~t~~~~~~~l~~~G  128 (398)
T 2rfv_A           56 YIYTRL-GNPT-TDALEKKLAVLERG----E-AGLATASGISAITTTLLTLCQQGDHIVSASAIYGCTHAFLSHSMPKFG  128 (398)
T ss_dssp             CSBTTT-CCHH-HHHHHHHHHHHHTC----S-EEEEESSHHHHHHHHHHHHCCTTCEEEEESSSCHHHHHHHHTHHHHTT
T ss_pred             CEEECC-CCHH-HHHHHHHHHHHHCC----C-HHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHCCCC
T ss_conf             665289-8878-99999999998698----4-066666789999999962568999899853124304577776521387


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCC
Q ss_conf             96999860446667766677889999985025403421566643233443789999999986378757841750235568
Q T0591           147 GEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYA  226 (406)
Q Consensus       147 ~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~  226 (406)
                      .++..+.           .-|+++++++++++||+||+-+|.|||..+..   +++|+++|+++|+.+++|..+..-.  
T Consensus       129 i~~~~~d-----------~~d~~~~~~~i~~~Tklv~~EspsNP~l~v~D---i~~ia~ia~~~g~~~vvDNT~atP~--  192 (398)
T 2rfv_A          129 INVRFVD-----------AAKPEEIRAAMRPETKVVYIETPANPTLSLVD---IETVAGIAHQQGALLVVDNTFMSPY--  192 (398)
T ss_dssp             CEEEEEC-----------TTSHHHHHHHCCTTEEEEEEESSBTTTTBCCC---HHHHHHHHHHTTCEEEEECTTTCTT--
T ss_pred             EEEEECC-----------CCCHHHHHHHCCCCCCEEEECCCCCCCCCCCC---CHHHHHHHHHCCCEEECCCCCCCCE--
T ss_conf             4787328-----------99999999747777608994289998565256---5999998732297697148631731--


Q ss_pred             CCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHHHHHHHHHHHH--HHHHHCCCCHHHHHHHHHHHHHHCCCHH
Q ss_conf             88765223321026786899850400104631-12114332589999999--8752036761245799999998565258
Q T0591           227 GASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAFGSRAIIARME--KLQAIVSLRAAGYSQAVLRGWFDEAPGW  303 (406)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~~~~~i~~l~--~~~~~~~~~~~~~~q~a~~~~l~~~~~~  303 (406)
                        -..++ ..+ .|    |+++|.||.++-.| .=.|.+++..+.+...+  .++.......++.....+..-|    +-
T Consensus       193 --~~~Pl-~~G-aD----ivihS~TKyi~GhsD~l~G~v~~~~~~~~~~r~~~~r~~~G~~~~p~~a~l~~rgL----~T  260 (398)
T 2rfv_A          193 --CQQPL-QLG-AD----IVVHSVTKYINGHGDVIGGIIVGKQEFIDQARFVGLKDITGGCMSPFNAWLTLRGV----KT  260 (398)
T ss_dssp             --TCCGG-GGT-CS----EEEEETTTTTTCSSCCCCEEEEECHHHHHHHHHTHHHHTTCCCCCHHHHHHHHHHH----TT
T ss_pred             --ECCCH-HCC-CC----EEEEECCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCC----CC
T ss_conf             --32313-228-98----89981443426887545432347899999999999998338988989999997681----75


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCC-EEECC-----------------CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEE
Q ss_conf             9999999999999999999727994-55358-----------------87307877668878898999999998689189
Q T0591           304 MEDRIARHQAIRDELLHVLRGCEGV-FARTP-----------------QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVV  365 (406)
Q Consensus       304 ~~~~~~~~~~~r~~l~~~L~~~~g~-~~~~p-----------------~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v  365 (406)
                      +.-+.++..++...+.+.|.+.+.+ .+..|                 .||++.| .+.    ++.+-+.++++.-.+.-
T Consensus       261 L~lRm~~~~~nA~~lA~~L~~hp~V~~V~yPgl~s~p~h~~~~~~~~g~gg~~sf-~l~----~~~e~~~~f~~~L~l~~  335 (398)
T 2rfv_A          261 LGIRMERHCENALKIARFLEGHPSITRVYYPGLSSHPQYELGQRQMSLPGGIISF-EIA----GGLEAGRRMINSVELCL  335 (398)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCTTEEEEECTTSTTSTTHHHHHHHCSSCCSEEEE-EET----THHHHHHHHHTTCSSSE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHCCCCCCEEEEE-EEC----CCHHHHHHHHHCCCCCC
T ss_conf             8999999999999999999749996767378867883255665217898859999-966----98999999997188250


Q ss_pred             EECCCCCC-------------------------CCCCEEEEEECC-CHHHHHHHHHHHHHHHHH
Q ss_conf             61610267-------------------------999858998509-979999999999999998
Q T0591           366 TPGTEFSP-------------------------HTADSVRLNFSQ-DHEAAVAAARRIVTLVER  403 (406)
Q Consensus       366 ~pG~~Fg~-------------------------~~~~~iRis~~~-~~e~l~~al~rl~~~~~~  403 (406)
                       .+..+|.                         -.++.||||++. +.|+|.+   -|.+++++
T Consensus       336 -~a~SlGg~eSLi~~pa~~~h~~~~~e~r~~~Gi~~~liRlSvGlEd~~DLi~---Dl~~AL~~  395 (398)
T 2rfv_A          336 -LAVSLGDTETLIQHPASMTHSPVAPEERLKAGITDGLIRLSVGLEDPEDIIN---DLEHAIRK  395 (398)
T ss_dssp             -ECSCCSSSSCEEECHHHHTSSSSCHHHHHHTTCCTTEEEEECCSSCHHHHHH---HHHHHHHH
T ss_pred             -EEECCCCCCCEEECCCCCCCCCCCHHHHHHCCCCCCEEEEEEEECCHHHHHH---HHHHHHHH
T ss_conf             -3136375230534753126656999999965979296999850099999999---99999997


No 100
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, pyridoxal-5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis S2} SCOP: c.67.1.9
Probab=99.82  E-value=8.5e-18  Score=138.27  Aligned_cols=302  Identities=15%  Similarity=0.047  Sum_probs=175.7

Q ss_pred             HHHHHH-HHHHHHCCCCCCCCCEEEEECCCCHH-HHHHHHHHH--HCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCC
Q ss_conf             999999-99998648867886707882487278-999999997--20010101310551389999982996999860446
Q T0591            82 IRDLLA-PRLAAFTGAPVDARDGLIITPGTQGA-LFLAVAATV--ARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYV  157 (406)
Q Consensus        82 Lr~aia-~~~~~~~g~~~~~~~~I~it~G~~~~-l~~~~~~l~--~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~  157 (406)
                      +.+.++ .|+ +..|.+.    ..+++++++++ +.+++.++-  .+++.|+++.-.+.+....+.++|++++.|+... 
T Consensus       134 ~~~~~~~~~~-~~~g~~~----~~~~~~~~tG~~~~l~l~a~~~~~~~~~Vi~~~~~H~S~~kai~~aG~~~v~v~~~~-  207 (456)
T 2z67_A          134 LTNKILESFF-KQLGLNV----HAIATPISTGMSISLCLSAARKKYGSNVVIYPYASHKSPIKAVSFVGMNMRLVETVL-  207 (456)
T ss_dssp             HHHHHHHHHH-HHTTCCC----EEEEESSCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHTTCEEEEECCEE-
T ss_pred             HHHHHHHHHH-HHHCCCC----CEEECCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHCCCEEEEEECEE-
T ss_conf             9999999999-9848996----078747674999999999963168999899726216779999998699799983622-


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCC--EEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHH
Q ss_conf             6677666778899999850254--03421566643233443789999999986378757841750235568887652233
Q T0591           158 SADETRAGLDLTGLEEAFKAGA--RVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRA  235 (406)
Q Consensus       158 ~~~~~~~~~d~~~l~~~~~~~~--k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~  235 (406)
                        ++..+.+|+++|++++++.+  +.+++..|.||+......+++++|+++|++||+++++|++|+.+...   ......
T Consensus       208 --~~~~~~~d~~~le~~i~~~~~~~~i~~v~~t~~~~~~g~~ddi~eIa~l~~~~gi~livD~A~g~~~~~---~~~~~~  282 (456)
T 2z67_A          208 --DGDRVYVPVEDIENAIKKEIELGNRPCVLSTLTFFPPRNSDDIVEIAKICENYDIPHIINGAYAIQNNY---YLEKLK  282 (456)
T ss_dssp             --ETTEEECCHHHHHHHHHHHHHTTCCEEEEEESSCCTTBCCCCHHHHHHHHHHHTCCEEEECTTTTTCHH---HHHHHH
T ss_pred             --CCCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCEEEEECCCCHHCCC---CCCCCC
T ss_conf             --362357699999999985735482699982689878886247999999999809979998987100103---444541


Q ss_pred             HHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             21026786899850400104631121143325899999998752036761245799999998565258999999999999
Q T0591           236 EAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIR  315 (406)
Q Consensus       236 ~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r  315 (406)
                      . .....--+++.|+.|.+..|.-..++.+.++++++.+.+.........+.....+....+  +....++..++..+++
T Consensus       283 ~-~~~~gvD~vv~S~hK~l~~p~G~g~v~~~~~~~~~~v~~~~~~~~~~s~~~~~~a~l~~~--g~~~~~~~~~~~~~~~  359 (456)
T 2z67_A          283 K-AFKYRVDAVVSSSDKNLLTPIGGGLVYSTDAEFIKEISLSYPGRASATPVVNTLVSLLSM--GSKNYLELVKNQKNSK  359 (456)
T ss_dssp             H-HHTSCCSEEEEEHHHHHCCCSSCEEEEESCHHHHHHHHTTSCSCBCSHHHHHHHHHHHHH--HHHHHHHHHHHHHHHH
T ss_pred             C-HHHCCCCEEEECCCCCCCCCCCCEEEEECCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH--HHHHHHHHHHHHHHHH
T ss_conf             0-221687589971876666787813999778779999998722688872799999999999--8861056899999999


Q ss_pred             HHHHHHHHHC---CCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEE----EECCCCC-----CCCCCEEEEEE
Q ss_conf             9999999727---9945535887307877668878898999999998689189----6161026-----79998589985
Q T0591           316 DELLHVLRGC---EGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVV----TPGTEFS-----PHTADSVRLNF  383 (406)
Q Consensus       316 ~~l~~~L~~~---~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v----~pG~~Fg-----~~~~~~iRis~  383 (406)
                      +.+.+.|+++   .|..+.....-....+.+   ..+..++...| .+.||..    .+...++     .....++|+++
T Consensus       360 ~~l~~~L~~l~~~~g~~i~~~~~~i~~~i~~---~~d~~~l~~~L-~~~gVsG~~v~~~~~~~g~~~~~~~~~~yl~~~~  435 (456)
T 2z67_A          360 KLLDELLNDLSKKTGGKFLDVESPIASCISV---NSDPVEIAAKL-YNLRVTGPRGIKKTDHFGNCYLGTYTHDYIVMNA  435 (456)
T ss_dssp             HHHHHHHHHHHHHSSCCBCCCCCSSEEEEEC---SSCHHHHHHHH-HHTTEESCEEECTTCHHHHTCSSCCSCCEEEEEC
T ss_pred             HHHHHHHHHHHCCCCCEECCCCCCCEEEEEC---CCCHHHHHHHH-HHCCCCHHHHHHHCCCCCCEEECCCCCCEEEEEC
T ss_conf             9999999740344780536788875010112---66889999999-9759815788763210480685215778089982


Q ss_pred             C--CCHHHHHHHHHHHHHHH
Q ss_conf             0--99799999999999999
Q T0591           384 S--QDHEAAVAAARRIVTLV  401 (406)
Q Consensus       384 ~--~~~e~l~~al~rl~~~~  401 (406)
                      +  .++|+++.-+++|++++
T Consensus       436 sig~T~eDId~~v~~L~kiL  455 (456)
T 2z67_A          436 AIGVRTEDIVNSVSKLEKIL  455 (456)
T ss_dssp             CTTCCHHHHHHHHHHHHTC-
T ss_pred             CCCCCHHHHHHHHHHHHHHH
T ss_conf             48999999999999998975


No 101
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotransferase; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis; HET: PLP; 1.91A {Salmonella typhimurium LT2} PDB: 2pb0_A*
Probab=99.82  E-value=2.8e-16  Score=127.98  Aligned_cols=333  Identities=13%  Similarity=0.113  Sum_probs=204.5

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.|||..|  ...+-+-.|.+.+++.+++....  ..+... ..+.+..+|+++....+     .+.+..+++++++...
T Consensus        58 ~ylD~~~g~g~~~lGh~~p~i~~Av~~q~~~~~--~~~~~~-~~~~~~~lae~L~~~~~-----~~~~~f~~sGsea~e~  129 (420)
T 2pb2_A           58 EYIDFAGGIAVTALGHCHPALVEALKSQGETLW--HTSNVF-TNEPALRLGRKLIDATF-----AERVLFMNSGTEANET  129 (420)
T ss_dssp             EEEESSHHHHTCTTCBTCHHHHHHHHHHHTTCC--CCCTTS-CCHHHHHHHHHHHHHSS-----CSEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCC--CCCCCC-CCHHHHHHHHHHHCCCC-----CCCEEECCCCCHHHHH
T ss_conf             999953088877645896999999999986677--776631-38999999999861067-----0006542565278789


Q ss_pred             HHHHH---H----HC-CHHHHHHHCCCHHHHHHHH-HHCC------------EEEEEEECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999---7----20-0101013105513899999-8299------------6999860446667766677889999985
Q T0591           117 AVAAT---V----AR-GDKVAIVQPDYFANRKLVE-FFEG------------EMVPVQLDYVSADETRAGLDLTGLEEAF  175 (406)
Q Consensus       117 ~~~~l---~----~p-Gd~Vl~~~P~y~~~~~~~~-~~g~------------~~v~v~~~~~~~~~~~~~~d~~~l~~~~  175 (406)
                      ++...   .    .+ ...|+....+|++...... ..|-            ....+|           ..|.+.+++.+
T Consensus       130 a~~~a~~~~~~~~~~~r~~ii~~~g~yHG~t~~~~~~tg~~~~~~~~~~~~~~~~~~p-----------~~~~~~~~~~~  198 (420)
T 2pb2_A          130 AFKLARHYACVRHSPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVP-----------FNDLHAVKAVM  198 (420)
T ss_dssp             HHHHHHHHHHHHTCTTCCEEEEETTCCCCSSHHHHHHSSCHHHHTTSSSCCSCEEEEC-----------TTCHHHHHHHC
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEC-----------CCCHHHHHHHC
T ss_conf             9999998776427999867999968806885554246799544578889999869954-----------88328999844


Q ss_pred             CCCCEEEECCCC--CCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHH
Q ss_conf             025403421566--643233443789999999986378757841750235568887652233210267868998504001
Q T0591           176 KAGARVFLFSNP--NNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKT  253 (406)
Q Consensus       176 ~~~~k~i~l~~P--~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~  253 (406)
                      ++++.++++ -|  .|---...+++.+++|.++|++||+++|.||++..|.-.|..+..-  .....||    +-++||.
T Consensus       199 ~~~iAavii-EPi~g~~G~~~~~~~yl~~l~~lc~~~gillI~DEV~tGfGRtG~~~~~~--~~~v~PD----i~~~gK~  271 (420)
T 2pb2_A          199 DDHTCAVVV-EPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYM--HYGVTPD----ILTSAKA  271 (420)
T ss_dssp             CTTEEEEEE-CSEETTTTSEECCHHHHHHHHHHHHHTTCEEEEECTTTTTTTTSSSSHHH--HHTCCCS----EEEECGG
T ss_pred             CCCEEEEEE-ECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCC--CCCCCCC----EEEEEEC
T ss_conf             897689999-64568889816999999999999998499899615550778226765333--6772334----4788320


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             04631121143325899999998752036761245799999998565--2589999999999999999999727994553
Q T0591           254 ESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEGVFAR  331 (406)
Q Consensus       254 ~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~  331 (406)
                      ++ .|+-+|.+++.+++.+.+.......+++.++++..++.+.|+..  +...++..+.-+..++.+.+...+.+.+...
T Consensus       272 l~-gG~p~~av~~~~~i~~~~~~~~~~~T~~g~pla~aaa~a~L~~i~~~~~~~~~~~~g~~l~~~l~~l~~~~~~i~~V  350 (420)
T 2pb2_A          272 LG-GGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDI  350 (420)
T ss_dssp             GG-TTSCCEEEEECHHHHTTCC----CCEECCCHHHHHHHHHHHHHHSSHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEE
T ss_pred             CC-CCCCCCCEECCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             35-87655431223767624477776778899815666667778888755799999999999999999998648981677


Q ss_pred             CCCCCEEEEEECCC-CCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             58873078776688-7889899999999868918961610267999858998--509979999999999999998569
Q T0591           332 TPQAGSYLFPRLPK-LAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       332 ~p~gg~~~w~~~~~-~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      ...| ++.-+.+.. ......+++..++ ++|+++.|.      +.+.+|++  +..+++++++++++|.+.+++.-|
T Consensus       351 rg~G-lm~~i~~~~~~~~~~~~~~~~~~-e~Gll~~~~------g~~~ir~~PpL~it~~eId~~l~~l~~al~~vlA  420 (420)
T 2pb2_A          351 RGMG-LLIGAELKPKYKGRARDFLYAGA-EAGVMVLNA------GADVMRFAPSLVVEEADIHEGMQRFAQAVGKVVA  420 (420)
T ss_dssp             EEET-TEEEEEECGGGTTCHHHHHHHHH-HTTEECEES------STTEEEECCCTTCCHHHHHHHHHHHHHHHHHHHC
T ss_pred             EEEC-EEEEEEEECCCHHHHHHHHHHHH-HCCCEEECC------CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             6435-49999984783579999999999-789489427------9998999389778999999999999999999729


No 102
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), structural genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii}
Probab=99.81  E-value=5.2e-17  Score=132.92  Aligned_cols=325  Identities=11%  Similarity=0.054  Sum_probs=193.0

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHH---C-----
Q ss_conf             88899999999998087888878888988999999999986488678867078824872789999999972---0-----
Q T0591            53 PTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVA---R-----  124 (406)
Q Consensus        53 p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~---p-----  124 (406)
                      ++|...+++...+.. ....+....|...+-+.+.+|+.+..|.+   +...++|+|+|++...++.+..+   .     
T Consensus        42 ~~~~a~~~~~~~~~~-n~~~~~~~p~~~~le~~v~~~la~l~g~~---~a~g~ftsGgT~an~~al~~ar~~~~~~~~~~  117 (397)
T 3f9t_A           42 VLPITRKIVDIFLET-NLGDPGLFKGTKLLEEKAVALLGSLLNNK---DAYGHIVSGGTEANLMALRCIKNIWREKRRKG  117 (397)
T ss_dssp             CCTHHHHHHHHHTTC-CTTSGGGBHHHHHHHHHHHHHHHHHTTCT---TCEEEEESCHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHH-CCCCCCCCHHHHHHHHHHHHHHHHHHCCC---CCCEEEECCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             279999999999986-69983117889999999999999982999---77079845762888999999887521222002


Q ss_pred             -----CHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCE-EEECCCCCCCCCCCCCHH
Q ss_conf             -----01010131055138999998299699986044666776667788999998502540-342156664323344378
Q T0591           125 -----GDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGAR-VFLFSNPNNPAGVVYSAE  198 (406)
Q Consensus       125 -----Gd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k-~i~l~~P~NPTG~~~s~~  198 (406)
                           ...|+++.-.+.+....++..|.+++.++++      .++.+|++.+++.+.+.++ +++.+.++|+||.+.+  
T Consensus       118 ~~~~~~~~il~~~~~H~s~~kaa~~~G~~~~~v~~~------~~~~id~~~l~~~~~~~~~~~vv~~~~~t~~G~~~~--  189 (397)
T 3f9t_A          118 LSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPIK------EDYTIDEKFVKDAVEDYDVDGIIGIAGTTELGTIDN--  189 (397)
T ss_dssp             CCCCSSCEEEEETTCCTHHHHHHHHHTCEEEEECBC------TTSSBCHHHHHHHHHHSCCCEEEEEBSCTTTCCBCC--
T ss_pred             CCCCCCCEEEECCCHHHHHHHHHHHCCCEEEEEEEC------CCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCEEC--
T ss_conf             257868679984631667777777508614787304------554468888754431012342101443156551221--


Q ss_pred             HHHHHHHHHHHCCCEEEECCCCCCCC--CCCCCCCCH--HHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHH-HHHHHH
Q ss_conf             99999999863787578417502355--688876522--3321026786899850400104631121143325-899999
Q T0591           199 EIGQIAALAARYGATVIADQLYSRLR--YAGASYTHL--RAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS-RAIIAR  273 (406)
Q Consensus       199 ~l~~i~~~a~~~~~~ii~De~Y~~l~--~~~~~~~~~--~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~-~~~i~~  273 (406)
                       +++|.++|++||+++++|.+|+...  |........  .........--.+..|.+|.++.| ..+|+++.. +.+.+.
T Consensus       190 -l~~I~~i~~~~g~~l~vD~A~~~~~~~~~~~~~~~~g~~~~~~~~~~~D~~~~s~hK~l~~p-~g~g~~~~r~~~~~~~  267 (397)
T 3f9t_A          190 -IEELSKIAKENNIYIHVDAAFGGLVIPFLDDKYKKKGVNYKFDFSLGVDSITIDPHKMGHCP-IPSGGILFKDIGYKRY  267 (397)
T ss_dssp             -HHHHHHHHHHHTCEEEEECTTGGGTGGGCCGGGCCTTCCCCCSGGGTCSEEECCTTTTTCCC-SSCEEEEESSGGGGGG
T ss_pred             -CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHCCCCCCCCCCCCCCEEEECCCCCCCCC-CCCCCCEECCHHHHHH
T ss_conf             -54221211233322211434215746554315551587323455678647994443234666-7875540167899997


Q ss_pred             HHHHHHHC------C-CCH-HHHHHHHHHHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECC
Q ss_conf             99875203------6-761-24579999999856-525899999999999999999997279945535887307877668
Q T0591           274 MEKLQAIV------S-LRA-AGYSQAVLRGWFDE-APGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLP  344 (406)
Q Consensus       274 l~~~~~~~------~-~~~-~~~~q~a~~~~l~~-~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~  344 (406)
                      +..-..+.      + .+. +...-.++...+.. +..-.++..++..++.+.+.+.|++.+...+..|..++..+ +  
T Consensus       268 ~~~~~~y~~~~~~~~~~gsr~~~~~~~~~~~l~~lg~~g~~~~~~~~~~~a~~l~~~L~~~~~~~~~~p~~~iv~~-~--  344 (397)
T 3f9t_A          268 LDVDAPYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPILNIVAI-E--  344 (397)
T ss_dssp             TCEECTTSSSSEECSSCSSCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCBSSCCSSSEEEE-E--
T ss_pred             HHCCCCHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCEEEEEE-C--
T ss_conf             4205640002344553344044443378899987667779999999999999999998708998970795448983-5--


Q ss_pred             CCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC--CCHHHHHHHHHHHHHHHH
Q ss_conf             8788989999999986891896161026799985899850--997999999999999999
Q T0591           345 KLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS--QDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       345 ~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~--~~~e~l~~al~rl~~~~~  402 (406)
                        ..+..++.++| .++||.+..     ..++..+|+++.  ++.|++++.++.|+++.+
T Consensus       345 --~~~~~~l~~~L-~~~Gi~v~~-----~~~~~~lRi~~~~~~t~e~id~l~~~l~~i~k  396 (397)
T 3f9t_A          345 --DEDYKEVCKKL-RDRGIYVSV-----CNCVKALRIVVMPHIKREHIDNFIEILNSIKR  396 (397)
T ss_dssp             --CTTHHHHHHHH-HHTTCBCEE-----CSSSSEEEEECCTTCCHHHHHHHHHHHHHHC-
T ss_pred             --CCCHHHHHHHH-HHCCCEEEC-----CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             --89999999999-977988972-----78997799997499999999999999999865


No 103
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfuration; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3
Probab=99.81  E-value=2.1e-16  Score=128.83  Aligned_cols=288  Identities=18%  Similarity=0.157  Sum_probs=178.9

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHH----HC
Q ss_conf             88878888988999999999986488678867078824872789999999972001010131055138999998----29
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEF----FE  146 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~----~g  146 (406)
                      +.|+- .|.|. ++++.+.+....|.    + ..++++.+..|+.. +.+++.+||+|+++...|..-...++.    .|
T Consensus       125 ~~YsR-~gnPT-~~~LE~~la~LE~g----~-~allfsSGMAAIsa-ll~ll~~Gd~vv~~~~~YggT~~l~~~~l~~~G  196 (464)
T 1ibj_A          125 YDYTR-SGNPT-RDALESLLAKLDKA----D-RAFCFTSGMAALSA-VTHLIKNGEEIVAGDDVYGGSDRLLSQVVPRSG  196 (464)
T ss_dssp             CSBTT-TCCHH-HHHHHHHHHHHHTC----S-EEEEESSHHHHHHH-HHTTSCTTCEEEEESSCCHHHHHHHHHTSGGGT
T ss_pred             CEECC-CCCHH-HHHHHHHHHHHHCC----C-CEEEECCHHHHHHH-HHHHHCCCCEEEEECCCCCHHHHHHHHHHHHCC
T ss_conf             62508-98878-99999999998599----7-09995569999999-999857999999968979718999999985158


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCC
Q ss_conf             96999860446667766677889999985025403421566643233443789999999986378757841750235568
Q T0591           147 GEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYA  226 (406)
Q Consensus       147 ~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~  226 (406)
                      .+...+.           ..|.+.++++++++||+||+-+|+||+..+.+   +++|+++|+++|+++|+|..+.--.+ 
T Consensus       197 v~~~f~d-----------~~d~e~~e~~i~~~tklI~~EspsNP~l~v~D---i~~ia~iA~~~gi~vVVDNT~atP~~-  261 (464)
T 1ibj_A          197 VVVKRVN-----------TTKLDEVAAAIGPQTKLVWLESPTNPRQQISD---IRKISEMAHAQGALVLVDNSIMSPVL-  261 (464)
T ss_dssp             CEEEEEC-----------TTSHHHHHHHCCSSEEEEEECSSCTTTCCCCC---HHHHHHHHHTTTCEEEEECTTTCTTT-
T ss_pred             CCCCCCC-----------CCCHHHHHHCCCCCCEEEEECCCCCCCCCCCC---HHHHHHHHCCCCCEEEEECCCCCCCE-
T ss_conf             7520153-----------21135666403767149996588986444466---68999874226513998466445324-


Q ss_pred             CCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHHH-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH
Q ss_conf             88765223321026786899850400104631-12114332-58999999987520367612457999999985652589
Q T0591           227 GASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAFG-SRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWM  304 (406)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~-~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~  304 (406)
                         ..++. . ..|    |+++|.||.++-.| .=.|.++. ++.+...+...+.......+......+..-+    +-+
T Consensus       262 ---~~Pl~-~-GAD----IVihS~TKYi~GhsDv~~G~vv~~~~~~~~~l~~~~~~~G~~lsP~dA~Ll~RGL----~TL  328 (464)
T 1ibj_A          262 ---SRPLE-L-GAD----IVMHSATKFIAGHSDVMAGVLAVKGEKLAKEVYFLQNSEGSGLAPFDCWLCLRGI----KTM  328 (464)
T ss_dssp             ---CCGGG-T-TCS----EEEEETTTTTTCSSCCCCEEEEECSHHHHHHHHHHHHHTTCBCCHHHHHHHHHHH----TTH
T ss_pred             ---ECCCC-C-CCC----EEEEECCCCCCCCCCCCCCEEEECCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH----HHH
T ss_conf             ---20344-5-887----8983145422257555586476261777788876315778848989999998415----789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCE-EECC-----------------CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEE
Q ss_conf             9999999999999999997279945-5358-----------------873078776688788989999999986891896
Q T0591           305 EDRIARHQAIRDELLHVLRGCEGVF-ARTP-----------------QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVT  366 (406)
Q Consensus       305 ~~~~~~~~~~r~~l~~~L~~~~g~~-~~~p-----------------~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~  366 (406)
                      ..+.++..++...+.+.|.+.+.+. +..|                 -||++-+ .+     .+.+.+.++++.-.+.- 
T Consensus       329 ~lRm~~~~~NA~~vA~~L~~hp~V~~V~YPgL~s~p~~~~a~~~~~G~GgmlSf-~~-----~~~e~a~~f~d~L~lf~-  401 (464)
T 1ibj_A          329 ALRIEKQQENARKIAMYLSSHPRVKKVYYAGLPDHPGHHLHFSQAKGAGSVFSF-IT-----GSVALSKHLVETTKYFS-  401 (464)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCTTCCEEECTTSTTSTTHHHHTTTCSCCCSEEEE-EC-----SCHHHHHHHHHHCSSSE-
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHCCCCCCEEEEE-EE-----CCHHHHHHHHHCCCCCE-
T ss_conf             999999999999999998608976265566533103599998569994089999-96-----99999999997069164-


Q ss_pred             ECCCCC------------------C-------CCCCEEEEEECC-CHHHHHHHHHHHHHHHHHH
Q ss_conf             161026------------------7-------999858998509-9799999999999999985
Q T0591           367 PGTEFS------------------P-------HTADSVRLNFSQ-DHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       367 pG~~Fg------------------~-------~~~~~iRis~~~-~~e~l~~al~rl~~~~~~~  404 (406)
                      .|..+|                  .       -.++.||+|++. +.|+|.   +.|.++++++
T Consensus       402 ~a~SlGg~eSLi~~pas~th~~~~~e~r~~~Gi~~~liRlSVGLEd~eDLi---~DL~qALk~~  462 (464)
T 1ibj_A          402 IAVSFGSVKSLISMPCFMSHASIPAEVREARGLTEDLVRISAGIEDVDDLI---SDLDIAFKTF  462 (464)
T ss_dssp             ECSCCCSSSCEEECTTTTTTCSCCSSSSSSSSCCTTCEEEECCSSCHHHHH---HHHHHHHHSC
T ss_pred             ECCCCCCCCCCCCCCHHHCCCCCCHHHHHHCCCCCCEEEEEECCCCHHHHH---HHHHHHHHHC
T ss_conf             623578754032376211362489999997597969599985239999999---9999999667


No 104
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A*
Probab=99.81  E-value=3.6e-16  Score=127.22  Aligned_cols=283  Identities=22%  Similarity=0.265  Sum_probs=180.0

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHH----HC
Q ss_conf             88878888988999999999986488678867078824872789999999972001010131055138999998----29
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEF----FE  146 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~----~g  146 (406)
                      +-|+-. |.|. ++++.+.+....|.    + ..++++.+..|+..++.+++.+||+|++.+..|......++.    .|
T Consensus        57 ~~YsR~-~nPt-~~~le~~la~Legg----~-~a~~~sSGmaAi~~~l~~~~~~gd~vi~~~~~Yg~t~~l~~~~~~~~g  129 (398)
T 1gc0_A           57 HFYSRI-SNPT-LNLLEARMASLEGG----E-AGLALASGMGAITSTLWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFG  129 (398)
T ss_dssp             -------CCHH-HHHHHHHHHHHHTC----S-EEEEESSHHHHHHHHHHHHCCTTCEEEEESSCCSHHHHHHHHTGGGGT
T ss_pred             CEECCC-CCHH-HHHHHHHHHHHHCC----C-EEEEECCHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             501289-8868-99999999998399----7-079972635887744303478999799703567726899887653125


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCC
Q ss_conf             96999860446667766677889999985025403421566643233443789999999986378757841750235568
Q T0591           147 GEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYA  226 (406)
Q Consensus       147 ~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~  226 (406)
                      .++..+.           .-|+++++++++++||+|++-+|.|||..+.+   +++|+++|+++|+++++|+.+..-.+ 
T Consensus       130 i~~~~~d-----------~~d~~~~~~~i~~~tklI~~EspsNP~l~v~D---i~~i~~iA~~~g~~lvVDnT~atP~~-  194 (398)
T 1gc0_A          130 VKLRHVD-----------MADLQALEAAMTPATRVIYFESPANPNMHMAD---IAGVAKIARKHGATVVVDNTYCTPYL-  194 (398)
T ss_dssp             CEEEEEC-----------TTCHHHHHHHCCTTEEEEEEESSCTTTCCCCC---HHHHHHHHGGGTCEEEEECTTTHHHH-
T ss_pred             CCCCCCC-----------CCCHHHHHHHCCCCCEEEEEECCCCCCCCCCC---HHHHHHHHHHCCCCEEEECCCCCCCE-
T ss_conf             5445689-----------77899999865877618999467886656557---69999999981992884055345450-


Q ss_pred             CCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHHHHHHHHHHHH--HHHHHCCCCHHHHHHHHHHHHHHCCCHH
Q ss_conf             88765223321026786899850400104631-12114332589999999--8752036761245799999998565258
Q T0591           227 GASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAFGSRAIIARME--KLQAIVSLRAAGYSQAVLRGWFDEAPGW  303 (406)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~~~~~i~~l~--~~~~~~~~~~~~~~q~a~~~~l~~~~~~  303 (406)
                         ..++ .. ..|    |+++|.+|.++-.| .=.|.++++++.+.+++  .++.......++.....+..-+    +-
T Consensus       195 ---~~Pl-~~-GaD----iVvhS~TKyi~GhsDv~~G~v~~~~~~~~~~r~~~~~~~~G~~l~p~da~ll~rgl----~T  261 (398)
T 1gc0_A          195 ---QRPL-EL-GAD----LVVHSATKYLSGHGDITAGIVVGSQALVDRIRLQGLKDMTGAVLSPHDAALLMRGI----KT  261 (398)
T ss_dssp             ---CCGG-GG-TCS----EEEEETTTTTTCSSSCCCEEEEECHHHHHHHHHTHHHHHTCCCCCHHHHHHHHHHH----TT
T ss_pred             ---ECCC-CC-CCC----EEEEECCEEECCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCC----CH
T ss_conf             ---0565-35-577----79950325531466268762467789999999999998048878868889987073----07


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCE-EECC-----------------CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEE
Q ss_conf             99999999999999999997279945-5358-----------------87307877668878898999999998689189
Q T0591           304 MEDRIARHQAIRDELLHVLRGCEGVF-ARTP-----------------QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVV  365 (406)
Q Consensus       304 ~~~~~~~~~~~r~~l~~~L~~~~g~~-~~~p-----------------~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v  365 (406)
                      +..+.++..++...+.+.|.+.+.+. +..|                 .||++. ..+.    .+.+-+.++++.-.+ +
T Consensus       262 l~lR~~~~~~nA~~lA~~L~~hp~V~~V~yPgl~s~p~~~~~~~~~~g~gg~~s-f~l~----~~~~~a~~f~d~L~l-~  335 (398)
T 1gc0_A          262 LNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASFPQYTLARQQMSQPGGMIA-FELK----GGIGAGRRFMNALQL-F  335 (398)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCTTEEEEEEC----------------CCTTEEE-EEET----THHHHHHHHHHHCSS-S
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCEEE-EEEC----CCHHHHHHHHHHCCC-C
T ss_conf             899999998889999999974766443355223678157798632799998789-8653----999999999983894-6


Q ss_pred             EECCCCCC-------------------------CCCCEEEEEECC-CHHHHHHHH
Q ss_conf             61610267-------------------------999858998509-979999999
Q T0591           366 TPGTEFSP-------------------------HTADSVRLNFSQ-DHEAAVAAA  394 (406)
Q Consensus       366 ~pG~~Fg~-------------------------~~~~~iRis~~~-~~e~l~~al  394 (406)
                      ..|..+|.                         -.++.||||++. +.|+|.+-+
T Consensus       336 ~~a~SlGg~~SLi~~p~~~~h~~~~~e~~~~~Gi~~~liRlSvGlE~~~DLi~Dl  390 (398)
T 1gc0_A          336 SRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLEDIDDLLADV  390 (398)
T ss_dssp             EECSCCSCSSCEEECGGGTTTSSSCHHHHHHTTCCTTEEEEECCSSCHHHHHHHH
T ss_pred             EECCCCCCCCCEEECCHHCCCCCCCHHHHHHCCCCCCEEEEEECCCCHHHHHHHH
T ss_conf             6645678767220175210520189999986697949599997019999999999


No 105
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma- family, lyase; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A*
Probab=99.81  E-value=5.7e-16  Score=125.92  Aligned_cols=228  Identities=17%  Similarity=0.186  Sum_probs=155.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHH----HC
Q ss_conf             88878888988999999999986488678867078824872789999999972001010131055138999998----29
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEF----FE  146 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~----~g  146 (406)
                      +.|+- .|.| -++++.+.+....|.    + ..++++.+..|+..++.+++.+||+|++....|..-...++.    .|
T Consensus       106 ~~YsR-~~NP-T~~~LE~~lA~LEgg----~-~al~fsSGMAAi~~~l~~l~~~Gd~iv~~~~~Yg~T~~l~~~~~~~~G  178 (445)
T 1qgn_A          106 FEYGR-YGNP-TTVVLEEKISALEGA----E-STLLMASGMCASTVMLLALVPAGGHIVTTTDCYRKTRIFIETILPKMG  178 (445)
T ss_dssp             CCBGG-GCCH-HHHHHHHHHHHHHTC----S-EEEEESCHHHHHHHHHHHHSCSSCEEEEETTSCHHHHHHHHHTGGGGT
T ss_pred             CEECC-CCCH-HHHHHHHHHHHHHCC----C-EEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHCCCC
T ss_conf             35539-9886-799999999998399----7-389965899999999996178999799756664246677753202467


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHH-HHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCC
Q ss_conf             969998604466677666778899999-8502540342156664323344378999999998637875784175023556
Q T0591           147 GEMVPVQLDYVSADETRAGLDLTGLEE-AFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRY  225 (406)
Q Consensus       147 ~~~v~v~~~~~~~~~~~~~~d~~~l~~-~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~  225 (406)
                      .+...+.           ..+.++.++ ..+++||+||+-+|.||+..+..   +++|+++|+++|+++++|+.+.--.+
T Consensus       179 i~~~~~d-----------~~~~~~~~~~~~~~~t~lv~~EspsNP~l~v~D---i~~ia~iA~~~g~~lvVDNT~atP~~  244 (445)
T 1qgn_A          179 ITATVID-----------PADVGALELALNQKKVNLFFTESPTNPFLRCVD---IELVSKLCHEKGALVCIDGTFATPLN  244 (445)
T ss_dssp             CEEEEEC-----------SSCHHHHHHHHHHSCEEEEEEESSCTTTCCCCC---HHHHHHHHHHTTCEEEEECTTTCTTT
T ss_pred             CEEEECC-----------CCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCC---HHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             2465337-----------774277887640466408995068997765567---79999999872997998778426155


Q ss_pred             CCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCC-CCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH
Q ss_conf             8887652233210267868998504001046311-211433258999999987520367612457999999985652589
Q T0591           226 AGASYTHLRAEAAVDAENVVTIMGPSKTESLSGY-RLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWM  304 (406)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~Gl-RiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~  304 (406)
                          ..++ ..+ .|    |+++|+||.++-.|= =.|.++++++++..++..+.......++.....+..   . -+-+
T Consensus       245 ----~~PL-~~G-AD----IVvhS~TKyi~Ghsdv~gG~v~~~~~~~~~~~~~~~~~G~~lsp~da~lllr---G-L~TL  310 (445)
T 1qgn_A          245 ----QKAL-ALG-AD----LVLHSATKFLGGHNDVLAGCISGPLKLVSEIRNLHHILGGALNPNAAYLIIR---G-MKTL  310 (445)
T ss_dssp             ----CCTT-TTT-CS----EEEECTTTTTTCSSSCCCEEEEECHHHHHHHHHHHHHHCCCCCHHHHHHHHH---H-GGGH
T ss_pred             ----CCCH-HHC-CC----EEEEEEEEECCCCCCCCCCEEEEHHHHHHHHHHHHCCCCCCCCHHHHHHHHH---H-CHHH
T ss_conf             ----8752-317-76----8998622304788763123133114577788763056676279899999985---1-5389


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCE-EECC
Q ss_conf             9999999999999999997279945-5358
Q T0591           305 EDRIARHQAIRDELLHVLRGCEGVF-ARTP  333 (406)
Q Consensus       305 ~~~~~~~~~~r~~l~~~L~~~~g~~-~~~p  333 (406)
                      ..+.++..++...+.+.|.+.+.+. +..|
T Consensus       311 ~lRm~r~~~nA~~vA~~L~~hp~V~~V~yP  340 (445)
T 1qgn_A          311 HLRVQQQNSTALRMAEILEAHPKVRHVYYP  340 (445)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCTTEEEEECT
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             999999999999999999609985279788


No 106
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genomics, SGC stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B
Probab=99.80  E-value=1.4e-16  Score=130.11  Aligned_cols=282  Identities=16%  Similarity=0.188  Sum_probs=171.4

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHH----HC
Q ss_conf             88878888988999999999986488678867078824872789999999972001010131055138999998----29
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEF----FE  146 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~----~g  146 (406)
                      +.|+-. |.|. .+++.+.+....|.    ++-+++ +.++.++.. +.+++.|||+|+++...|......+..    .|
T Consensus        59 ~~Y~R~-~nPt-~~~LE~~lA~leg~----e~al~~-sSGmAA~~a-il~ll~~GD~VI~~~~~y~~t~~~~~~~~~~~g  130 (403)
T 3cog_A           59 FEYSRS-GNPT-RNCLEKAVAALDGA----KYCLAF-ASGLAATVT-ITHLLKAGDQIICMDDVYGGTNRYFRQVASEFG  130 (403)
T ss_dssp             --------CHH-HHHHHHHHHHHHTC----SEEEEE-SCHHHHHHH-HHTTSCTTCEEEEESSCCHHHHHHHHHTGGGGT
T ss_pred             CEECCC-CCHH-HHHHHHHHHHHHCC----CEEEEE-CCHHHHHHH-HHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCC
T ss_conf             513189-8866-99999999998499----839996-649999999-999857999899927863589999999986068


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC-CEEEECCCCCCCCC
Q ss_conf             96999860446667766677889999985025403421566643233443789999999986378-75784175023556
Q T0591           147 GEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYG-ATVIADQLYSRLRY  225 (406)
Q Consensus       147 ~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~-~~ii~De~Y~~l~~  225 (406)
                      .++..+.           ..|++.++++++++||+|++.+|+||||.+.+   +++|+++|++|| +++++|..+..-.+
T Consensus       131 v~v~~~d-----------~~D~~~le~ai~~~tklV~vEspsNp~g~v~D---i~~I~~ia~~~G~i~lvvDnt~a~~~~  196 (403)
T 3cog_A          131 LKISFVD-----------CSKIKLLEAAITPETKLVWIETPTNPTQKVID---IEGCAHIVHKHGDIILVVDNTFMSPYF  196 (403)
T ss_dssp             CEEEEEC-----------TTSHHHHHHHCCTTEEEEEEESSCTTTCCCCC---HHHHHHHHTSSSCCEEEEECTTTCTTT
T ss_pred             EEEEEEC-----------CCCHHHHHHHCCCCCCEEEEECCCCCCCEECC---HHHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             5999859-----------99899999746568868999788898886376---799999998718971762045336400


Q ss_pred             CCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHH-HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHH
Q ss_conf             888765223321026786899850400104631-1211433-25899999998752036761245799999998565258
Q T0591           226 AGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAF-GSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGW  303 (406)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~-~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~  303 (406)
                          ..++ ... .|    |+++|+||.++-.| .-.|.++ .++++.++++..+.......+...-..+..-    -+-
T Consensus       197 ----~~pl-~~G-AD----ivv~S~tKyl~Gh~d~~gG~vv~~~~~~~~~l~~~~~~~G~~~~p~da~ll~rg----l~T  262 (403)
T 3cog_A          197 ----QRPL-ALG-AD----ISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRG----LKT  262 (403)
T ss_dssp             ----CCTT-TTT-CS----EEEEETTTTTTCSSCCCCEEEEECCHHHHHHHHHHHHHHCCCCCHHHHHHHHHH----HTT
T ss_pred             ----CCCC-CCC-EE----EEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCC----CCC
T ss_conf             ----2354-456-46----998503134457887200531478599999999887435774899999999756----985


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCE-EECCC-----------------CCEEEEEECCCCCCCHHHHHHHHHHHCCEEE
Q ss_conf             99999999999999999997279945-53588-----------------7307877668878898999999998689189
Q T0591           304 MEDRIARHQAIRDELLHVLRGCEGVF-ARTPQ-----------------AGSYLFPRLPKLAVAPAEFVKILRLQAGVVV  365 (406)
Q Consensus       304 ~~~~~~~~~~~r~~l~~~L~~~~g~~-~~~p~-----------------gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v  365 (406)
                      +..+.++..++...+.+.|...+.+. +..|.                 ||+ +.+.+.+    +.+-+.++++.-.+..
T Consensus       263 l~~R~~~~~~nA~~lA~~L~~~p~v~~V~yPgl~s~p~~~~~~~~~~g~gg~-~sf~l~~----~~~~~~~f~~~l~l~~  337 (403)
T 3cog_A          263 LHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGM-VTFYIKG----TLQHAEIFLKNLKLFT  337 (403)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCTTEEEEECTTSTTSTTHHHHHHHCSCCCSE-EEEEESS----CHHHHHHHHHHCSSSE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCHHHHHHHHCCCCCEE-EEEEECC----CHHHHHHHHHCCCCCE
T ss_conf             7889999999999999999968993579758988882199999618998706-7989769----8999999997389355


Q ss_pred             EECCCCCC-------------------------CCCCEEEEEECC-CHHHHHHHH
Q ss_conf             61610267-------------------------999858998509-979999999
Q T0591           366 TPGTEFSP-------------------------HTADSVRLNFSQ-DHEAAVAAA  394 (406)
Q Consensus       366 ~pG~~Fg~-------------------------~~~~~iRis~~~-~~e~l~~al  394 (406)
                       .|..+|.                         -.++.||||++. +.|+|.+-+
T Consensus       338 -~a~SlG~~~SLi~~pa~~sh~~~~~~~r~~~Gi~~~liRlsvGlE~~eDLi~Dl  391 (403)
T 3cog_A          338 -LAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDL  391 (403)
T ss_dssp             -ECSCCSSSSCEEECTTTTTTTTSCHHHHHHHTCCTTEEEEECCSSCHHHHHHHH
T ss_pred             -ECCCCCCCCCEECCCCCCCCCCCCHHHHHHCCCCCCEEEEEECCCCHHHHHHHH
T ss_conf             -546777756240076522432289999997598949599995859999999999


No 107
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A*
Probab=99.80  E-value=1.9e-16  Score=129.10  Aligned_cols=327  Identities=15%  Similarity=0.128  Sum_probs=193.9

Q ss_pred             HHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCC----
Q ss_conf             9999999808788887888898899999999998648867886707882487278999999997200101013105----
Q T0591            59 DLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPD----  134 (406)
Q Consensus        59 ~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~----  134 (406)
                      +.+..++.. +...|+...+..+|.+.+++++    |.     +.++.|++++++...++.+++.+||.+++....    
T Consensus        57 ~~~~a~~~~-gd~~y~~~~~~~~le~~~a~~~----g~-----~~~~~~~sGt~A~~~a~~~~~~~g~~~~~~~~~~~~~  126 (467)
T 2oqx_A           57 QSMQAAMMR-GDEAYSGSRSYYALAESVKNIF----GY-----QYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVA  126 (467)
T ss_dssp             HHHHHHTTS-CCCCSSSCHHHHHHHHHHHHHH----CC-----SEEEEEC--CCSHHHHHHHHHHHHHHHHCCCTTTCEE
T ss_pred             HHHHHHHCC-CCCCCCCCCCHHHHHHHHHHHH----CC-----CEEEECCCCHHHHHHHHHHHHHHCCEECCCCCCCEEE
T ss_conf             999986045-8610158931999999999986----99-----8799999719999999999986174144778775798


Q ss_pred             -----CHHHHHHHHHHCCEEEEEEECCCCC----CCCCCCCCHHHHHHHHCC----CCEEEECCCCCCCC-CCCCCHHHH
Q ss_conf             -----5138999998299699986044666----776667788999998502----54034215666432-334437899
Q T0591           135 -----YFANRKLVEFFEGEMVPVQLDYVSA----DETRAGLDLTGLEEAFKA----GARVFLFSNPNNPA-GVVYSAEEI  200 (406)
Q Consensus       135 -----y~~~~~~~~~~g~~~v~v~~~~~~~----~~~~~~~d~~~l~~~~~~----~~k~i~l~~P~NPT-G~~~s~~~l  200 (406)
                           |..........|++.+.++.+....    ......+|++++++.+++    +++++++.++||.. |..++.+++
T Consensus       127 ~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~d~~~l~~~i~~~~~~~~~~~~~~~~~~~~g~~~~~~~~l  206 (467)
T 2oqx_A          127 FSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKGNFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANL  206 (467)
T ss_dssp             EESSCCHHHHHHHHHTTCEEEECBCTTTTCTTSCCTTTTCBCHHHHHHHHHHHCGGGCCCEEEESSBCGGGCBCCCHHHH
T ss_pred             EECCCCCCHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHH
T ss_conf             50776602379999819855214652345665445445665999999886336866412799855420275044799999


Q ss_pred             HHHHHHHHHCCCEEEECCCCCCC----------CCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHH
Q ss_conf             99999986378757841750235----------56888765223321026786899850400104631121143325899
Q T0591           201 GQIAALAARYGATVIADQLYSRL----------RYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAI  270 (406)
Q Consensus       201 ~~i~~~a~~~~~~ii~De~Y~~l----------~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~  270 (406)
                      ++|.++|++||+++++|+++...          .|.+.....+.....  ...-++..|++|.++  +.+.|+++.+++.
T Consensus       207 ~~i~~~a~~~~~~l~~D~a~~~~~~~~~~~~~~~~~g~~~~~i~~~~~--~~~d~~s~s~~K~~~--~~~gG~i~~~~~~  282 (467)
T 2oqx_A          207 KAMYSIAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTIEQITRETY--KYADMLAMSAKKDAM--VPMGGLLCMKDDS  282 (467)
T ss_dssp             HHHHHHHHHTTCCEEEECTTHHHHHHHHHHHCGGGTTSCHHHHHHHHG--GGCSEEEEESSSTTC--CSSCEEEEECSGG
T ss_pred             HHHHHHHHHCCCEEEEECCCHHHHHCCCCCCCCCCCCCCHHHCCCCCC--CCCCEEEECCCCCCC--CCCCCEEECCCHH
T ss_conf             999999998499899967455530010124542226875311145555--678889946877666--6776513127177


Q ss_pred             HH-HHHHHHH-------HC-CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEE
Q ss_conf             99-9998752-------03-676124579999999856525899999999999999999997279945535887307877
Q T0591           271 IA-RMEKLQA-------IV-SLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFP  341 (406)
Q Consensus       271 i~-~l~~~~~-------~~-~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~  341 (406)
                      +. ..+..+.       .. ..+.......+....+....  ..+..++..++.+.+.+.|.+. ++.+. |.++..+++
T Consensus       283 ~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~a~~~~l~~~~--~~~~~~~r~~~a~~L~~~L~~~-~~~v~-~~~~~~~~~  358 (467)
T 2oqx_A          283 FFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGM--NLDWLAYRIAQVQYLVDGLEEI-GVVCQ-QAGGHAAFV  358 (467)
T ss_dssp             GHHHHHHHHHHHHHTTSSCCCCCCCHHHHHHHHHHHHHTT--CHHHHHHHHHHHHHHHHHHHHT-TCCEE-EECSSCEEE
T ss_pred             HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHC-CCCCC-CCCCCEEEE
T ss_conf             7777765420365456650011356679999999988777--7799999999999999999866-99545-777641464


Q ss_pred             EC----CC---CCCCHHHHHHHHHHHCCEEEE-ECCCC-------C---CCCCCEEEEEEC---CCHHHHHHHHHHHHHH
Q ss_conf             66----88---788989999999986891896-16102-------6---799985899850---9979999999999999
Q T0591           342 RL----PK---LAVAPAEFVKILRLQAGVVVT-PGTEF-------S---PHTADSVRLNFS---QDHEAAVAAARRIVTL  400 (406)
Q Consensus       342 ~~----~~---~~~~~~~~~~~Ll~~~gV~v~-pG~~F-------g---~~~~~~iRis~~---~~~e~l~~al~rl~~~  400 (406)
                      +.    +.   .......+...++.+.||... .|..+       +   +.....+|+++.   .++|+++..++.|+++
T Consensus       359 d~~~~~~~~~~~~~~~~~~~~~l~~~~Gi~~~~~g~~~~~~~~~~~~~~~~~~~~vRl~ip~~~~T~eeiD~vve~l~~v  438 (467)
T 2oqx_A          359 DAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHV  438 (467)
T ss_dssp             EHHHHSTTSCGGGCHHHHHHHHHHHHHCEECEEESHHHHCBCTTTCSBCCCSCCEEEECCCTTTSCHHHHHHHHHHHHHH
T ss_pred             EHHHHCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             23765688766554248899999997294201376654454555686566766607986788889999999999999999


Q ss_pred             HHH
Q ss_conf             998
Q T0591           401 VER  403 (406)
Q Consensus       401 ~~~  403 (406)
                      .++
T Consensus       439 ~~~  441 (467)
T 2oqx_A          439 KEN  441 (467)
T ss_dssp             HHS
T ss_pred             HHH
T ss_conf             997


No 108
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A*
Probab=99.80  E-value=5.1e-17  Score=132.97  Aligned_cols=317  Identities=15%  Similarity=0.160  Sum_probs=193.9

Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHH
Q ss_conf             34156786788788899999999998087888878888988999999999986488678867078824872789999999
Q T0591            41 VDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAA  120 (406)
Q Consensus        41 i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~  120 (406)
                      |.|+  .|....   .-.+++.+.+.++-..+.++.  ..++.+.+++++    |..     .++.++.+|.|+.+++.+
T Consensus        27 i~~~--~p~~~~---~e~~~~~~~~~~~~~~~~G~~--~~~fE~~~a~~~----g~~-----~av~~~SGT~Al~lal~~   90 (391)
T 3dr4_A           27 ISVA--APRLDG---NERDYVLECMDTTWISSVGRF--IVEFEKAFADYC----GVK-----HAIACNNGTTALHLALVA   90 (391)
T ss_dssp             -CCC--CCCCCS---SHHHHHHHHHHHTCCSSCSHH--HHHHHHHHHHHH----TCS-----EEEEESSHHHHHHHHHHH
T ss_pred             CCCC--CCCCCH---HHHHHHHHHHHCCCCCCCCHH--HHHHHHHHHHHH----CCC-----EEEEECCHHHHHHHHHHH
T ss_conf             0566--999998---999999999975971789979--999999999986----969-----599966899999999998


Q ss_pred             H-HHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHH
Q ss_conf             9-720010101310551389999982996999860446667766677889999985025403421566643233443789
Q T0591           121 T-VARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEE  199 (406)
Q Consensus       121 l-~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~  199 (406)
                      + +.+||+|+++..+|.+....+...|++++.+.++     +..+.+|+++++++++++||+|++++   +.|...   +
T Consensus        91 l~~~~gdeVI~~~~~~~~~~~~~~~~g~~~v~~Di~-----~~~~~id~~~le~~i~~ktkaIi~vh---~~G~~~---d  159 (391)
T 3dr4_A           91 MGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDND-----PRTFNLDAAKLEALITPRTKAIMPVH---LYGQIC---D  159 (391)
T ss_dssp             HTCCTTCEEEEESSSCTHHHHHHHHTTCEEEEECBC-----TTTCSBCGGGSGGGCCTTEEEECCBC---GGGCCC---C
T ss_pred             HCCCCCCEEEEECCCCCCCCCHHHHCEEEEEECCCC-----CCCCCCCHHHHHHHCCCCCCEEEEEC---CCCCHH---C
T ss_conf             288997989983143322221011100389613577-----53468899999984589981999979---877710---7


Q ss_pred             HHHHHHHHHHCCCEEEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEECC--HHCCCCCCCCHHHH-HHHHHHHHHH
Q ss_conf             9999999863787578417502355-688876522332102678689985040--01046311211433-2589999999
Q T0591           200 IGQIAALAARYGATVIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGPS--KTESLSGYRLGVAF-GSRAIIARME  275 (406)
Q Consensus       200 l~~i~~~a~~~~~~ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~S--K~~~~~GlRiG~~~-~~~~~i~~l~  275 (406)
                      +++|.++|+++|++||+|.+++... +.+...       ....  .+.+.||.  |... .|- -|+++ -++++...++
T Consensus       160 ~~~i~~iakk~~i~lIeD~A~a~G~~~~~~~~-------g~~g--d~~~~Sf~~~k~~~-~g~-GG~i~t~~~~~~~~~~  228 (391)
T 3dr4_A          160 MDPILEVARRHNLLVIEDAAEAVGATYRGKKS-------GSLG--DCATFSFFGNAIIT-TGE-GGMITTNDDDLAAKMR  228 (391)
T ss_dssp             HHHHHHHHHHTTCEEEEECTTCTTCEETTEET-------TSSS--SEEEEECBTTSSSC-CBS-CEEEEESCHHHHHHHH
T ss_pred             HHHHHHHHHHCCCEEEEECHHHHCCCCCCEEC-------CCCC--CCEEECCCCCCEEE-CCC-CCCEEEECCCCCCCCC
T ss_conf             99999999984999999771120776388113-------4578--70585367752132-267-6630233022221101


Q ss_pred             HHHHHC------------CC--CHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECC-----CCC
Q ss_conf             875203------------67--61245799999998565258999999999999999999972799455358-----873
Q T0591           276 KLQAIV------------SL--RAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTP-----QAG  336 (406)
Q Consensus       276 ~~~~~~------------~~--~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p-----~gg  336 (406)
                      ..+...            ..  ..+.+....+...+    ..+.+..++.++..+.+.+.|.+++++.....     ...
T Consensus       229 ~~~~~g~~~~~~~~~~~~g~n~r~s~i~Aaigl~ql----~~l~~~~~~R~~i~~~y~~~L~~~~~~~~~~~~~~~~~~~  304 (391)
T 3dr4_A          229 LLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQL----ERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHV  304 (391)
T ss_dssp             HHHBTTCCTTSTTCCSSCCCBCBCCHHHHHHHHHHH----HTHHHHHHHHHHHHHHHHHHHGGGTTSEECCCCCTTSCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH----HHHCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             222466632123321237877667779999989988----7514421123121123322233333334576422222220


Q ss_pred             EEE-EEECCC-CCCCHHHHHHHHHHHCCEEEEECCC-------CCC--CC---------CCEEEEEEC--CCHHHHHHHH
Q ss_conf             078-776688-7889899999999868918961610-------267--99---------985899850--9979999999
Q T0591           337 SYL-FPRLPK-LAVAPAEFVKILRLQAGVVVTPGTE-------FSP--HT---------ADSVRLNFS--QDHEAAVAAA  394 (406)
Q Consensus       337 ~~~-w~~~~~-~~~~~~~~~~~Ll~~~gV~v~pG~~-------Fg~--~~---------~~~iRis~~--~~~e~l~~al  394 (406)
                      ++. .+.+.+ ...+..++.+.| .+.||.+.|...       |..  ..         ...+.|.+-  .++++++.-+
T Consensus       305 ~~~~~i~l~~~~~~~rd~l~~~L-~~~GI~~r~~~~plh~~~~~~~~~~~~~p~ae~i~~~~i~LP~~~~lt~~di~~Ii  383 (391)
T 3dr4_A          305 FWMYTVRLGEGLSTTRDQVIKDL-DALGIESRPVFHPMHIMPPYAHLATDDLKIAEACGVDGLNLPTHAGLTEADIDRVI  383 (391)
T ss_dssp             CSSEEEEECSSCSSCHHHHHHHH-HHTTCCCEECCCCGGGSGGGGGGCCTTCHHHHHHHHHEEEECCCTTCCHHHHHHHH
T ss_pred             HHHHHCCCCCCCHHHHHHHHHHH-HHCCCCEEEECCCHHHCHHHHHCCCCCCHHHHHHHHCEEECCCCCCCCHHHHHHHH
T ss_conf             01100023332345599999999-98799767738564549777746889997999998298991588999999999999


Q ss_pred             HHHHHH
Q ss_conf             999999
Q T0591           395 RRIVTL  400 (406)
Q Consensus       395 ~rl~~~  400 (406)
                      +.|+++
T Consensus       384 ~~ik~i  389 (391)
T 3dr4_A          384 AALDQV  389 (391)
T ss_dssp             HHHHTT
T ss_pred             HHHHHH
T ss_conf             999998


No 109
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, structural genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987}
Probab=99.79  E-value=1.8e-16  Score=129.21  Aligned_cols=318  Identities=14%  Similarity=0.075  Sum_probs=188.1

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH-HHCCHHHHHH
Q ss_conf             888999999999980878888788889889999999999864886788670788248727899999999-7200101013
Q T0591            53 PTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT-VARGDKVAIV  131 (406)
Q Consensus        53 p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l-~~pGd~Vl~~  131 (406)
                      |..+.++.+.+.+.++...+++|.  ..+|.+.++++    ++..   ...++.++++|.||.++++++ +.+||+|++|
T Consensus        14 ~~~~~~~~~~~~~~s~~~~~~G~~--~~~fE~~~a~~----~~~~---~~~~~~~~sgt~al~~al~~l~~~~gdeVi~p   84 (377)
T 3ju7_A           14 PVIEYLDELKEIDASHIYTNYGPI--NQRFEQTIMSG----FFQN---RGAVTTVANATLGLMAAIQLKKRKKGKYALMP   84 (377)
T ss_dssp             CGGGGHHHHHHHHHHTCCSSSCHH--HHHHHHHHHHH----TSTT---CSEEEEESCHHHHHHHHHHHHSCTTCCEEEEE
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCHH--HHHHHHHHHHH----HCCC---CCEEEEECHHHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             669999999999966986579979--99999999997----5899---99999812499999999998098989989984


Q ss_pred             HCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             10551389999982996999860446667766677889999985025403421566643233443789999999986378
Q T0591           132 QPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYG  211 (406)
Q Consensus       132 ~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~  211 (406)
                      ..+|.+....+..+|++++.+.++     .+.+.+|++.+++++++.|+.+.+..|.|+.|.....++   |.++| +++
T Consensus        85 ~~t~~a~~~~i~~~G~~pvfvDvd-----~~~~~id~~~l~~~I~~~t~~~~~ii~~~~~G~~~d~~~---i~~i~-k~~  155 (377)
T 3ju7_A           85 SFTFPATPLAAIWCGLEPYFIDIS-----IDDWYMDKTVLWDKIEELKEEVAIVVPYATFGSWMNLEE---YEELE-KKG  155 (377)
T ss_dssp             SSSCTHHHHHHHHTTCEEEEECBC-----TTTCSBCHHHHHHHHHHHGGGEEEECCBCGGGBCCCCHH---HHHHH-HTT
T ss_pred             ECCCCCCCCHHHHHHHHHHCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH---HHHHC-CCC
T ss_conf             035632101134534332113333-----332222222333322233344433333333322110024---66541-344


Q ss_pred             CEEEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHH-HHHHHHHHHHHHHHHC--------
Q ss_conf             7578417502355-68887652233210267868998504001046311211433-2589999999875203--------
Q T0591           212 ATVIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAF-GSRAIIARMEKLQAIV--------  281 (406)
Q Consensus       212 ~~ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~-~~~~~i~~l~~~~~~~--------  281 (406)
                      ++||+|.+++... +.+...      +....+  +.++||...-.+++..-|.++ .++++.+.++..+...        
T Consensus       156 i~lIeD~a~a~g~~~~~~~~------g~~~gd--~~~fSf~~~K~l~~g~GG~i~~~~~~l~~~~~~~~~~~~~~~~~~~  227 (377)
T 3ju7_A          156 VPVVVDAAPGFGLMNGGMHY------GQDFSG--MIIYSFHATKPFGIGEGGLIYSKNEEDIQRIKRMGNFGFDTNRECT  227 (377)
T ss_dssp             CCBEEECTTCTTCEETTEET------TTTCSS--EEEEECBTTSSSCCBSCEEEEESCHHHHHHHHHHTBTTBCTTSCBC
T ss_pred             CCCCCCCCCHHCCCCCCCCC------CCCHHH--HHHCCCCHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             33233322000013322233------431144--4311320000122234320002205777666553012223322233


Q ss_pred             ----CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEE--ECC--CCC--EEEEEECCCCCCCHH
Q ss_conf             ----6761245799999998565258999999999999999999972799455--358--873--078776688788989
Q T0591           282 ----SLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFA--RTP--QAG--SYLFPRLPKLAVAPA  351 (406)
Q Consensus       282 ----~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~--~~p--~gg--~~~w~~~~~~~~~~~  351 (406)
                          ....+.+....+..-|+.    +.+..++.++..+...+.|.+.+....  ..+  ...  +|+.+-++. ..+..
T Consensus       228 ~~G~n~~~~~l~Aaigl~qL~~----ld~~~~~R~~ia~~y~~~L~~~~~~~~~~~~~~~~~~~~~~~~i~~~~-~~~r~  302 (377)
T 3ju7_A          228 MMGFNCKMSEYAAAIGIATMKK----WDDKLKERTRISEWYKQLLQSNGLMKKGWQLQKTEAVIQQFMPILCPE-EVRNK  302 (377)
T ss_dssp             SSCCBCCCCHHHHHHHHHHHHT----HHHHHHHHHHHHHHHHHHHHHTTTTTTTCBCCCCSCBCCSSEEEECCT-TSCHH
T ss_pred             CCCCCCCCCCCCCHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC-HHHHH
T ss_conf             4433211112331033446776----777754445356677776530334321122232333333222223410-56599


Q ss_pred             HHHHHHHHHCCEEEEECC--------CCCC--CC---------CCEEEEEEC--CCHHHHHHHHHHHHHHHH
Q ss_conf             999999986891896161--------0267--99---------985899850--997999999999999999
Q T0591           352 EFVKILRLQAGVVVTPGT--------EFSP--HT---------ADSVRLNFS--QDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       352 ~~~~~Ll~~~gV~v~pG~--------~Fg~--~~---------~~~iRis~~--~~~e~l~~al~rl~~~~~  402 (406)
                      ++.+.| .++||-+.+..        .|-.  .+         ...++|.+-  .++++++..++.|++.+-
T Consensus       303 ~l~~~L-~~~gI~~~~~y~p~~~~~~~~~~~~~~~~p~a~~i~~~~l~LP~~~~lt~~di~~I~~~l~~~v~  373 (377)
T 3ju7_A          303 QVIEDL-KKQKIEARLYFSPSCHQQVLFRNYKSTDLTRTNKIAKRIVSLPLWEGMTKEIVEQIVICLGQKVV  373 (377)
T ss_dssp             HHHHHH-HTTTBCCBCTTSSCGGGSGGGTTSCBSCCHHHHHHHHHEEEECCCTTCCHHHHHHHHHHHTC---
T ss_pred             HHHHHH-HHCCCCEEEECCCCCCCCHHHHCCCCCCCHHHHHHHHCEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             999999-98799856558972001788706997899899999848898879999899999999999999998


No 110
>3e6g_A Xometc, cystathionine gamma-lyase-like protein; bacterial blight, cystathionine lyase, reverse transsulfuration pathway; 2.80A {Xanthomonas oryzae PV}
Probab=99.79  E-value=1.2e-15  Score=123.60  Aligned_cols=282  Identities=16%  Similarity=0.138  Sum_probs=172.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHH-----HH
Q ss_conf             8887888898899999999998648867886707882487278999999997200101013105513899999-----82
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVE-----FF  145 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~-----~~  145 (406)
                      +-|+-. |.|. .+++.+.+....|.    ++-++ ++.+..++.. +..++.+||+|++..+.|......+.     ..
T Consensus        59 ~~Y~R~-~nPt-~~~le~~la~Leg~----~~a~~-~sSGmAa~~~-~l~~l~~Gd~vv~~~~~yg~t~~~~~~~~~~~~  130 (400)
T 3e6g_A           59 FEYSRT-HNPT-RFAYERCVAALEGG----TRAFA-FASGMAATST-VMELLDAGSHVVAMDDLYGGTFRLFERVRRRTA  130 (400)
T ss_dssp             -----C-CCHH-HHHHHHHHHHHHTC----SEEEE-ESSHHHHHHH-HHTTSCTTCEEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCC-CCHH-HHHHHHHHHHHHCC----CEEEE-CCCHHHHHHH-HHHHHCCCCEEEEECCCCCCCCCCCCHHHCCCC
T ss_conf             765289-8877-99999999997398----53665-3646779999-987515898899747987871011500002464


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCC
Q ss_conf             99699986044666776667788999998502540342156664323344378999999998637875784175023556
Q T0591           146 EGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRY  225 (406)
Q Consensus       146 g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~  225 (406)
                      |.++..+.           .-|+++++++++++||+|++-+|.||+..+..   +++|+++|+++|+++|+|+.+..-.+
T Consensus       131 gi~~~~~d-----------~~d~~~~~~ai~~~t~li~~EspsNP~l~v~D---i~~i~~iA~~~gi~~vVDnT~atP~~  196 (400)
T 3e6g_A          131 GLDFSFVD-----------LTDPAAFKAAIRADTKMVWIETPTNPMLKLVD---IAAIAVIARKHGLLTVVDNTFASPML  196 (400)
T ss_dssp             CCEEEEEC-----------TTCHHHHHHHCCTTEEEEEEESSCTTTCCCCC---HHHHHHHHHHTTCEEEEECSSSCTTT
T ss_pred             EEEEEEEC-----------CCCHHHHHHHCCCCCEEEEECCCCCCCEEECC---HHHHHHHHHHCCCEEEEECCCCCHHC
T ss_conf             17999816-----------99989999753768559995178997400056---69999999875986998156443000


Q ss_pred             CCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCC-HHHH--HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCH
Q ss_conf             888765223321026786899850400104631121-1433--2589999999875203676124579999999856525
Q T0591           226 AGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRL-GVAF--GSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPG  302 (406)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRi-G~~~--~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~  302 (406)
                          ..++ ..+ .|    |+++|+||.++-.|=-+ |.++  ..+.+.+.+...+.......+......+..-++    
T Consensus       197 ----~~Pl-~~G-aD----iVvhS~TKyi~Gh~d~~~G~vv~~~~~~~~~~~~~~~~~~G~~~~p~~a~l~~rgl~----  262 (400)
T 3e6g_A          197 ----QRPL-SLG-AD----LVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLK----  262 (400)
T ss_dssp             ----CCGG-GGT-CS----EEEEETTTTTTCSSSCCCEEEEECSCHHHHHHHHHHHHHHCCBCCHHHHHHHHHHHT----
T ss_pred             ----CCCH-HCC-CC----EEEEECCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCC----
T ss_conf             ----5750-207-99----899955502268885321225317718889999999987178688789999985407----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCE-EECCC-----------------CCEEEEEECCCCCCCHHHHHHHHHHHCCEE
Q ss_conf             899999999999999999997279945-53588-----------------730787766887889899999999868918
Q T0591           303 WMEDRIARHQAIRDELLHVLRGCEGVF-ARTPQ-----------------AGSYLFPRLPKLAVAPAEFVKILRLQAGVV  364 (406)
Q Consensus       303 ~~~~~~~~~~~~r~~l~~~L~~~~g~~-~~~p~-----------------gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~  364 (406)
                      -+..+.++..++...+.+.|...+.+. +..|.                 ||++.+ .+.    .+.+-+.++++.-.+.
T Consensus       263 TL~lRm~~~~~nA~~lA~~L~~hp~V~~V~yPgl~s~p~~~l~~~~~~g~gg~~sf-~l~----~~~~~~~~f~d~L~lf  337 (400)
T 3e6g_A          263 TLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGFGGIVSI-VLK----GGFDAAKRFCEKTELF  337 (400)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHTCTTEEEEECTTSTTSTTHHHHHHHCSSCCSEEEE-EET----THHHHHHHHHHHCSSS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCHHHHHHHCCCCCCEEEEE-EEC----CCHHHHHHHHHHCCCC
T ss_conf             29999999999999999999768882669899999992099998618998517999-981----8999999999709935


Q ss_pred             EEECCCCCC-------------------------CCCCEEEEEECC-CHHHHHHHH
Q ss_conf             961610267-------------------------999858998509-979999999
Q T0591           365 VTPGTEFSP-------------------------HTADSVRLNFSQ-DHEAAVAAA  394 (406)
Q Consensus       365 v~pG~~Fg~-------------------------~~~~~iRis~~~-~~e~l~~al  394 (406)
                       ..|..+|.                         -.++.||||++. +.|+|.+-+
T Consensus       338 -~~a~SlG~~~SLi~~pa~~th~~~~~~~r~~~Gi~~~liRlSvGlEd~~DLi~Dl  392 (400)
T 3e6g_A          338 -TLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDL  392 (400)
T ss_dssp             -EECSCCCCSSCEEECTTTTTTCSSCCTTTTTSSCCSSEEEEECCSSCHHHHHHHH
T ss_pred             -EEEECCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCEEEEEEECCCHHHHHHHH
T ss_conf             -4602678776166475221454499999996597929699987019999999999


No 111
>3jzl_A Putative cystathionine beta-lyase involved in aluminum resistance; YP_013912.1, structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A*
Probab=99.79  E-value=2.6e-17  Score=134.95  Aligned_cols=227  Identities=14%  Similarity=0.084  Sum_probs=147.0

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEE--ECCCCHHHHHHHHHHHHCCHHHHHHH-CCCHHHHHHHH----------HHCCE
Q ss_conf             9999999999864886788670788--24872789999999972001010131-05513899999----------82996
Q T0591            82 IRDLLAPRLAAFTGAPVDARDGLII--TPGTQGALFLAVAATVARGDKVAIVQ-PDYFANRKLVE----------FFEGE  148 (406)
Q Consensus        82 Lr~aia~~~~~~~g~~~~~~~~I~i--t~G~~~~l~~~~~~l~~pGd~Vl~~~-P~y~~~~~~~~----------~~g~~  148 (406)
                      =|+++-+.+.+.+|.    |+-++.  .+.+++++..++.+++.|||+|++.. +.|......+.          ..|.+
T Consensus        60 gr~~LE~~~A~LfGa----EaALvrp~fsSGT~Ai~~AL~all~PGDeVI~~~g~~Y~tl~~vig~~~~~~~sL~~~GV~  135 (409)
T 3jzl_A           60 GRDTLERVYATVFKT----EAALVRPQIISGTHAISTVLFGILRPDDELLYITGQPYDTLEEIVGIRKQGQGSLKDFHIG  135 (409)
T ss_dssp             HHHHHHHHHHHHHTC----SEEEEETTSCSHHHHHHHHHHHHCCTTCEEEECSSSCCTTHHHHHTSSSSSSSCTGGGTCE
T ss_pred             CHHHHHHHHHHHHCC----CEEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCE
T ss_conf             699999999988398----2068636876699999999998568999899846996377999865541224358873956


Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECC-CCCCCCCCCCCHHHHHHHHHHHHHC--CCEEEECCCCCCCCC
Q ss_conf             9998604466677666778899999850254034215-6664323344378999999998637--875784175023556
Q T0591           149 MVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFS-NPNNPAGVVYSAEEIGQIAALAARY--GATVIADQLYSRLRY  225 (406)
Q Consensus       149 ~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~-~P~NPTG~~~s~~~l~~i~~~a~~~--~~~ii~De~Y~~l~~  225 (406)
                      ...+++.      .+..+|+++++++++++||++++. ++++|++.+++.+++++|+++|+++  ++++++|++|..+.+
T Consensus       136 ~~~v~l~------~~g~id~e~ie~aI~p~TKlV~Ie~S~~y~~~p~l~i~dI~~I~~lak~~~~~viv~vDn~yg~~v~  209 (409)
T 3jzl_A          136 YSSVPLL------ENGDVDFPRIAKKMTPKTKMIGIQRSRGYADRPSFTIEKIKEMIVFVKNINPEVIVFVDNCYGEFVE  209 (409)
T ss_dssp             EEECCCC------TTSCCCHHHHHHHCCTTEEEEEEECSCTTSSSCCCCHHHHHHHHHHHHHHCTTCEEEEECTTCTTTS
T ss_pred             EEECCCC------CCCCCCHHHHHHHCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCHHH
T ss_conf             3524887------6564589999974467673799994478889997759999999999876189988998588754342


Q ss_pred             CCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHHHHHHHHHHHHHHHHHCCC----CHHHHHHHHHHHHHHCC
Q ss_conf             888765223321026786899850400104631-1211433258999999987520367----61245799999998565
Q T0591           226 AGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAFGSRAIIARMEKLQAIVSL----RAAGYSQAVLRGWFDEA  300 (406)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~~~~~i~~l~~~~~~~~~----~~~~~~q~a~~~~l~~~  300 (406)
                      ...+   + ... .|    ++++|+||.++-.+ .--||+++++++|++...-...-..    +++.-.   ...++. +
T Consensus       210 ~~~P---~-~~G-AD----lV~~SltK~LGG~~ap~GG~IaGkkelIe~a~~rltapg~g~~~ga~~~~---~~~~~q-G  276 (409)
T 3jzl_A          210 YQEP---P-EVG-AD----IIAGSLIKNPGGGLAKTGGYIAGKEALVDLCGYRLTTPGIGREAGASLYS---LLEMYQ-G  276 (409)
T ss_dssp             SCCS---G-GGT-CS----EEEEETTSGGGTTTCSSCEEEEECHHHHHHHHHHHSCTTTGGGCCCCTTC---HHHHHH-H
T ss_pred             CCCH---H-HHC-CC----EEEEEEEECCCCCCCCEEEEEECCHHHHHHHHHHHCCCCCCCCCCCCCCH---HHHHHH-H
T ss_conf             0686---7-858-78----89999851268987765789971899999999887289643334758552---479864-4


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             25899999999999999999997279945535
Q T0591           301 PGWMEDRIARHQAIRDELLHVLRGCEGVFART  332 (406)
Q Consensus       301 ~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~  332 (406)
                      --...+...+-.+.+......|.++ |+.+.+
T Consensus       277 ~f~ap~~v~~a~k~~~~~a~~l~~~-g~~v~P  307 (409)
T 3jzl_A          277 FFLAPHVTAQAIKGARFTAAMLAEF-GVEADP  307 (409)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHT-TCEEES
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCC
T ss_conf             2440799999999999999999967-996589


No 112
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3
Probab=99.78  E-value=7e-17  Score=132.07  Aligned_cols=299  Identities=11%  Similarity=0.090  Sum_probs=182.1

Q ss_pred             HHHHHHHHHHHHHCCCCCC-CCCEEEEECCCCHHHHHHHHHHH---HCCHHHHHHHCCCHHH--HHHHHHHCCEEEEEEE
Q ss_conf             8999999999986488678-86707882487278999999997---2001010131055138--9999982996999860
Q T0591            81 GIRDLLAPRLAAFTGAPVD-ARDGLIITPGTQGALFLAVAATV---ARGDKVAIVQPDYFAN--RKLVEFFEGEMVPVQL  154 (406)
Q Consensus        81 ~Lr~aia~~~~~~~g~~~~-~~~~I~it~G~~~~l~~~~~~l~---~pGd~Vl~~~P~y~~~--~~~~~~~g~~~v~v~~  154 (406)
                      ++-+.+.+.+++.++.... ..+.|++|.++|.++..++..++   .|||+|++..-++++.  ...++.+|.++..+..
T Consensus        38 ~~~~~~~~~lr~~~~~~~~~~~~~v~~tgsgT~a~e~~~~~l~~~~~~gd~vlv~~~g~~~~~~~~~a~~~g~~~~~v~~  117 (385)
T 2bkw_A           38 SIFQRVLKNTRAVFKSAAASKSQPFVLAGSGTLGWDIFASNFILSKAPNKNVLVVSTGTFSDRFADCLRSYGAQVDVVRP  117 (385)
T ss_dssp             HHHHHHHHHHHHHTTCCGGGTCEEEEEESCTTHHHHHHHHHHSCTTCSCCEEEEECSSHHHHHHHHHHHHTTCEEEEECC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999999998201588872999938689999999998632237998268984203556777776654311333223


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHC-CCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC--CEEEECCCCCCCCCCCCCCC
Q ss_conf             4466677666778899999850-25403421566643233443789999999986378--75784175023556888765
Q T0591           155 DYVSADETRAGLDLTGLEEAFK-AGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYG--ATVIADQLYSRLRYAGASYT  231 (406)
Q Consensus       155 ~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~--~~ii~De~Y~~l~~~~~~~~  231 (406)
                           .+.+..+|++++++.++ ++++++.++..+|.||...+   +++|.++|++|+  +++++|.+.+.   ...+ -
T Consensus       118 -----~~~g~~~~~~~l~~~i~~~~~~~v~~~h~etstG~~~p---i~~I~~~~~~~g~~~l~vvDa~~s~---G~~p-i  185 (385)
T 2bkw_A          118 -----LKIGESVPLELITEKLSQNSYGAVTVTHVDTSTAVLSD---LKAISQAIKQTSPETFFVVDAVCSI---GCEE-F  185 (385)
T ss_dssp             -----SSTTSCCCHHHHHHHHHHSCCSEEEEESEETTTTEECC---HHHHHHHHHHHCTTSEEEEECTTTT---TTSC-C
T ss_pred             -----CCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCC---CHHHHHHHHHCCCCEEEEEECCCCH---HEEE-C
T ss_conf             -----45787576467999740577439999622112220367---2023455540476036773022320---0232-0


Q ss_pred             CHHHHHCCCCCCEEEEEECCHHCC-CCCCCCHHHHHHHHHHHHHHHHH--------------------H-----HCCCCH
Q ss_conf             223321026786899850400104-63112114332589999999875--------------------2-----036761
Q T0591           232 HLRAEAAVDAENVVTIMGPSKTES-LSGYRLGVAFGSRAIIARMEKLQ--------------------A-----IVSLRA  285 (406)
Q Consensus       232 ~~~~~~~~~~~~~i~~~S~SK~~~-~~GlRiG~~~~~~~~i~~l~~~~--------------------~-----~~~~~~  285 (406)
                      .+..     ..--+++.|-.|.++ .||  +|+++.+++.++++....                    .     ..+.++
T Consensus       186 d~~~-----~~iD~~~~s~~K~l~gP~G--~g~l~~s~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~T  258 (385)
T 2bkw_A          186 EFDE-----WGVDFALTASQKAIGAPAG--LSISLCSSRFMDYALNDSKNGHVHGYFSSLRRWTPIMENYEAGKGAYFAT  258 (385)
T ss_dssp             CTTT-----TTCSEEEEESSSTTCCCSC--EEEEEECHHHHHHHTCHHHHCCCSCSTTCHHHHHHHHHHHHTTCCCCSSC
T ss_pred             CCCC-----CCEEEEEECCCCCCCCCCC--CHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             3555-----5338999547764457875--00677429987422201358888742010100357776420256777777


Q ss_pred             HHH-HHHHHHHHHHCCC-HHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC--CC----CCEEEEEECCCCCCCHHHHHHHH
Q ss_conf             245-7999999985652-5899999999999999999997279945535--88----73078776688788989999999
Q T0591           286 AGY-SQAVLRGWFDEAP-GWMEDRIARHQAIRDELLHVLRGCEGVFART--PQ----AGSYLFPRLPKLAVAPAEFVKIL  357 (406)
Q Consensus       286 ~~~-~q~a~~~~l~~~~-~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~--p~----gg~~~w~~~~~~~~~~~~~~~~L  357 (406)
                      +.. .-.++..+++... .-++...+++++..+.+.+.|.+-.++....  |+    .+. .-+.+|    +..++.+. 
T Consensus       259 p~v~~i~~l~~al~~i~~~G~~~~~~r~~~l~~~l~~~L~~~l~~~~~~~~~~~~~~~~v-~~~~~p----~~~d~~~~-  332 (385)
T 2bkw_A          259 PPVQLINSLDVALKEILEEGLHKRWDLHREMSDWFKDSLVNGLQLTSVSRYPSNMSAHGL-TAVYVA----DPPDVIAF-  332 (385)
T ss_dssp             CCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHTTTCCEESSCSSSTTBCSSC-EEEECS----CHHHHHHH-
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE-EEEECC----CHHHHHHH-
T ss_conf             887999999999999986666776599999999999733320354332358544567756-987179----87999999-


Q ss_pred             HHHCCEEEEECCCCCCCCCCEEEEE-EC--CC---HHHHHHHHHHHHHHHHHHC
Q ss_conf             9868918961610267999858998-50--99---7999999999999999856
Q T0591           358 RLQAGVVVTPGTEFSPHTADSVRLN-FS--QD---HEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       358 l~~~gV~v~pG~~Fg~~~~~~iRis-~~--~~---~e~l~~al~rl~~~~~~~r  405 (406)
                      ++++||.+.+|.. +.-+...+||+ ++  ..   .+.+..+++-|+..+++.|
T Consensus       333 L~~~gi~i~~G~~-~~~~~~~~RIg~mG~~~~~~~i~~~~~~l~~l~~~L~~~k  385 (385)
T 2bkw_A          333 LKSHGVVIAGGIH-KDIGPKYIRIGHMGVTACNKNLPYMKNCFDLIKLALQRKK  385 (385)
T ss_dssp             HHHTTEECBCCCC-TTTGGGEEEECCCGGGTSSTTCTHHHHHHHHHHHHTTC--
T ss_pred             HHHCCEEEECCCC-CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9978939976676-0017998988188588857799999999999999997567


No 113
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to P3F inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A*
Probab=99.77  E-value=1.6e-15  Score=122.87  Aligned_cols=284  Identities=15%  Similarity=0.182  Sum_probs=176.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHH----HC
Q ss_conf             88878888988999999999986488678867078824872789999999972001010131055138999998----29
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEF----FE  146 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~----~g  146 (406)
                      +-|+- .|.|.- +++.+.+....|.    + ..++++.+..|+..++.+++.+||+|++..+.|......+..    .|
T Consensus        74 ~~Y~R-~~nPt~-~~le~~la~LE~~----~-~a~~~sSGMaAI~~~~~~ll~~Gd~iv~~~~~Yg~T~~ll~~~l~~~G  146 (415)
T 2fq6_A           74 LFYGR-RGTLTH-FSLQQAMCELEGG----A-GCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLG  146 (415)
T ss_dssp             CCCTT-TCCHHH-HHHHHHHHHHHTC----S-EEEEESSHHHHHHHHHHTTCCTTCEEEEETTSCHHHHHHHHHTGGGGT
T ss_pred             EEEEC-CCCHHH-HHHHHHHHHHHCC----C-EEEEECCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCC
T ss_conf             66658-998659-9999999998298----6-189844879999999874057999476478786479999999877338


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHH--CCCEEEECCCCCCCC
Q ss_conf             969998604466677666778899999850254034215666432334437899999999863--787578417502355
Q T0591           147 GEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAAR--YGATVIADQLYSRLR  224 (406)
Q Consensus       147 ~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~--~~~~ii~De~Y~~l~  224 (406)
                      .+...+.           .-|++++++++++++|++++-+|.||+..+..   +++++++|++  +++++|+|+.+.--.
T Consensus       147 i~~~~~d-----------~~d~e~~~~~i~~~t~~v~~EspsNP~l~v~D---i~~i~~~a~~~~~g~~vvVDnT~atp~  212 (415)
T 2fq6_A          147 VTTSWFD-----------PLIGADIVKHLQPNTKIVFLESPGSITMEVHD---VPAIVAAVRSVVPDAIIMIDNTWAAGV  212 (415)
T ss_dssp             CEEEEEC-----------TTCGGGGGGGCCTTEEEEEEESSCTTTCCCCC---HHHHHHHHHHHCTTCEEEEECTTTTTT
T ss_pred             CEEEECC-----------CCCHHHHHHHHCCCCEEEEEECCCCCCCCCCC---CHHHHHHHHHCCCCCEEEEECCCCCCE
T ss_conf             0446359-----------99989999762755139997258887642136---299999987505796699977865510


Q ss_pred             CCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHH
Q ss_conf             6888765223321026786899850400104631-121143325899999998752036761245799999998565258
Q T0591           225 YAGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGW  303 (406)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~  303 (406)
                      +    ..++ .. ..|    |+++|.+|.++-.+ .=.|.++++++..+.+...........+......+..    +-+-
T Consensus       213 ~----~~Pl-~~-GaD----ivvhS~TKy~~Ghsdv~gG~vv~~~~~~~~~~~~~~~~G~~~~p~~a~ll~r----gl~T  278 (415)
T 2fq6_A          213 L----FKAL-DF-GID----VSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAYITSR----GLRT  278 (415)
T ss_dssp             S----SCGG-GG-TCS----EEEEETTTTTTCSSSCCCEEEEECTTTHHHHHHHHHHTTCCCCHHHHHHHHH----HHHH
T ss_pred             E----EECC-CC-CCE----EEEEECCCEECCCCCCCCCCEECCCHHHHHHHHHEECCCCCCCHHHHHHHHH----HHHH
T ss_conf             1----1102-48-862----8997065012688888788550030233320011011576678278999984----4768


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEE-ECC-----------------CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEE
Q ss_conf             999999999999999999972799455-358-----------------87307877668878898999999998689189
Q T0591           304 MEDRIARHQAIRDELLHVLRGCEGVFA-RTP-----------------QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVV  365 (406)
Q Consensus       304 ~~~~~~~~~~~r~~l~~~L~~~~g~~~-~~p-----------------~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v  365 (406)
                      +..+.++..++...+.+.|.+.+.+.. ..|                 .+|.+.+ .+.. ..+..+ +.+.++.-++. 
T Consensus       279 L~~R~~r~~~nA~~vA~~L~~hp~V~~V~yPgl~s~p~~~~a~~~~~g~~G~~sf-~l~~-~~~~e~-~~~f~~~L~lf-  354 (415)
T 2fq6_A          279 LGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSSGLFSF-VLKK-KLNNEE-LANYLDNFSLF-  354 (415)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCTTEEEEECTTSTTSTTHHHHHHHCSCCCSEEEE-EESS-CCCHHH-HHHHHTTCSSC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCEEE-EEEC-CCCHHH-HHHHHHCCCCC-
T ss_conf             9999999999999999998518985545677767886699998615799874478-9943-689999-99999728906-


Q ss_pred             EECCCCCC-----------------------CCCCEEEEEECC-CHHHHHHH
Q ss_conf             61610267-----------------------999858998509-97999999
Q T0591           366 TPGTEFSP-----------------------HTADSVRLNFSQ-DHEAAVAA  393 (406)
Q Consensus       366 ~pG~~Fg~-----------------------~~~~~iRis~~~-~~e~l~~a  393 (406)
                      ..|..||.                       -.++.||||++. +.|+|.+-
T Consensus       355 ~~a~SlG~~~SLi~~~~~~~~~~~~~~~~~gi~~~liRlSVGlEd~~DLi~D  406 (415)
T 2fq6_A          355 SMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGTLIRLHIGLEDVDDLIAD  406 (415)
T ss_dssp             EECSCCCSSSCEEEEECHHHHHTTCTTCCCCCCSCEEEEECCSSCHHHHHHH
T ss_pred             EEEECCCCCCCCEECCCCCCCCCCCCHHHCCCCCCEEEEEECCCCHHHHHHH
T ss_conf             5866778876664078443544579237659996979998542999999999


No 114
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (acoat), structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A*
Probab=99.77  E-value=6.7e-16  Score=125.43  Aligned_cols=341  Identities=11%  Similarity=0.081  Sum_probs=199.9

Q ss_pred             CC-CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             89-83341567--8678878889999999999808788887888898899999999998648867886707882487278
Q T0591            37 EG-RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        37 ~~-~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      ++ +.|||..|  ...+.+-.|.+.+++.+++.+...   ....-.-+++..+++++.+..+     .+.+..++++++|
T Consensus        38 dG~~yiD~~~g~g~~~lGh~~p~v~~Av~~q~~~~~~---~~~~~~~~~~~~lae~l~~~~~-----~~~~~~~~SGseA  109 (397)
T 2ord_A           38 KGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIH---CSNLFWNRPQMELAELLSKNTF-----GGKVFFANTGTEA  109 (397)
T ss_dssp             TCCEEEESSHHHHTCTTCBTCHHHHHHHHHHHHHCSC---CCTTSEEHHHHHHHHHHHHTTT-----SCEEEEESSHHHH
T ss_pred             CCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCC---CCCCCCCHHHHHHHHHHHHHCC-----CCEEEEECCCHHH
T ss_conf             9799998553888610168979999999999974567---6674126699999999887588-----6628874776289


Q ss_pred             HHHHHHHHHH------C-CHHHHHHHCCCHHHHHHH-HHHCCEEEEEEECCC-CCCCCCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             9999999972------0-010101310551389999-982996999860446-667766677889999985025403421
Q T0591           114 LFLAVAATVA------R-GDKVAIVQPDYFANRKLV-EFFEGEMVPVQLDYV-SADETRAGLDLTGLEEAFKAGARVFLF  184 (406)
Q Consensus       114 l~~~~~~l~~------p-Gd~Vl~~~P~y~~~~~~~-~~~g~~~v~v~~~~~-~~~~~~~~~d~~~l~~~~~~~~k~i~l  184 (406)
                      ...++.....      + ...++....+|++..... ...|......+.... +.......-+++++++.+.+++.++++
T Consensus       110 ~e~Aik~ar~~~~~~~~~r~~ii~~~~~yHG~~~~~~~~sg~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~~~iaavIi  189 (397)
T 2ord_A          110 NEAAIKIARKYGKKKSEKKYRILSAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFL  189 (397)
T ss_dssp             HHHHHHHHHHHHHHHCTTCCEEEEEBTCCCCSSHHHHHHSBCHHHHGGGCSCCTTEEEECTTCHHHHHHHCCTTEEEEEE
T ss_pred             HHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEEEEE
T ss_conf             99999999997376787764488313887788655401368843457888999984344866099999736897679999


Q ss_pred             CCC-CCCCCCC-CCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCH
Q ss_conf             566-6432334-43789999999986378757841750235568887652233210267868998504001046311211
Q T0591           185 SNP-NNPAGVV-YSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLG  262 (406)
Q Consensus       185 ~~P-~NPTG~~-~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG  262 (406)
                       .| .+..|.. .+++.+++|.++|++||+++|.||++..|.-.|.-.. .. .....+|    +.++||.++ .|+-+|
T Consensus       190 -Epv~~~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tGfgR~G~~~~-~~-~~gv~PD----i~~~gK~lg-gg~p~~  261 (397)
T 2ord_A          190 -EPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFA-YQ-KYGVVPD----VLTTAKGLG-GGVPIG  261 (397)
T ss_dssp             -CSEECTTTCEECCHHHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSH-HH-HHTCCCS----EEEECGGGG-TTSCCE
T ss_pred             -ECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCHH-HC-CCCCCCC----CEEECHHHC-CCCCEE
T ss_conf             -615678897709989999999999872968997132407865574522-04-7898944----133122435-997237


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEE
Q ss_conf             43325899999998752036761245799999998565--2589999999999999999999727994553588730787
Q T0591           263 VAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLF  340 (406)
Q Consensus       263 ~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w  340 (406)
                      .+++..++. .+.......+++.++++..++.+.|+..  +...+...+.-+..++.+.+.+.+.+-+.-.... |..+-
T Consensus       262 a~~~~~~~~-~~~~~~~~~T~~g~p~a~AAa~a~L~~i~~~~~~~~v~~~g~~l~~~l~~l~~~~~~v~~vrg~-G~~~~  339 (397)
T 2ord_A          262 AVIVNERAN-VLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGM-GLMIG  339 (397)
T ss_dssp             EEEECSTTC-CCCTTSSCCSSTTCHHHHHHHHHHHHHHTSTTHHHHHHHHHHHHHHHHHHHHHHCTTEEEEEEE-TTEEE
T ss_pred             EEEEHHHHH-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEE-CEEEE
T ss_conf             888813453-1778781878860699999999999999867869999999999999999999868984778775-51999


Q ss_pred             EECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHH
Q ss_conf             766887889899999999868918961610267999858998--509979999999999999998
Q T0591           341 PRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       341 ~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~~~~~  403 (406)
                      +.+.+ .....+++.++++ +||.+.|.      +.+.+|++  +..+++++++++++|.+++++
T Consensus       340 i~~~~-~~~~~~~~~~~~~-~Gll~~~~------g~~~i~~~Ppl~it~~eid~~i~~l~~alk~  396 (397)
T 2ord_A          340 IQFRE-EVSNREVATKCFE-NKLLVVPA------GNNTIRFLPPLTVEYGEIDLAVETLKKVLQG  396 (397)
T ss_dssp             EEECT-TSCHHHHHHHHHH-TTEECEEE------TTTEEEECCCTTCCHHHHHHHHHHHHHHHHT
T ss_pred             EEECC-CCCHHHHHHHHHH-CCCEEEEC------CCCEEEEECCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             99768-7766999999997-89899727------9998999798688999999999999999955


No 115
>3ffr_A Phosphoserine aminotransferase SERC; YP_677612.1, structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406}
Probab=99.77  E-value=7.9e-16  Score=124.95  Aligned_cols=326  Identities=10%  Similarity=0.060  Sum_probs=192.0

Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHCCCC--CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHH
Q ss_conf             341567867887888999999999980878--888788889889999999999864886788670788248727899999
Q T0591            41 VDFSHGDVDAHEPTPGAFDLFSAGVQSGGV--QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAV  118 (406)
Q Consensus        41 i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~--~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~  118 (406)
                      +.|+-|   +..-++.+.+++.+.+.....  .+.++  -..++-+...+.+++..|.+-  ...|++|.|+|+++..++
T Consensus         6 ~~f~pG---P~~~~~~V~~a~~~~~~~~~~~~~HRs~--~f~~i~~~~r~~l~~ll~~~~--~~~iif~~~gT~a~~~~~   78 (362)
T 3ffr_A            6 IYFTPG---PSELYPTVRQHMITALDEKIGVISHRSK--KFEEVYKTASDNLKTLLELPS--NYEVLFLASATEIWERII   78 (362)
T ss_dssp             EEECSS---SCCCCTTHHHHHHHHHHTTTTTSCTTSH--HHHHHHHHHHHHHHHHTTCCT--TEEEEEESCHHHHHHHHH
T ss_pred             EEECCC---CCCCCHHHHHHHHHHHHHCCCCCCCCCH--HHHHHHHHHHHHHHHHHCCCC--CCEEEEECCHHHHHHHHH
T ss_conf             410179---9288999999999987744898777788--999999999999999967999--978999587699999999


Q ss_pred             HHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHH
Q ss_conf             99972001010131055138999998299699986044666776667788999998502540342156664323344378
Q T0591           119 AATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAE  198 (406)
Q Consensus       119 ~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~  198 (406)
                      ..+.++++.+++...+-......++.+|.++..+..+.      +..+|+++++  ..++++++.++.-+|.||...+  
T Consensus        79 ~~l~~~~~~~i~~g~~~~~~~~~a~~~g~~v~~~~~~~------~~~~~~~~~~--~~~~~~~v~~~h~~t~tG~~~p--  148 (362)
T 3ffr_A           79 QNCVEKKSFHCVNGSFSKRFYEFAGELGREAYKEEAAF------GKGFYPADIT--VPADAEIICLTHNETSSGVSMP--  148 (362)
T ss_dssp             HHHCSSEEEEEECSHHHHHHHHHHHHTTCEEEEEECCT------TCCCCGGGCC--CCTTCCEEEEESEETTTTEECC--
T ss_pred             HHHCCCCEEEEECCCHHHHHHHHHHHCCCCEEEECCCC------CCCCCHHHHH--CCCCCCEEEEECCCCCCCEEEC--
T ss_conf             72002550588468137899999975185004862676------7546876752--3778765888534587654633--


Q ss_pred             HHHHHHHHHHH-CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCC-CCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999999863-78757841750235568887652233210267868998504001046-31121143325899999998
Q T0591           199 EIGQIAALAAR-YGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESL-SGYRLGVAFGSRAIIARMEK  276 (406)
Q Consensus       199 ~l~~i~~~a~~-~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~-~GlRiG~~~~~~~~i~~l~~  276 (406)
                       +++|.++|++ +|+++++|-+.+...   .+   +.. ..  -+  +++.|-.|.++. ||  +|+++..+++++.+..
T Consensus       149 -i~~I~~~~~k~~~~l~~vDa~qs~g~---~~---iD~-~~--iD--~~~~s~~K~l~~P~G--~g~l~~~~~~l~~~~~  214 (362)
T 3ffr_A          149 -VEDINTFRDKNKDALIFVDAVSSLPY---PK---FDW-TK--ID--SVFFSVQKCFGLPAG--LGVWILNDRVIEKSKA  214 (362)
T ss_dssp             -HHHHTTSGGGSTTSEEEEECTTTTTS---SC---CCT-TS--CS--EEEEETTSTTCCCSC--CEEEEEEHHHHHHHHH
T ss_pred             -HHHHHHHHHCCCCCEEEECCCCCCCC---CC---CCC-HH--CC--EEEECCCCCCCCCCC--EEEEEECHHHHHHHHC
T ss_conf             -15441111025782475256544343---45---320-11--54--357236655668986--2478987999975431


Q ss_pred             HHHH--------------------CCCCHHH-HHHHHHHHHHHCCC-HHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC
Q ss_conf             7520--------------------3676124-57999999985652-589999999999999999999727994553588
Q T0591           277 LQAI--------------------VSLRAAG-YSQAVLRGWFDEAP-GWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ  334 (406)
Q Consensus       277 ~~~~--------------------~~~~~~~-~~q~a~~~~l~~~~-~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~  334 (406)
                      ....                    .+.+++. ....++...++... .-++...++.+++.+.+.+.+.+.++..+...+
T Consensus       215 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~Tp~~~~i~~l~~al~~~~~~g~e~i~~~~~~~~~~l~~~l~~~~~~~~~~~~  294 (362)
T 3ffr_A          215 LLAKRKSIGTYHTIPSMLEKARVNQTPETPNAMNIFLLGKVTGDMLQISADGIRKQTEEKAALINTYIESSKVFSFGVED  294 (362)
T ss_dssp             HHHTTCCCCSTTSHHHHHHHHTTTCCSSCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCSSEEESSSC
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCEECCCCC
T ss_conf             26898760144667899986531577757579999999999998876362258999999999999999968891137788


Q ss_pred             CCE--EEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC--CCHHHHHHHHHHHHHHH
Q ss_conf             730--78776688788989999999986891896161026799985899850--99799999999999999
Q T0591           335 AGS--YLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS--QDHEAAVAAARRIVTLV  401 (406)
Q Consensus       335 gg~--~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~--~~~e~l~~al~rl~~~~  401 (406)
                      ...  ..-+.++. +.+..++. .+++++||.+.+|..  ....+.+|++..  .+.|+++..++.|++.+
T Consensus       295 ~~~~s~~~i~~~~-~~~~~~~~-~~l~~~~i~i~~g~g--~~~~~~~Ris~~~~~t~edI~~lv~alke~l  361 (362)
T 3ffr_A          295 AKLRSMTTIVANT-TMLPGEIN-KILEPFDMAVGAGYG--SKKETQIRIANFPAHSLEQVHKLVQTLKEKI  361 (362)
T ss_dssp             GGGBCSSEEEEEE-SSCHHHHH-HHHGGGTEEEEECSG--GGTTTEEEEECCTTSCHHHHHHHHHHHHHHT
T ss_pred             CCCCCEEEEECCC-CCCHHHHH-HHHHHCCCEEECCCC--CCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             2017668998999-98989999-999968965214885--6689899887589999999999999999974


No 116
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4
Probab=99.77  E-value=1.8e-15  Score=122.55  Aligned_cols=341  Identities=15%  Similarity=0.111  Sum_probs=195.8

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.|||..|  ...+.+-.|.+.+++.+.+......   ...-.....+..++.+....|     .+.++.+++++++...
T Consensus        66 ~yiD~~~g~~~~~lGh~hp~v~~Ai~~q~~~~~~~---~~~~~~~~~~~~e~ll~~~~~-----~~~v~f~~sGseA~e~  137 (433)
T 1z7d_A           66 RYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTIC---SRAFFSVPLGICERYLTNLLG-----YDKVLMMNTGAEANET  137 (433)
T ss_dssp             EEEESSHHHHTTTTCBTCHHHHHHHHHHHTTCSCC---CTTSEEHHHHHHHHHHHHHHT-----CSEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHHHHCCCHHHHHHHHHHHHHCCCC---CCCCCHHHHHHHHHHHHHCCC-----CCEEEEEECCCCHHHH
T ss_conf             99984418886714059899999999999855875---465540799999997645678-----6415774112421567


Q ss_pred             HHHHHHHCCH----------HHHHHHCCCHHHHHHHHH-HCCEE---EEEEECCCCCCCCCCCCCHHHHHHHHCC-CCEE
Q ss_conf             9999972001----------010131055138999998-29969---9986044666776667788999998502-5403
Q T0591           117 AVAATVARGD----------KVAIVQPDYFANRKLVEF-FEGEM---VPVQLDYVSADETRAGLDLTGLEEAFKA-GARV  181 (406)
Q Consensus       117 ~~~~l~~pGd----------~Vl~~~P~y~~~~~~~~~-~g~~~---v~v~~~~~~~~~~~~~~d~~~l~~~~~~-~~k~  181 (406)
                      ++.....-+.          .++...-+|+........ .+...   ...|....  ...--..|.+++++.+++ ++.+
T Consensus       138 a~klar~~~~~~~~~~~~~~~i~~~~~~yhG~t~~~~~~~~~~~~~~~~~~~~~~--~~~~p~~d~~~le~~l~~~~iAa  215 (433)
T 1z7d_A          138 AYKLCRKWGYEVKKIPENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFGPFAPQ--FSKVPYDDLEALEEELKDPNVCA  215 (433)
T ss_dssp             HHHHHHHHHHHTSCCCTTCCEEEEETTC--------------------------C--EEEECTTCHHHHHHHHTSTTEEE
T ss_pred             HHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC--EECCCCCHHHHHHHHCCCCCEEE
T ss_conf             9999988763234433333432467632688743110267885556688888873--01237775999998648998699


Q ss_pred             EECCCC-CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-
Q ss_conf             421566-643233-44378999999998637875784175023556888765223321026786899850400104631-
Q T0591           182 FLFSNP-NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-  258 (406)
Q Consensus       182 i~l~~P-~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-  258 (406)
                      +++ -| ..-.|. ..+++.+++|.++|++||+++|.||++..|.-.|.-... .. ....||  |+  +++|.++ .| 
T Consensus       216 vi~-EPv~g~~G~~~~~~~~l~~lr~lc~~~gillI~DEV~tGfGRtG~~~~~-e~-~gv~PD--iv--~~gK~l~-gG~  287 (433)
T 1z7d_A          216 FIV-EPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCV-HH-YNVKPD--VI--LLGKALS-GGH  287 (433)
T ss_dssp             EEE-CSSBSTTTSBCCCTTHHHHHHHHHHHTTCEEEEECTTTTTTTTSSSSGG-GG-GTCCCS--EE--EECGGGG-TTS
T ss_pred             EEE-EEECCCCCCEECCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCH-HH-CCCCCC--EE--EECCCCC-CCC
T ss_conf             999-7574888985099999999999998819689994576588852343325-44-399987--88--7310034-887


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCC
Q ss_conf             12114332589999999875203676124579999999856--5258999999999999999999972799455358873
Q T0591           259 YRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDE--APGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAG  336 (406)
Q Consensus       259 lRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~--~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg  336 (406)
                      +-+|.+++.+++.+.+.......+++.+++...++.+.++.  .+...+...+.-+..++.+.+.+.+.+.+......| 
T Consensus       288 ~p~~av~~~~~i~~~~~~~~~~~Tf~g~pl~~aAa~a~L~~l~~~~~~~~v~~~g~~l~~~L~~~~~~~~~v~~vrg~G-  366 (433)
T 1z7d_A          288 YPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKG-  366 (433)
T ss_dssp             SCCEEEEECHHHHTTCCTTCCCCTTTTCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHTTCTTEEEEEEET-
T ss_pred             CCCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECC-
T ss_conf             7642114519886157899867788989245577676655553112577766535899999999975699707986158-


Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             0787766887889899999999868918961610267999858998--50997999999999999999856
Q T0591           337 SYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       337 ~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      +.+-+.+.+......+++..++ +.||++.|.      +.+.||++  +..+++++++++++|.+.++++.
T Consensus       367 lm~~i~f~~~~~~~~~~~~~l~-~~Gll~~~~------~~~~ir~~Ppl~it~~did~~~~~l~~alk~ld  430 (433)
T 1z7d_A          367 LLCAIEFKNELVNVLDICLKLK-ENGLITRDV------HDKTIRLTPPLCITKEQLDECTEIIVKTVKFFD  430 (433)
T ss_dssp             TEEEEEECTTTCCHHHHHHHHH-HTTEECCEE------TTTEEEECCCTTCCHHHHHHHHHHHHHHHHHHC
T ss_pred             EEEEEEECCCCCCHHHHHHHHH-HCCEEEECC------CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             0899997488668999999999-699489327------999899979847899999999999999999997


No 117
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A*
Probab=99.76  E-value=2e-15  Score=122.18  Aligned_cols=309  Identities=14%  Similarity=0.154  Sum_probs=195.0

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH-HHCCHHHHHHHC
Q ss_conf             8999999999980878888788889889999999999864886788670788248727899999999-720010101310
Q T0591            55 PGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT-VARGDKVAIVQP  133 (406)
Q Consensus        55 ~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l-~~pGd~Vl~~~P  133 (406)
                      ++-++++.+.+.++... .++.  ..+|.+.+|++    +|.    + ..+.++.+|.||.+++.++ +.+||+|+++..
T Consensus        20 ~~e~~~v~~~l~sg~~~-~G~~--v~~fE~~~a~~----~g~----~-~av~~~Sgt~Al~~al~al~~~~gdeVi~p~~   87 (393)
T 1mdo_A           20 AEELAAVKTVLDSGWIT-TGPK--NQELEAAFCRL----TGN----Q-YAVAVSSATAGMHIALMALGIGEGDEVITPSM   87 (393)
T ss_dssp             HHHHHHHHHHHHHTCCS-SSHH--HHHHHHHHHHH----HCC----S-EEEEESCHHHHHHHHHHHTTCCTTCEEEEESS
T ss_pred             HHHHHHHHHHHHCCCCC-CCHH--HHHHHHHHHHH----HCC----C-EEEEECCHHHHHHHHHHHCCCCCCCEEECCCC
T ss_conf             99999999999759876-8988--99999999999----782----9-59996788999999999819999898957996


Q ss_pred             CCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             55138999998299699986044666776667788999998502540342156664323344378999999998637875
Q T0591           134 DYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGAT  213 (406)
Q Consensus       134 ~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~  213 (406)
                      +|.+....+...|++++.+.++     .+.+.+|++.+++.++++||+|+++   +..|....   +++|.++|+++|++
T Consensus        88 t~~~~~~ai~~~g~~pv~~Di~-----~~~~~~d~~~l~~~i~~~tkaIi~~---h~~G~~~d---~~~i~~i~~~~~i~  156 (393)
T 1mdo_A           88 TWVSTLNMIVLLGANPVMVDVD-----RDTLMVTPEHIEAAITPQTKAIIPV---HYAGAPAD---LDAIYALGERYGIP  156 (393)
T ss_dssp             SCHHHHHHHHHTTCEEEEECBC-----TTTCCBCHHHHHHHCCTTEEEECCB---CGGGCCCC---HHHHHHHHHHHTCC
T ss_pred             EEHHHHHHHHHCCCEEEEECCC-----CCCCCCCHHHHHHHHCCCCEEEEEE---CCCCCCCC---HHHHHHHHHHCCCE
T ss_conf             4033103653359888994143-----3234688999997517785089702---78587214---88999999974976


Q ss_pred             EEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEEC--CHHCCCCCCCCHHHHH-HHHHHHHHHHHHHHCC-------
Q ss_conf             78417502355-68887652233210267868998504--0010463112114332-5899999998752036-------
Q T0591           214 VIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGP--SKTESLSGYRLGVAFG-SRAIIARMEKLQAIVS-------  282 (406)
Q Consensus       214 ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~--SK~~~~~GlRiG~~~~-~~~~i~~l~~~~~~~~-------  282 (406)
                      ||+|.+.+... |.+...      +  ..+  ..++||  +|.++ +| .-|.++. ++++.+.++.++....       
T Consensus       157 lIeD~a~a~g~~~~~~~~------g--~~g--~~~fSf~~~K~l~-~g-eGG~i~t~~~~l~~~~~~l~~~g~~~~~~~~  224 (393)
T 1mdo_A          157 VIEDAAHATGTSYKGRHI------G--ARG--TAIFSFHAIKNIT-CA-EGGIVVTDNPQFADKLRSLKFHGLGVDAWDR  224 (393)
T ss_dssp             BCEECTTCTTCEETTEET------T--SSS--EEEEECCTTSSSC-SS-SCEEEEESCHHHHHHHHHHTBTTEECC----
T ss_pred             EEECCCCCCCCCCCCCCC------C--CCC--EEEEECCCCCCCC-CC-CCEEEEEEHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             997583202670089214------7--887--1898698866787-88-9618995129999999987755977543533


Q ss_pred             -----------------CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCC----CEEEEE
Q ss_conf             -----------------76124579999999856525899999999999999999997279945535887----307877
Q T0591           283 -----------------LRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQA----GSYLFP  341 (406)
Q Consensus       283 -----------------~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~g----g~~~w~  341 (406)
                                       +..+.+.......-|    +.+.+..++.++..+.+.+.|.+++++....+..    .++.++
T Consensus       225 ~~~~~~~~~~~~~~G~N~rmsel~Aaig~~qL----~~l~~~i~~R~~~~~~y~~~L~~~~~~~~~~~~~~~~~~~~~~~  300 (393)
T 1mdo_A          225 QSGGRAPQAEVLAPGYKYNLPDLNAAIALAQL----QKLDALNARRAAIAAQYHQAMADLPFQPLSLPSWEHIHAWHLFI  300 (393)
T ss_dssp             -------CCEESSCCCBCCCCHHHHHHHHHHH----HTHHHHHHHHHHHHHHHHHHHHTSSCEECCCCSSCEECCCSCEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCC----CCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEE
T ss_conf             23333321123568756463257887752001----00489999999999999998605898656663212432104542


Q ss_pred             E-CC--CCCCCHHHHHHHHHHHCCEEEEECC-----------CCCCC--------CCCEEEEEEC--CCHHHHHHHHHHH
Q ss_conf             6-68--8788989999999986891896161-----------02679--------9985899850--9979999999999
Q T0591           342 R-LP--KLAVAPAEFVKILRLQAGVVVTPGT-----------EFSPH--------TADSVRLNFS--QDHEAAVAAARRI  397 (406)
Q Consensus       342 ~-~~--~~~~~~~~~~~~Ll~~~gV~v~pG~-----------~Fg~~--------~~~~iRis~~--~~~e~l~~al~rl  397 (406)
                      - +.  ....+..++.+.| .+.||-+.+..           .|...        ....+.|.+-  .++++++..++.|
T Consensus       301 ~~~~~~~~~~~Rd~l~~~L-~~~gI~~~~~y~pl~~~~~~~~~~~~~~~p~ae~~~~~~l~LP~~~~lt~~di~~Ii~~i  379 (393)
T 1mdo_A          301 IRVDEARCGITRDALMASL-KTKGIGTGLHFRAAHTQKYYRERFPTLTLPDTEWNSERICSLPLFPDMTESDFDRVITAL  379 (393)
T ss_dssp             EECCHHHHSSCHHHHHHHH-HHTTBCCBCCCCCGGGSHHHHHHSTTCCCHHHHHHHTTEEEECCCTTCCHHHHHHHHHHH
T ss_pred             EECCHHHCCCCHHHHHHHH-HHCCCCEEEECCCHHCCHHHHHHCCCCCCHHHHHHHHCEEECCCCCCCCHHHHHHHHHHH
T ss_conf             2043222413599999999-987998221585123189989638778998999998497986489999999999999999


Q ss_pred             HHHHHH
Q ss_conf             999998
Q T0591           398 VTLVER  403 (406)
Q Consensus       398 ~~~~~~  403 (406)
                      ++++++
T Consensus       380 ~~i~~~  385 (393)
T 1mdo_A          380 HQIAGQ  385 (393)
T ss_dssp             HHHHC-
T ss_pred             HHHHHC
T ss_conf             999966


No 118
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus VF5}
Probab=99.76  E-value=2.2e-15  Score=121.95  Aligned_cols=334  Identities=11%  Similarity=0.087  Sum_probs=204.6

Q ss_pred             CC-CCEEECC--CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             89-8334156--78678878889999999999808788887888898899999999998648867886707882487278
Q T0591            37 EG-RPVDFSH--GDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        37 ~~-~~i~ls~--G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      ++ +.||+..  |...+.+-.|.+.+++.+++.....  .+..... +....+++.+....+    ..+.+..+++++++
T Consensus        26 dG~~yiD~~~g~g~~~lGh~~p~v~~Ai~~q~~~~~~--~~~~~~~-~~~~~l~~~l~~~~~----~~~~~~f~~sGseA   98 (375)
T 2eh6_A           26 EGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLH--VSNLYEN-PWQEELAHKLVKHFW----TEGKVFFANSGTES   98 (375)
T ss_dssp             TCCEEEESSHHHHTCTTCBSCHHHHHHHHHHHHHCSC--CCTTBCC-HHHHHHHHHHHHTSS----SCEEEEEESSHHHH
T ss_pred             CCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCC--CCCCCCC-HHHHHHHHHHHHCCC----CCCEEEECCCCCCH
T ss_conf             9899998652888620178959999999999865377--6654257-699999874221265----32201223786326


Q ss_pred             HHHHHHHHH------HCC-HHHHHHHCCCHHHHHHHH-HHCCEEEEEEECCC-CCCCCCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             999999997------200-101013105513899999-82996999860446-667766677889999985025403421
Q T0591           114 LFLAVAATV------ARG-DKVAIVQPDYFANRKLVE-FFEGEMVPVQLDYV-SADETRAGLDLTGLEEAFKAGARVFLF  184 (406)
Q Consensus       114 l~~~~~~l~------~pG-d~Vl~~~P~y~~~~~~~~-~~g~~~v~v~~~~~-~~~~~~~~~d~~~l~~~~~~~~k~i~l  184 (406)
                      ...++....      ..| ..|+..+.+|++...... ..|-....-+.... .........+++++.+.+.+++.++++
T Consensus        99 ~e~Aikla~~~~~~~~~~r~~ii~~~~~yHG~t~~~~~~sg~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~iAavi~  178 (375)
T 2eh6_A           99 VEAAIKLARKYWRDKGKNKWKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLDEETAGIII  178 (375)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCEEEEEBTCCCCSSHHHHHHCBCGGGTTTTCSCCSSEEEECTTCHHHHHTTCCTTEEEEEE
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEE
T ss_conf             99999999999985089967899988986997455523568813345778999983322344799999964898369999


Q ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCH
Q ss_conf             566-643233-443789999999986378757841750235568887652233210267868998504001046311211
Q T0591           185 SNP-NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLG  262 (406)
Q Consensus       185 ~~P-~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG  262 (406)
                       .| .+-.|. ..+++.+++|.++|++||+++|.||++..|.-.|.-+.. .. ....||  |+  .+||.++ .|+-+|
T Consensus       179 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~gRtG~~~a~-~~-~gv~PD--i~--~~gK~l~-~G~p~~  250 (375)
T 2eh6_A          179 -EVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAY-QH-FNLKPD--VI--ALAKGLG-GGVPIG  250 (375)
T ss_dssp             -CSEETTTTSEECCHHHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSGG-GG-GTCCCS--EE--EECGGGG-TTSCCE
T ss_pred             -ECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHH-HH-CCCCCC--EE--EECCCCC-CCCEEE
T ss_conf             -6446778974799899999999999819889966564087655477404-44-299843--01--1042345-674136


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEE
Q ss_conf             43325899999998752036761245799999998565258999999999999999999972799455358873078776
Q T0591           263 VAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPR  342 (406)
Q Consensus       263 ~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~  342 (406)
                      .+++.+++.+.+.......+++.++++..++.+.++.    +++...+.++..+.+.+.|+++.--.+. .. |++.-+.
T Consensus       251 a~~~~~~~~~~~~~~~~~~T~~g~p~a~aaa~a~l~~----~e~~~~~~~~~~~~~~~~L~~l~~~~vr-g~-Gl~~~ie  324 (375)
T 2eh6_A          251 AILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVVDE----VEKLLPHVREVGNYFKEKLKELGKGKVK-GR-GLMLGLE  324 (375)
T ss_dssp             EEEEEHHHHTTCCTTSCCCSSTTCHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHTTSSEEE-EE-TTEEEEE
T ss_pred             EEEECHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHH----HHCHHHHHHHHHHHHHHHHHHHCCCCEE-EC-CEEEEEE
T ss_conf             6886288762426898564728892788999999999----9661367889999999998873579740-02-3699999


Q ss_pred             CCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHH
Q ss_conf             6887889899999999868918961610267999858998--5099799999999999999
Q T0591           343 LPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVTLV  401 (406)
Q Consensus       343 ~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~~~  401 (406)
                      +..   +..+++.++++ .|+++.+.      +.+.+|++  +..+++++++++++|.+.+
T Consensus       325 ~~~---~~~~~~~~~~~-~Gv~~~~~------~~~~ir~~Ppl~it~~~id~~~~~l~~~L  375 (375)
T 2eh6_A          325 LER---ECKDYVLKALE-KGLLINCT------AGKVLRFLPPLIIQKEHIDRAISVLREIL  375 (375)
T ss_dssp             CSS---CCHHHHHHHHH-TTEECEEE------TTTEEEECCCTTCCHHHHHHHHHHHHHHC
T ss_pred             ECC---CHHHHHHHHHH-CCCEEECC------CCCEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             656---07999999997-89289028------99989995896889999999999999869


No 119
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, pyridoxal phosphate, PSI-2, protein structure initiative; 1.70A {Deinococcus radiodurans}
Probab=99.76  E-value=6.3e-15  Score=118.82  Aligned_cols=353  Identities=15%  Similarity=0.085  Sum_probs=200.1

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.||+..|  ...+-+-.|.+.+++.+.+......  ......-+.+..+|+.+.+..+.+   .+.++.++++++|...
T Consensus        30 ~ylD~~~g~g~~~lGh~~p~i~~ai~~q~~~~~~~--~~~~~~~~~~~~lae~L~~~~~~~---~~~v~~~~sGseA~e~  104 (430)
T 3i4j_A           30 RYLDGSSGALVANIGHGRAEVGERMAAQAARLPFV--HGSQFSSDVLEEYAGRLARFVGLP---TFRFWAVSGGSEATES  104 (430)
T ss_dssp             EEEETTHHHHTCTTCBCCHHHHHHHHHHHHHCCCC--CTTTCEEHHHHHHHHHHHHHTTCT---TCEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCC--CCCCCCCHHHHHHHHHHHHHCCCC---CCEEEECCCHHHHHHH
T ss_conf             99988633898870899699999999998656875--667546099999999999866998---1459942865899999


Q ss_pred             HHHHHH-------HCC-HHHHHHHCCCHHHHHHHH-HHCCEE-----EEEEEC------CCCCCCCCCCCCHHHHHHHHC
Q ss_conf             999997-------200-101013105513899999-829969-----998604------466677666778899999850
Q T0591           117 AVAATV-------ARG-DKVAIVQPDYFANRKLVE-FFEGEM-----VPVQLD------YVSADETRAGLDLTGLEEAFK  176 (406)
Q Consensus       117 ~~~~l~-------~pG-d~Vl~~~P~y~~~~~~~~-~~g~~~-----v~v~~~------~~~~~~~~~~~d~~~l~~~~~  176 (406)
                      +++.--       .+| ..|+....+|++...... ..+-..     .+++..      ...........+.+.+++.+.
T Consensus       105 AiklAr~~~~~~~~tgr~~Ii~~~~~yHG~t~~a~~~s~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~  184 (430)
T 3i4j_A          105 AVKLARQYHVERGEPGRFKVITRVPSYHGASLGSLAASGMGARRELYTPLMRPEAWPKLPKPDPARNGAEDAEGLRALLE  184 (430)
T ss_dssp             HHHHHHHHHHHTTCTTCCEEEEETTC-------------------------CGGGSCEECCCCTTSCHHHHHTHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999997886389998889998688687988864336887555555676667766777764101231357999999999


Q ss_pred             ----CCCEEEECCCCCC-CCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEEC
Q ss_conf             ----2540342156664-3233-443789999999986378757841750235568887652233210267868998504
Q T0591           177 ----AGARVFLFSNPNN-PAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGP  250 (406)
Q Consensus       177 ----~~~k~i~l~~P~N-PTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~  250 (406)
                          +++.++++.-+.. -.|. ..+++.++++.++|++||+++|.||++..|...+..... .......||    +-++
T Consensus       185 ~~~~~~iaavi~Ep~~~~~~G~~~p~~~~l~~lr~lc~~~gillI~DEV~tGfgr~g~~~~~-~~~~gv~PD----iv~~  259 (430)
T 3i4j_A          185 REGPETVAAFMAEPVVGASDAALAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLAL-SRWSGVTPD----IAVL  259 (430)
T ss_dssp             HHCGGGEEEEEECSSCCGGGTTCCCCTTHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSGG-GGTTTCCCS----EEEE
T ss_pred             HHCCCCEEEEEECCEECCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHH-HHHCCCCCC----CEEE
T ss_conf             72998747999635455789866898799999999985259648852664367757763278-886398987----1566


Q ss_pred             CHHCCCCC-CCCHHHHHHHHHHHHHHHHH----HHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00104631-12114332589999999875----2036761245799999998565--25899999999999999999997
Q T0591           251 SKTESLSG-YRLGVAFGSRAIIARMEKLQ----AIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLR  323 (406)
Q Consensus       251 SK~~~~~G-lRiG~~~~~~~~i~~l~~~~----~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~  323 (406)
                      +|.++ .| .-++.+++.+++.+.+..-.    ...+.+.+.++..++.+.|+..  +...++..+.-++.++.+.+.+.
T Consensus       260 gK~l~-~G~~p~~~v~~~~~i~~~~~~~~~~~~h~~T~~g~pl~~aaa~a~L~~i~~~~~~~~v~~~g~~l~~~l~~l~~  338 (430)
T 3i4j_A          260 GKGLA-AGYAPLAGLLAAPQVYETVMGGSGAFMHGFTYAGHPVSVAAGLSVLDIVEREDLTGAAKERGAQLLAGLQALQA  338 (430)
T ss_dssp             CGGGT-TTSSCCEEEEECHHHHHHHHHTTCBCCCCCTTTTCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHC-CCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             43003-67665112320699998644787666406788998699999999999852445999999997778999999997


Q ss_pred             HCCCCEEECCCCCEEEEEECCCC--------CCCHHHHHHHHHHHCCEEEEECCCCCCC-CCCEEEEE--ECCCHHHHHH
Q ss_conf             27994553588730787766887--------8898999999998689189616102679-99858998--5099799999
Q T0591           324 GCEGVFARTPQAGSYLFPRLPKL--------AVAPAEFVKILRLQAGVVVTPGTEFSPH-TADSVRLN--FSQDHEAAVA  392 (406)
Q Consensus       324 ~~~g~~~~~p~gg~~~w~~~~~~--------~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~-~~~~iRis--~~~~~e~l~~  392 (406)
                      +.+.+.-.... |+++-+.+.+.        ..-...+...++ ++||++.|+...... ..+++|++  +..+++++++
T Consensus       339 ~~~~i~~vrg~-G~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~-~~Gll~~~~~~~~~~~~~~~ir~~Ppl~it~~eid~  416 (430)
T 3i4j_A          339 RFPQMMQVRGT-GLLLGVVLGDLATGQAFETPGIASRIGAAAL-KRGLITYPGSGAEPNGRGDHLLLGPPLSITAAEVDG  416 (430)
T ss_dssp             HCTTEEEEEEE-TTEEEEEEC------------CHHHHHHHHH-HTTEECC-----------CEEEECCCTTCCHHHHHH
T ss_pred             HCCCEEEEECC-CEEEEEEEECCCCCCCCCCHHHHHHHHHHHH-HCCCEEEECCCCCCCCCCCEEEEECCCCCCHHHHHH
T ss_conf             68985899536-7599999732555755458899999999999-789789425665667878889995898889999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999985
Q T0591           393 AARRIVTLVERY  404 (406)
Q Consensus       393 al~rl~~~~~~~  404 (406)
                      ++++|.+.+++.
T Consensus       417 ~~~~l~~al~ev  428 (430)
T 3i4j_A          417 LLALLAGALEDV  428 (430)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999986


No 120
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomics; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3
Probab=99.76  E-value=1e-14  Score=117.42  Aligned_cols=286  Identities=18%  Similarity=0.116  Sum_probs=171.2

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHH----HHC
Q ss_conf             8887888898899999999998648867886707882487278999999997200101013105513899999----829
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVE----FFE  146 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~----~~g  146 (406)
                      +-|+-. |.|. ++++.+.+....|.    + ..++++.+..|+..++.+++.+||+|++..+.|......+.    ..|
T Consensus        50 ~~Y~R~-~nPt-~~~le~~la~Le~~----~-~a~~fsSGMaAi~~~~l~l~~~Gd~ii~~~~~Yg~t~~l~~~~~~~~g  122 (421)
T 2ctz_A           50 NIYSRI-MNPT-VDVLEKRLAALEGG----K-AALATASGHAAQFLALTTLAQAGDNIVSTPNLYGGTFNQFKVTLKRLG  122 (421)
T ss_dssp             GSCBTT-BCHH-HHHHHHHHHHHHTC----S-EEEEESSHHHHHHHHHHHHCCTTCEEEECSCCCHHHHHHHHTHHHHTT
T ss_pred             CEECCC-CCHH-HHHHHHHHHHHHCC----C-EEEEECCHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHHHCC
T ss_conf             632289-8878-99999999998399----7-388761769999999875054666213326667642689999874223


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCC
Q ss_conf             96999860446667766677889999985025403421566643233443789999999986378757841750235568
Q T0591           147 GEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYA  226 (406)
Q Consensus       147 ~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~  226 (406)
                      .+...+..          .-+.+..++.++++||+||+-+|.|||..+..   +++|+++|+++|+++++|+.++.--+ 
T Consensus       123 i~~~~~d~----------~~~~~~~~~~~~~~t~li~~EtpsNP~l~v~D---i~~i~~iA~~~g~~~vvDnT~a~tP~-  188 (421)
T 2ctz_A          123 IEVRFTSR----------EERPEEFLALTDEKTRAWWVESIGNPALNIPD---LEALAQAAREKGVALIVDNTFGMGGY-  188 (421)
T ss_dssp             CEEEECCT----------TCCHHHHHHHCCTTEEEEEEESSCTTTCCCCC---HHHHHHHHHHHTCEEEEECGGGGGGT-
T ss_pred             CCCCCCCC----------CCCCCCCCCCCCCCCEEEEEECCCCCEEEECC---HHHHHHHHHHCCCCEEECCCCCCCCE-
T ss_conf             01100355----------55730000224776248997147864366444---89999998644973674253233620-


Q ss_pred             CCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCC-CCHHHHHH-------------------------------HHHHHHH
Q ss_conf             887652233210267868998504001046311-21143325-------------------------------8999999
Q T0591           227 GASYTHLRAEAAVDAENVVTIMGPSKTESLSGY-RLGVAFGS-------------------------------RAIIARM  274 (406)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~Gl-RiG~~~~~-------------------------------~~~i~~l  274 (406)
                        -..+ ...+ .|    |+++|.||.++--|= =.|.++++                               ..++.+.
T Consensus       189 --~~~P-l~~G-aD----iVvhS~TKyl~GHsDvl~G~vv~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  260 (421)
T 2ctz_A          189 --LLRP-LAWG-AA----LVTHSLTKWVGGHGAVIAGAIVDGGNFPWEGGRYPLLTEPQPGYHGLRLTEAFGELAFIVKA  260 (421)
T ss_dssp             --SCCG-GGGT-CS----EEEEETTTTTTCSSCCCCEEEEECSCSCCTTTTCHHHHSCBGGGTTBCHHHHHGGGHHHHHH
T ss_pred             --ECCH-HHCC-CC----EEEEEHHHHCCCCCCEEEEEEECCCCCHHHHCCCCHHHCCCCCCCCHHHHHHHCCHHHHHHH
T ss_conf             --1562-3418-85----58974033336888726788752773056533450210132000101499885227999999


Q ss_pred             H-HHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCE-EECCC------------------
Q ss_conf             9-875203676124579999999856525899999999999999999997279945-53588------------------
Q T0591           275 E-KLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVF-ARTPQ------------------  334 (406)
Q Consensus       275 ~-~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~-~~~p~------------------  334 (406)
                      + ..........++.....+..-|    +-+.-+.++..++...+.+.|.+.+.+. +..|.                  
T Consensus       261 ~~~~~~~~G~~~sp~~a~lllRGL----~TL~lRm~~~~~nA~~lA~~L~~hp~V~~V~yPgl~s~p~h~~a~~~~~g~~  336 (421)
T 2ctz_A          261 RVDGLRDQGQALGPFEAWVVLLGM----ETLSLRAERHVENTLHLAHWLLEQPQVAWVNYPGLPHHPHHDRAQKYFKGKP  336 (421)
T ss_dssp             HHTHHHHHCCCCCHHHHHHHHHHH----TTHHHHHHHHHHHHHHHHHHHHTCTTEEEEECTTSTTCTTHHHHHHHHTTCC
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCC----CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHCCCCC
T ss_conf             999998636879979989874589----8347779999998999987551389735996587578813999986347996


Q ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCC-------------------------CCCCEEEEEECC-CHH
Q ss_conf             730787766887889899999999868918961610267-------------------------999858998509-979
Q T0591           335 AGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSP-------------------------HTADSVRLNFSQ-DHE  388 (406)
Q Consensus       335 gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~-------------------------~~~~~iRis~~~-~~e  388 (406)
                      |++ +.+.+.    .+.+-+.++++.-.+. ..|..+|.                         -.++.||+|++. +.|
T Consensus       337 G~~-~sf~l~----~~~~~a~~f~d~L~l~-~~a~SlGg~eSLi~~pa~~th~~~~~e~~~~~GI~~~liRlSvGlEd~e  410 (421)
T 2ctz_A          337 GAV-LTFGLK----GGYEAAKRFISRLKLI-SHLANVGDTRTLAIHPASTTHSQLSPEEQAQAGVSPEMVRLSVGLEHVE  410 (421)
T ss_dssp             CSE-EEEEET----THHHHHHHHHHTCSSS-EECSCCCCSSCEEECGGGTTTTTSCHHHHHHHTCCTTEEEEECCSSCHH
T ss_pred             CEE-EEEEEC----CCHHHHHHHHHCCCCC-EECCCCCCCCCEEECCCCCCCHHCCHHHHHHCCCCCCEEEEEECCCCHH
T ss_conf             328-999943----9999999999738847-6645665345330283102310089999986698939799975239999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q T0591           389 AAVAAAR  395 (406)
Q Consensus       389 ~l~~al~  395 (406)
                      +|.+-++
T Consensus       411 DLi~DL~  417 (421)
T 2ctz_A          411 DLKAELK  417 (421)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
T ss_conf             9999999


No 121
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A*
Probab=99.76  E-value=4.5e-15  Score=119.83  Aligned_cols=346  Identities=12%  Similarity=0.092  Sum_probs=196.7

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.|||..|  ...+.+-.|.+.+++.+.+......  .+.....+....+++.+......  +..+.++.+++++++...
T Consensus        42 ~ylD~~~g~g~~~lGh~~p~i~~av~~q~~~~~~~--~~~~~~~~~~~~la~~l~~~~p~--~~~~~v~~~~sGseA~e~  117 (426)
T 1sff_A           42 EYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHT--CFQVLAYEPYLELCEIMNQKVPG--DFAKKTLLVTTGSEAVEN  117 (426)
T ss_dssp             EEEESSHHHHTCTTCBTCHHHHHHHHHHTTTCSCC--CTTTEECHHHHHHHHHHHHHSSC--SSCEEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCC--CCCCCCCCHHHHHHHHHHHHHHH--CCCCEEEECCCCCHHHHH
T ss_conf             99985728886400489699999999998646776--66533560799999998755431--145334421465203455


Q ss_pred             HHHHH---HHCCHHHHHHHCCCHHHHHHH-HHHCCE-------------EEEEEECCCCCCCCCCCCCHHHHHHH-H---
Q ss_conf             99999---720010101310551389999-982996-------------99986044666776667788999998-5---
Q T0591           117 AVAAT---VARGDKVAIVQPDYFANRKLV-EFFEGE-------------MVPVQLDYVSADETRAGLDLTGLEEA-F---  175 (406)
Q Consensus       117 ~~~~l---~~pGd~Vl~~~P~y~~~~~~~-~~~g~~-------------~v~v~~~~~~~~~~~~~~d~~~l~~~-~---  175 (406)
                      +++..   .+ ...++...-+|++..... ...+..             ....+............. ....++. .   
T Consensus       118 Aik~ar~~t~-r~~ii~~~~~yHG~t~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~  195 (426)
T 1sff_A          118 AVKIARAATK-RSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISEDDA-IASIHRIFKNDA  195 (426)
T ss_dssp             HHHHHHHHHT-CCEEEEETTCCCCSSHHHHHHSSCCTTTTTTSCCCCSSEEEECCCBGGGTBCHHHH-HHHHHHHHHHTC
T ss_pred             HHHHHHHHHC-CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH-HHHHHHHHHHHC
T ss_conf             4344443423-34168436887788542100014567765788988887535677621235321001-467777776404


Q ss_pred             C-CCCEEEECCCC--CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECC
Q ss_conf             0-25403421566--643233-4437899999999863787578417502355688876522332102678689985040
Q T0591           176 K-AGARVFLFSNP--NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPS  251 (406)
Q Consensus       176 ~-~~~k~i~l~~P--~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~S  251 (406)
                      . .++.++++ -|  ++ .|. ..+++.+++|.++|++||+++|.||++..+.-.|.-... .. ....||    +-++|
T Consensus       196 ~~~~iaaviv-Epi~~~-~G~~~~~~~~l~~lr~lc~~~gillI~DEV~tG~gRtg~~~~~-~~-~~v~PD----i~~~g  267 (426)
T 1sff_A          196 APEDIAAIVI-EPVQGE-GGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAM-EQ-MGVAPD----LTTFA  267 (426)
T ss_dssp             CGGGEEEEEE-CSBCTT-TTSCBCCHHHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSGG-GG-TTSCCS----EEEEC
T ss_pred             CCCCEEEEEE-CCCCCC-CCCCCCCHHHHHHHHHHHHHCCEEEEECCEEECCCCCCCCCHH-HH-CCCCCC----CEEEC
T ss_conf             6771789996-675378-8960587899999999998719389854413356666443146-55-697831----30001


Q ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCE
Q ss_conf             0104631121143325899999998752036761245799999998565--25899999999999999999997279945
Q T0591           252 KTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEGVF  329 (406)
Q Consensus       252 K~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g~~  329 (406)
                      |.++ .|+-+|.+++.+++.+.........+++.++++..++.+.|+.-  +....+....-.+.++.+.+.+.+.+-+.
T Consensus       268 K~lg-gG~P~~av~~~~~i~~~~~~~~~~~T~~g~p~~~aAa~a~L~~i~~~~~~~~~~~~g~~l~~~l~~~~~~~~~i~  346 (426)
T 1sff_A          268 KSIA-GGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIG  346 (426)
T ss_dssp             GGGG-TSSCCEEEEEEHHHHTTSCTTSBCCSSSSCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHTCTTEE
T ss_pred             HHCC-CCCCCEEEEECHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHCCCEE
T ss_conf             1115-886528999825643033799998798988789999999999998721101221001234566678898689637


Q ss_pred             EECCCCCEEEEEECCCC---C-CC---HHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHH
Q ss_conf             53588730787766887---8-89---899999999868918961610267999858998--509979999999999999
Q T0591           330 ARTPQAGSYLFPRLPKL---A-VA---PAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVTL  400 (406)
Q Consensus       330 ~~~p~gg~~~w~~~~~~---~-~~---~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~~  400 (406)
                      -.... |..+-+.+.+.   . .+   ..+++.+++ +.||.+.++.   . ..+.+|++  +..++++++++++++.+.
T Consensus       347 ~VrG~-Gl~~~ief~~~~~~~~~d~~~~~~~~~~l~-~~Gll~~~~g---~-~~n~ir~~PpL~it~~eid~~l~~l~~a  420 (426)
T 1sff_A          347 DVRGL-GAMIAIELFEDGDHNKPDAKLTAEIVARAR-DKGLILLSCG---P-YYNVLRILVPLTIEDAQIRQGLEIISQC  420 (426)
T ss_dssp             EEEEE-TTEEEEEEBGGGCTTSBCHHHHHHHHHHHH-HTTEECEEES---T-TSCEEEECCCTTCCHHHHHHHHHHHHHH
T ss_pred             EEEEE-CEEEEEEEECCCCCCCCCHHHHHHHHHHHH-HCCCEEECCC---C-CCCEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             89744-549999994266667756999999999999-7898895247---8-8888999799888999999999999999


Q ss_pred             HHHHC
Q ss_conf             99856
Q T0591           401 VERYR  405 (406)
Q Consensus       401 ~~~~r  405 (406)
                      ++++|
T Consensus       421 l~eik  425 (426)
T 1sff_A          421 FDEAK  425 (426)
T ss_dssp             HHHHC
T ss_pred             HHHHC
T ss_conf             99962


No 122
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus}
Probab=99.76  E-value=1.5e-14  Score=116.20  Aligned_cols=282  Identities=21%  Similarity=0.183  Sum_probs=167.1

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHH---
Q ss_conf             78888788889889999999999864886788670788248727899999999720010101310551389999982---
Q T0591            69 GVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFF---  145 (406)
Q Consensus        69 ~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~---  145 (406)
                      .-+-|+-. |.|. ++++.+.+....|.    + ..++++.+..|+..++.+++.+||+|+++.+.|......+...   
T Consensus        46 ~~~~Y~R~-~nPt-~~~lE~~la~leg~----~-~a~~~~SGmaAi~~~~~~~~~~gd~vv~~~~~y~~t~~~~~~~~~~  118 (412)
T 2cb1_A           46 EGYVYARQ-KDPT-AKALEERLKALEGA----L-EAVVLASGQAATFAALLALLRPGDEVVAAKGLFGQTIGLFGQVLSL  118 (412)
T ss_dssp             CSCSBTTT-CCHH-HHHHHHHHHHHHTC----S-EEEEESSHHHHHHHHHHTTCCTTCEEEEETTCCHHHHHHHHHTTTT
T ss_pred             CCCEECCC-CCHH-HHHHHHHHHHHHCC----C-EEEEECCHHHHHHHHHHHHCCCCCEEECCCCCCCCEEEEEECCCCC
T ss_conf             89534089-8878-99999999998599----6-2899748899999987530345531211577523022331004443


Q ss_pred             -CCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCC
Q ss_conf             -9969998604466677666778899999850254034215666432334437899999999863787578417502355
Q T0591           146 -EGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLR  224 (406)
Q Consensus       146 -g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~  224 (406)
                       |.+...+            -.|.+.++++++++||+|++.+|.||++.+.+   +++|+++|+++++++++|+.+...-
T Consensus       119 ~~~~~~~~------------d~d~e~~~~ai~~~tk~i~~EspsNP~l~v~D---i~~i~~~a~~~g~~~vvDnT~~atp  183 (412)
T 2cb1_A          119 MGVTVRYV------------DPEPEAVREALSAKTRAVFVETVANPALLVPD---LEALATLAEEAGVALVVDNTFGAAG  183 (412)
T ss_dssp             TTCEEEEE------------CSSHHHHHHHCCTTEEEEEEESSCTTTCCCCC---HHHHHHHHHHHTCEEEEECGGGTTT
T ss_pred             CCCCCCCC------------CCCHHHHHHHHHCCCEEEEEECCCCCCCCCCH---HHHHHHHHHHHCCCEEEECCEECCC
T ss_conf             34323114------------89999999875448639999878864444441---8888777776055514523242033


Q ss_pred             CCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHHHHH-H--------------------------HHHHHHH
Q ss_conf             6888765223321026786899850400104631-1211433258-9--------------------------9999998
Q T0591           225 YAGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAFGSR-A--------------------------IIARMEK  276 (406)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~~~-~--------------------------~i~~l~~  276 (406)
                      +   -..++ ..+ .|    |+++|+||.++--| .=.|.+++++ +                          ...+++.
T Consensus       184 ~---~~~Pl-~~G-aD----iVvhS~TKyi~GhsDv~gG~vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  254 (412)
T 2cb1_A          184 A---LCRPL-AWG-AH----VVVESLTKWASGHGSVLGGAVLSRETELWRNYPQFLQPDLKGQIPWEALRARCFPERVRT  254 (412)
T ss_dssp             T---SCCGG-GGT-CS----EEEEETTTTTTCSSCCCCEEEEECCCSGGGGSGGGGCC-------HHHHGGGHHHHHHHH
T ss_pred             C---CCCCC-CCC-CC----EEEECCEEECCCCCCCEEEEEEECCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             3---36653-468-87----899623551256776224799807178776655530123234203776676778999998


Q ss_pred             HHH-HCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEE-ECC-----------------CCCE
Q ss_conf             752-036761245799999998565258999999999999999999972799455-358-----------------8730
Q T0591           277 LQA-IVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFA-RTP-----------------QAGS  337 (406)
Q Consensus       277 ~~~-~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~-~~p-----------------~gg~  337 (406)
                      ... ......+...   +..++.. -+-+.-+.++..++...+.+.|.+.+.+.. ..|                 .||+
T Consensus       255 ~~~~~~G~~~~p~~---a~l~lrg-l~TL~lRm~~~~~nA~~la~~L~~hp~V~~V~yPgl~~~~~~~~~~~~~~g~Gg~  330 (412)
T 2cb1_A          255 LGLSLCGMALSPFN---AYLLFQG-LETVALRVARMSETARFLAERLQGHPKVKALRYPGLPEDPAHRNARKYLASGGPI  330 (412)
T ss_dssp             HHTTTTCCCCCHHH---HHHHHHH-GGGHHHHHHHHHHHHHHHHHHHHTCTTCSEEECTTSTTCTTHHHHHHHCSSSCSE
T ss_pred             HHHHCCCCCCCHHH---HHHHHCC-CHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             76501555788788---9999745-0765123211014466677642469856542123333322322123333566734


Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCC-------------------------CCCCEEEEEECC-CHHHHH
Q ss_conf             787766887889899999999868918961610267-------------------------999858998509-979999
Q T0591           338 YLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSP-------------------------HTADSVRLNFSQ-DHEAAV  391 (406)
Q Consensus       338 ~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~-------------------------~~~~~iRis~~~-~~e~l~  391 (406)
                       +.+.+.     +.+-+.+.++.-.+.-  +..+|.                         -.++.||||++. +.|+|.
T Consensus       331 -~sf~l~-----~~e~a~~f~~~l~l~~--~~SlGg~eSLi~~P~~~~h~~~~~e~r~~~Gi~~~lvRlSvGlEd~eDLi  402 (412)
T 2cb1_A          331 -LTLDLG-----DLERASRFLGAIRLLK--AANLGDARTLLVHPWTTTHSRLKEEARLQAGVTPGLVRVSVGLEDPLDLL  402 (412)
T ss_dssp             -EEEECS-----SHHHHHHHHHHCSSEE--CSCCSCSSCEEECTTTTTTTTSCHHHHHHTTCCTTEEEEECCSSCHHHHH
T ss_pred             -EEEEEC-----CHHHHHHHHHHCCEEE--EEEECCCCCEEECCCCCCCCCCCHHHHHHCCCCCCEEEEEECCCCHHHHH
T ss_conf             -689968-----9999999996371888--76675766235577310331289999986697959699997209999999


Q ss_pred             HH
Q ss_conf             99
Q T0591           392 AA  393 (406)
Q Consensus       392 ~a  393 (406)
                      +-
T Consensus       403 ~D  404 (412)
T 2cb1_A          403 AL  404 (412)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             99


No 123
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae}
Probab=99.75  E-value=2.8e-15  Score=121.24  Aligned_cols=321  Identities=13%  Similarity=0.111  Sum_probs=194.5

Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             15678678878889999999999808788887888898899999999998648867886707882487278999999997
Q T0591            43 FSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATV  122 (406)
Q Consensus        43 ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~  122 (406)
                      +-.+.|.+. +..+.++++.+.+.++-..+.+|.  ..+|-+.+++++    |..     .++.++.+|.||.+++.++ 
T Consensus        21 ~~~~~p~~~-~~~~~~~~~~~~l~s~~~s~~G~~--v~~fE~~~a~~~----g~k-----~av~~~SGT~AL~lal~al-   87 (424)
T 2po3_A           21 LLVGRPNRI-DRARLYERLDRALDSQWLSNGGPL--VREFEERVAGLA----GVR-----HAVATCNATAGLQLLAHAA-   87 (424)
T ss_dssp             EETTCCCCC-CHHHHHHHHHHHHHHTCCSSSCHH--HHHHHHHHHHHH----TSS-----EEEEESCHHHHHHHHHHHH-
T ss_pred             CCCCCCCCC-CHHHHHHHHHHHHHCCCCCCCCHH--HHHHHHHHHHHH----CCC-----EEEEECCHHHHHHHHHHHC-
T ss_conf             676799999-789999999999966986789978--999999999997----849-----2999677799999999977-


Q ss_pred             HCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             20010101310551389999982996999860446667766677889999985025403421566643233443789999
Q T0591           123 ARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQ  202 (406)
Q Consensus       123 ~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~  202 (406)
                      +.||+|+++.-+|......+...|++++.+.++     .+.+.+|++.+++.++++|+++++++.   -|....   +++
T Consensus        88 ~~~deVivps~t~~at~~ai~~~G~~pvfvDid-----~~t~~~d~~~i~~~it~~tkaIi~vh~---~G~~~d---~~~  156 (424)
T 2po3_A           88 GLTGEVIMPSMTFAATPHALRWIGLTPVFADID-----PDTGNLDPDQVAAAVTPRTSAVVGVHL---WGRPCA---ADQ  156 (424)
T ss_dssp             TCCSEEEEESSSCTHHHHHHHHTTCEEEEECBC-----TTTSSBCHHHHGGGCCTTEEEEEEECG---GGCCCC---HHH
T ss_pred             CCCCEEEECCCCCHHHHHHHHHCCCEEEEEEEE-----CCCCCCCHHHHHHHHCCCCEEEEEECC---CCCCCC---HHH
T ss_conf             997989988974182399999779989999752-----342358899998752357539998457---787653---045


Q ss_pred             HHHHHHHCCCEEEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEEC--CHHCCCCCCCCHHHHH-HHHHHHHHHHHH
Q ss_conf             9999863787578417502355-68887652233210267868998504--0010463112114332-589999999875
Q T0591           203 IAALAARYGATVIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGP--SKTESLSGYRLGVAFG-SRAIIARMEKLQ  278 (406)
Q Consensus       203 i~~~a~~~~~~ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~--SK~~~~~GlRiG~~~~-~~~~i~~l~~~~  278 (406)
                      |.++|+++|+.||+|.+.+... |+|....+       ..+  +.++||  +|.++. | --|.++. ++++.+.++.++
T Consensus       157 i~~i~k~~~i~lIEDaA~a~Ga~~~gk~~Gs-------~Gd--~~~fSF~~~K~itt-G-eGG~i~t~d~~l~~~~r~~r  225 (424)
T 2po3_A          157 LRKVADEHGLRLYFDAAHALGCAVDGRPAGS-------LGD--AEVFSFHATKAVNA-F-EGGAVVTDDADLAARIRALH  225 (424)
T ss_dssp             HHHHHHHTTCEEEEECTTCTTCEETTEETTS-------SSS--EEEEECCTTSSSCC-S-SCEEEEESCHHHHHHHHHHH
T ss_pred             HHHHHHHCCCEEEEECHHHHCCCCCCEEECC-------CCC--EEEECCHHHCCCCC-C-CCCEEECCCHHHHHHHHHHH
T ss_conf             5546775297699603143166329988434-------644--22155411033651-7-98924057999999999987


Q ss_pred             HHC------------CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCC-C----EEEEE
Q ss_conf             203------------676124579999999856525899999999999999999997279945535887-3----07877
Q T0591           279 AIV------------SLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQA-G----SYLFP  341 (406)
Q Consensus       279 ~~~------------~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~g-g----~~~w~  341 (406)
                      ...            .+..+.+.......-|    +.+.+..++.++..+.+.+.|.+++++.+..... +    .|..+
T Consensus       226 ~~G~~~~~~~~~~g~n~rmsel~Aaigl~qL----~~l~~~~~~R~~~a~~y~~~L~~~~~i~~~~~~~~~~~~~~~~~i  301 (424)
T 2po3_A          226 NFGFDLPGGSPAGGTNAKMSEAAAAMGLTSL----DAFPEVIDRNRRNHAAYREHLADLPGVLVADHDRHGLNNHQYVIV  301 (424)
T ss_dssp             BTTTTCTTCCTTCCCBCCCCHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHTCSCTTEEECCGGGGSCCCCCCEEE
T ss_pred             HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             2686756554456742200699999999987----364899999999999999987338984366776567642368999


Q ss_pred             ECCC--CCCCHHHHHHHHHHHCCEEEEECC--------CCC--CCC---------CCEEEEEEC--CCHHHHHHHHHHHH
Q ss_conf             6688--788989999999986891896161--------026--799---------985899850--99799999999999
Q T0591           342 RLPK--LAVAPAEFVKILRLQAGVVVTPGT--------EFS--PHT---------ADSVRLNFS--QDHEAAVAAARRIV  398 (406)
Q Consensus       342 ~~~~--~~~~~~~~~~~Ll~~~gV~v~pG~--------~Fg--~~~---------~~~iRis~~--~~~e~l~~al~rl~  398 (406)
                      .+..  ...+..++.+.| .++||-+.+..        .|.  ..+         ...+-|.+-  .++++++..++.|+
T Consensus       302 ~~~~~~~~~~Rd~l~~~L-~~~GI~~~~~y~p~l~~~~~y~~~~~~~~P~ae~l~~~~l~LP~~~~Lt~~di~~Ii~~IK  380 (424)
T 2po3_A          302 EIDEATTGIHRDLVMEVL-KAEGVHTRAYFSPGCHELEPYRGQPHAPLPHTERLAARVLSLPTGTAIGDDDIRRVADLLR  380 (424)
T ss_dssp             EECHHHHSSCHHHHHHHH-HHTTEECBCTTCSCGGGSTTTTTSCCCCCHHHHHHHTTEEEECCSTTCCHHHHHHHHHHHH
T ss_pred             EECCCCCCCCHHHHHHHH-HHCCCCEECCCCCCCCCCHHHCCCCCCCCHHHHHHHHCEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             961212524699999999-9879988502697300097761899899989999985979897899989999999999999


Q ss_pred             HHHHH
Q ss_conf             99998
Q T0591           399 TLVER  403 (406)
Q Consensus       399 ~~~~~  403 (406)
                      ....+
T Consensus       381 ~~~~~  385 (424)
T 2po3_A          381 LCATR  385 (424)
T ss_dssp             HHHHH
T ss_pred             HHHHC
T ss_conf             99864


No 124
>3bv0_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; biotin biosynthesis, pyridoxal phosphate, S-adenosyl-L-methionine; HET: PLP; 2.21A {Mycobacterium tuberculosis}
Probab=99.75  E-value=3.1e-15  Score=120.94  Aligned_cols=335  Identities=13%  Similarity=0.109  Sum_probs=198.4

Q ss_pred             CEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             3341567--86788788899999999998087888878888-98899999999998648867886707882487278999
Q T0591            40 PVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRG-DLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        40 ~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G-~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      .||+..|  ...+-+-.|.+.+++.+.+....   |....+ ..+....+|+++.......   -+.++++++++++...
T Consensus        57 ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~~~---~~~~~~~~~~~~~~la~~L~~~~p~~---~~~v~f~~sGseA~e~  130 (437)
T 3bv0_A           57 VLDAMSSWWTAIHGHGHPALDQALTTQLRVMN---HVMFGGLTHEPAARLAKLLVDITPAG---LDTVFFSDSGSVSVEV  130 (437)
T ss_dssp             EEETTHHHHTCTTCBTCHHHHHHHHHHHHHCS---CCCSSSEECHHHHHHHHHHHHHSSTT---EEEEEEESSHHHHHHH
T ss_pred             EEEECCCHHHHHHCCCCHHHHHHHHHHHHHCC---CCCCCCCCCHHHHHHHHHHHHHCCCC---CCEEEECCCCHHHHHH
T ss_conf             98750278977408998999999999997527---86478757699999999999867755---3158724860289999


Q ss_pred             HHHHHH-------HCC-HHHHHHHCCCHHHH-HHHHHHCC-------------EEEEEEECCCCCCCCCCCCCHHHHHHH
Q ss_conf             999997-------200-10101310551389-99998299-------------699986044666776667788999998
Q T0591           117 AVAATV-------ARG-DKVAIVQPDYFANR-KLVEFFEG-------------EMVPVQLDYVSADETRAGLDLTGLEEA  174 (406)
Q Consensus       117 ~~~~l~-------~pG-d~Vl~~~P~y~~~~-~~~~~~g~-------------~~v~v~~~~~~~~~~~~~~d~~~l~~~  174 (406)
                      +++...       .+| ..|+...-+|++.. ......+.             .....|...    ......+.+.+++.
T Consensus       131 AlklAr~~~~~~~~~~r~~ii~~~~~yHG~t~~a~s~t~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~le~~  206 (437)
T 3bv0_A          131 AAKMALQYWRGRGLPGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAPQVP----RDYDPAYSAAFEAQ  206 (437)
T ss_dssp             HHHHHHHHHHTTTCTTCCEEEEETTCCCCSSHHHHTTSCTTTTTGGGGTTTSCCCEEECCCC----SSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHEEECCCCCCCCCCCCCCCCCCCCCCCCC----CCCCHHHHHHHHHH
T ss_conf             99999999875289999779998288777762011213566776777888777765678898----75434455789999


Q ss_pred             HC---CCCEEEECCCC-CCCCCCCC-CHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEE
Q ss_conf             50---25403421566-64323344-378999999998637875784175023556888765223321026786899850
Q T0591           175 FK---AGARVFLFSNP-NNPAGVVY-SAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMG  249 (406)
Q Consensus       175 ~~---~~~k~i~l~~P-~NPTG~~~-s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S  249 (406)
                      +.   ++..++++.-+ ++--|... +++.+++|.++|++||+++|.||++..|...|.-+.. .. ....||  |  -+
T Consensus       207 l~~~~~~iaAviiep~i~~~gG~~~p~~~yl~~lr~lc~~~g~llI~DEV~tGfGRtG~~~a~-~~-~gv~PD--i--vt  280 (437)
T 3bv0_A          207 LAQHAGELAAVVVEPVVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAA-DH-AGVSPD--I--MC  280 (437)
T ss_dssp             HHHHGGGEEEEEECSSEECTTTCEECCTHHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSGG-GG-TTCCCS--E--EE
T ss_pred             HHHHCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEEE-EC-CCCCCC--H--HH
T ss_conf             986078645999855625789976799799999999999729848976677689887774201-02-786886--4--41


Q ss_pred             CCHHCCCCC-CCCHHHHHHHHHHHHHHHHH-----HHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHH
Q ss_conf             400104631-12114332589999999875-----2036761245799999998565--258999999999999999999
Q T0591           250 PSKTESLSG-YRLGVAFGSRAIIARMEKLQ-----AIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHV  321 (406)
Q Consensus       250 ~SK~~~~~G-lRiG~~~~~~~~i~~l~~~~-----~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~  321 (406)
                      +||.++ .| +-+|.+++.+++.+.+..-.     ...+++.+.++..++.+.|+..  +...    ++.++.-+.+.+.
T Consensus       281 ~~K~l~-gG~~p~~av~~~~~i~~~~~~~~~~~~~h~~T~~gnpl~~aaa~a~L~~l~~~~l~----~~~~~~g~~l~~~  355 (437)
T 3bv0_A          281 VGKALT-GGYLSLAATLCTADVAHTISAGAAGALMRGPTFMANPLACAVSVASVELLLGQDWR----TRITELAAGLTAG  355 (437)
T ss_dssp             ECGGGG-TTSSCCEEEEEEHHHHHHHHCC--------CTTTTCHHHHHHHHHHHHHHHTTTHH----HHHHHHHHHHHHH
T ss_pred             HHCCCC-CCCCCEEEEEEHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHH----HHHHHHHHHHHHH
T ss_conf             102145-67765588877499997514688876210565678879999999999999601499----9999999999999


Q ss_pred             HH---HCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHH
Q ss_conf             97---27994553588730787766887889899999999868918961610267999858998--50997999999999
Q T0591           322 LR---GCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARR  396 (406)
Q Consensus       322 L~---~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~r  396 (406)
                      |+   +.+.+.-... .|+++.+.+.+ ..+..++...++ ++||++.|+       .+.+|++  +..+++++++++++
T Consensus       356 L~~l~~~p~V~~vRg-~Gl~~~ie~~~-~~~~~~~~~~~~-~~Gvl~~~~-------~~~l~~~Ppl~it~~eid~~~~~  425 (437)
T 3bv0_A          356 LDTARALPAVTDVRV-CGAIGVIECDR-PVDLAVATPAAL-DRGVWLRPF-------RNLVYAMPPYICTPAEITQITSA  425 (437)
T ss_dssp             HGGGGGCTTEEEEEE-ETTEEEEEESS-CCCHHHHHHHHH-TTTEECCCB-------TTEEEECCCTTCCHHHHHHHHHH
T ss_pred             HHHHCCCCCEEEEEE-CCEEEEEEECC-CCCHHHHHHHHH-HCCCEEECC-------CCEEEEECCCCCCHHHHHHHHHH
T ss_conf             997524998897741-45399999478-131999999999-699189416-------99899979988989999999999


Q ss_pred             HHHHHHHHC
Q ss_conf             999999856
Q T0591           397 IVTLVERYR  405 (406)
Q Consensus       397 l~~~~~~~r  405 (406)
                      |.+++++..
T Consensus       426 l~e~l~~v~  434 (437)
T 3bv0_A          426 MVEVARLVG  434 (437)
T ss_dssp             HHHHHHTC-
T ss_pred             HHHHHHHHC
T ss_conf             999999864


No 125
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A*
Probab=99.75  E-value=4.5e-15  Score=119.85  Aligned_cols=310  Identities=19%  Similarity=0.200  Sum_probs=193.3

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH-HHCCHHHHHH
Q ss_conf             899999999998087888878888--9889999999999864886788670788248727899999999-7200101013
Q T0591            55 PGAFDLFSAGVQSGGVQAYTEYRG--DLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT-VARGDKVAIV  131 (406)
Q Consensus        55 ~~~~~~~~~~~~~~~~~~Y~~~~G--~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l-~~pGd~Vl~~  131 (406)
                      ++..+++.+.+.++..   .  .|  ..+|-+.++    +..|..     ..+.++.+|.||.++++++ +.+||+|+++
T Consensus        44 ~~~~~~~~~vl~sg~~---~--~G~~v~~fE~~~a----~~~g~k-----~ai~v~SGT~AL~lal~al~i~~gdeVi~p  109 (399)
T 2oga_A           44 AETDAAIARVLDSGRY---L--LGPELEGFEAEFA----AYCETD-----HAVGVNSGMDALQLALRGLGIGPGDEVIVP  109 (399)
T ss_dssp             HHHHHHHHHHHHHTCC---S--SSHHHHHHHHHHH----HHTTSS-----EEEEESCHHHHHHHHHHHTTCCTTCEEEEE
T ss_pred             HHHHHHHHHHHHCCCC---C--CCHHHHHHHHHHH----HHHCCC-----EEEEECCHHHHHHHHHHHCCCCCCCEEEEC
T ss_conf             9999999999857997---7--8976999999999----997869-----699967889999999998699993999979


Q ss_pred             HCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             10551389999982996999860446667766677889999985025403421566643233443789999999986378
Q T0591           132 QPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYG  211 (406)
Q Consensus       132 ~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~  211 (406)
                      .-+|.+....+...|++++.+.++     ++.+.+|++.+++.++++||+|++++   .-|...   ++.+|.++|++++
T Consensus       110 ~~t~~at~~ai~~~g~~pvf~Di~-----~~t~~id~~~l~~~i~~~tkaIi~vh---l~G~~~---d~~~i~~i~~~~~  178 (399)
T 2oga_A          110 SHTYIASWLAVSATGATPVPVEPH-----EDHPTLDPLLVEKAITPRTRALLPVH---LYGHPA---DMDALRELADRHG  178 (399)
T ss_dssp             SSSCTHHHHHHHHTTCEEEEECBC-----SSSSSBCHHHHHHHCCTTEEEECCBC---GGGCCC---CHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHCCCEEEECCC-----CCCCCCCHHHHHHHHCCCCEEEEEEC---CCCCCC---CHHHHHHHHHHCC
T ss_conf             957375688999715771872143-----22125888999987276651898507---779834---5389999898749


Q ss_pred             CEEEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEEC--CHHCCCCCCCCHHHHH-HHHHHHHHHHHHHHC------
Q ss_conf             7578417502355-68887652233210267868998504--0010463112114332-589999999875203------
Q T0591           212 ATVIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGP--SKTESLSGYRLGVAFG-SRAIIARMEKLQAIV------  281 (406)
Q Consensus       212 ~~ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~--SK~~~~~GlRiG~~~~-~~~~i~~l~~~~~~~------  281 (406)
                      ++||+|.+.+.-. |.|.....       ..+  +.++||  +|.++..|- -|.++. ++++.+.++.++.+-      
T Consensus       179 i~vIEDaAqa~Ga~~~gk~~G~-------~gd--~~~fSF~~~K~l~~~Ge-GG~i~t~d~~l~~~~~~lr~~G~~~~~~  248 (399)
T 2oga_A          179 LHIVEDAAQAHGARYRGRRIGA-------GSS--VAAFSFYPGKNLGCFGD-GGAVVTGDPELAERLRMLRNYGSRQKYS  248 (399)
T ss_dssp             CEECEECTTCTTCEETTEETTC-------TTC--EEEEECCTTSSSCCSSC-CEEEEESCHHHHHHHHHHHBTTCSSTTC
T ss_pred             CEEEEECCCHHHHCCCCEECCC-------CCC--CEEEECCCCCCCCCCCC-CEEEECCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             7799968665551036441477-------443--01351368851443588-4466259999999999999809986657


Q ss_pred             ------CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC-CCEEEEEECCCCCCCHHHHH
Q ss_conf             ------67612457999999985652589999999999999999999727994553588-73078776688788989999
Q T0591           282 ------SLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ-AGSYLFPRLPKLAVAPAEFV  354 (406)
Q Consensus       282 ------~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~-gg~~~w~~~~~~~~~~~~~~  354 (406)
                            .+..+.+....+..-|+.    +.+..++.++..+...+.|.+..++....+. ...+.|..+.-...+..++.
T Consensus       249 ~~~~G~N~rm~~lqAAigl~qL~~----ld~~~~~R~~~a~~y~~~L~~~~~~~~~~~~~~~~~~~~~~~i~~~~r~~l~  324 (399)
T 2oga_A          249 HETKGTNSRLDEMQAAVLRIRLAH----LDSWNGRRSALAAEYLSGLAGLPGIGLPVTAPDTDPVWHLFTVRTERRDELR  324 (399)
T ss_dssp             CCSCCCBCCCCHHHHHHHHHHHHT----HHHHHHHHHHHHHHHHHHTTTCTTCBCCCCCTTEECCCSSEEEECSSHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHCCCCCCEECCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             556775136768999999999999----8999999999999999846467870067668743210000002343199999


Q ss_pred             HHHHHHCCEEEEECCC--------C---CCC-CC---------CEEEEEEC--CCHHHHHHHHHHHHHHHHHH
Q ss_conf             9999868918961610--------2---679-99---------85899850--99799999999999999985
Q T0591           355 KILRLQAGVVVTPGTE--------F---SPH-TA---------DSVRLNFS--QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       355 ~~Ll~~~gV~v~pG~~--------F---g~~-~~---------~~iRis~~--~~~e~l~~al~rl~~~~~~~  404 (406)
                      +.| .+.||-+.+...        |   +.. +.         ..+.|.+-  .++++++.-++.|+++++++
T Consensus       325 ~~L-~~~GI~t~~~y~~plh~~p~~~~~~~~~~~~p~ae~l~~~~l~LP~~~~Lt~~di~~Ii~~I~~f~~ki  396 (399)
T 2oga_A          325 SHL-DARGIDTLTHYPVPVHLSPAYAGEAPPEGSLPRAESFARQVLSLPIGPHLERPQALRVIDAVREWAERV  396 (399)
T ss_dssp             HHH-HHTTBCCBCSCSSCGGGSHHHHTTSCCTTSCHHHHHHHHHEEEECCSTTCCHHHHHHHHHHHHHHHHSC
T ss_pred             HHH-HHCCCCEEEECCCCHHHCHHHHHCCCCCCCCHHHHHHHHCEEECCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             999-977998655178604439887735998799989999984979785899989999999999999999986


No 126
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A*
Probab=99.74  E-value=1.5e-14  Score=116.38  Aligned_cols=340  Identities=9%  Similarity=-0.024  Sum_probs=206.2

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC--CEEEEECCCCHHHHHHHHHHHH-------
Q ss_conf             8889999999999808788887888898899999999998648867886--7078824872789999999972-------
Q T0591            53 PTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDAR--DGLIITPGTQGALFLAVAATVA-------  123 (406)
Q Consensus        53 p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~--~~I~it~G~~~~l~~~~~~l~~-------  123 (406)
                      +.|.+.+.+.+.+.... ..+.......++-+.+.+|+.+.+|.+....  -.=.+|.|+++++.+++.+.-.       
T Consensus        54 ~~~~a~~l~~~~~~~N~-~~~~~~P~~~~lE~~v~~~la~L~g~p~~~~~~~~G~~t~G~sea~l~a~~aar~~~~~~~~  132 (452)
T 2dgk_A           54 DDENVHKLMDLSINKNW-IDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRME  132 (452)
T ss_dssp             CCHHHHHHHHHTTTCBT-TCTTTCHHHHHHHHHHHHHHHHHTTCCCCTTSCCEEEEESSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHCCC-CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88999999999984378-88543732999999999999997099953257865731143689999999999999987765


Q ss_pred             ----C-CHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHH
Q ss_conf             ----0-01010131055138999998299699986044666776667788999998502540342156664323344378
Q T0591           124 ----R-GDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAE  198 (406)
Q Consensus       124 ----p-Gd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~  198 (406)
                          + ...++++...+.+....++.+|.+++.||++     +.++.+|+++|+++++++|.+++.+.++|.||.+-+.+
T Consensus       133 ~~g~~~~~~~~~s~~~H~s~~Kaa~~~gi~~~~vp~~-----~~~~~~d~~~l~~~i~~~t~~vv~~~gtt~tG~~dpi~  207 (452)
T 2dgk_A          133 AAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMR-----PGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQ  207 (452)
T ss_dssp             HTTCCCSCCEEEESSCCHHHHHHHHHTTCEEEECCCB-----TTBCSCCHHHHHHHCCTTEEEEECBBSCTTTCBBCCHH
T ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEEC-----CCCCCCCHHHHHHHHHHCCCEEEEEEEEECCCCCCCHH
T ss_conf             4068877617997763199999999849954298453-----88873279999998653655357745760678757710


Q ss_pred             HHHHHHHH---HHHCCCEEEECCCCCCCC--CCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHH-HHHHH
Q ss_conf             99999999---863787578417502355--6888765223321026786899850400104631121143325-89999
Q T0591           199 EIGQIAAL---AARYGATVIADQLYSRLR--YAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS-RAIIA  272 (406)
Q Consensus       199 ~l~~i~~~---a~~~~~~ii~De~Y~~l~--~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~-~~~i~  272 (406)
                      ++.+|++.   |+++|+|+.+|-+|+.+.  |..........    ...--....|..|.+..| .-+|+++.. ++...
T Consensus       208 ~i~~i~~~~~~a~~~~i~~HVDaA~gg~~~~~~~~~~~~~~~----~~~~DSi~~s~HK~~~~P-~g~g~l~~r~~~~~~  282 (452)
T 2dgk_A          208 PLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFR----LPRVKSISASGHKFGLAP-LGCGWVIWRDEEALP  282 (452)
T ss_dssp             HHHHHHHHHHHHHCCCCCEEEECTTGGGTHHHHCTTCCCSTT----STTEEEEEEETTTTTCCC-SSCEEEEESSGGGSC
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECHHCCCEEEEEHHHHHHHCC----CCCCCEEECCCCCCCCCC-CCEEEEEECCHHHHH
T ss_conf             567899999887505926998602304323532222555425----546641213633247888-871688863645533


Q ss_pred             HHHHHH-HH-------CCCCHHH-HHHHHH-HHHH-HCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECC---CC--C
Q ss_conf             999875-20-------3676124-579999-9998-565258999999999999999999972799455358---87--3
Q T0591           273 RMEKLQ-AI-------VSLRAAG-YSQAVL-RGWF-DEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTP---QA--G  336 (406)
Q Consensus       273 ~l~~~~-~~-------~~~~~~~-~~q~a~-~~~l-~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p---~g--g  336 (406)
                      ...... .+       .+...+. ..+.+. ...+ .-+..-.++...+..+..+.+.+.|++++++++..|   +.  .
T Consensus       283 ~~~~~~~~yl~~~~~~~~~~~sr~~~~~~~~~~~l~~~G~~g~~~~~~~~~~~a~~l~~~l~~~~~~el~~~~~p~~~~~  362 (452)
T 2dgk_A          283 QELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIP  362 (452)
T ss_dssp             GGGCEEECCTTCCEEECCSCCSCBCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSEEEEEECCTTTBSS
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCEEE
T ss_conf             32123456447777776555677730133445667761530689999999999999999998689849997788875258


Q ss_pred             EEEEEECC--CCCCCHHHHHHHHHHHCCEEEEECCCCCCC--CCCEEEEEEC--CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             07877668--878898999999998689189616102679--9985899850--997999999999999999856
Q T0591           337 SYLFPRLP--KLAVAPAEFVKILRLQAGVVVTPGTEFSPH--TADSVRLNFS--QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       337 ~~~w~~~~--~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~--~~~~iRis~~--~~~e~l~~al~rl~~~~~~~r  405 (406)
                      .+.|--.+  ..+.+..++...| .+.|+.+ |+..+.+.  ....+|+++.  .+.+++++.++.|++.+++++
T Consensus       363 ~v~f~~~~~~~~~~~~~~la~~L-~~~G~~v-~a~~~p~~~~~~~vlRv~v~~~~t~e~id~~v~dl~~~v~~l~  435 (452)
T 2dgk_A          363 AVCFKLKDGEDPGYTLYDLSERL-RLRGWQV-PAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLS  435 (452)
T ss_dssp             EEEEEECTTCCCSCCHHHHHHHH-HHTTCBC-CEEECSTTCTTCEEEEEECCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCCCCCHHHHHHHH-HHCCCEE-ECCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99995457556897899999999-9759832-2256787666857999984699999999999999999999999


No 127
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A*
Probab=99.74  E-value=5.4e-14  Score=112.52  Aligned_cols=312  Identities=18%  Similarity=0.206  Sum_probs=194.9

Q ss_pred             CCHHHHHHHHHHHHCCCCC-CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH-HHCCHHHHH
Q ss_conf             8889999999999808788-88788889889999999999864886788670788248727899999999-720010101
Q T0591            53 PTPGAFDLFSAGVQSGGVQ-AYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT-VARGDKVAI  130 (406)
Q Consensus        53 p~~~~~~~~~~~~~~~~~~-~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l-~~pGd~Vl~  130 (406)
                      .....++++.+.+.++... ..++.  ..++.+.++++    +|.     ...+.++.+|.||.+++.++ +.+||+|++
T Consensus        15 ~~~~e~~~~~~~l~sg~~~~~~G~~--v~~fE~~~a~~----~g~-----k~av~~~SgT~Al~lal~~l~~~~gdeVi~   83 (388)
T 1b9h_A           15 YDDAERNGLVRALEQGQWWRMGGDE--VNSFEREFAAH----HGA-----AHALAVTNGTHALELALQVMGVGPGTEVIV   83 (388)
T ss_dssp             CCHHHHHHHHHHHHTSCCBTTTCSH--HHHHHHHHHHH----TTC-----SEEEEESCHHHHHHHHHHHTTCCTTCEEEE
T ss_pred             CCHHHHHHHHHHHHCCCEEECCCHH--HHHHHHHHHHH----HCC-----CEEEEECCHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             7999999999999749924358989--99999999999----787-----959995788999999999849998399997


Q ss_pred             HHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             31055138999998299699986044666776667788999998502540342156664323344378999999998637
Q T0591           131 VQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY  210 (406)
Q Consensus       131 ~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~  210 (406)
                      +.-+|+.....+...|++++.+.++     +..+.+|++.+++.+++++|++++++.   .|...   ++.++.++|+++
T Consensus        84 p~~t~~a~~~~i~~~g~~pv~~Dv~-----~~~~~~d~~~~~~~~~~~tk~i~~v~~---~g~~~---d~~~i~~~~~~~  152 (388)
T 1b9h_A           84 PAFTFISSSQAAQRLGAVTVPVDVD-----AATYNLDPEAVAAAVTPRTKVIMPVHM---AGLMA---DMDALAKISADT  152 (388)
T ss_dssp             ESSSCTHHHHHHHHTTCEEEEECBC-----TTTCCBCHHHHHHHCCTTEEEECCBCG---GGCCC---CHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHCCCEEEEECCC-----CCCCCCCHHHHHHHHHCCCCCCCCCCC---CCCCC---CHHHHHHHHHHH
T ss_conf             8984734257897569889985044-----454568999999885056424534356---67654---577889999980


Q ss_pred             CCEEEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEEC--CHHCCCCCCCCHHHHH-HHHHHHHHHHHHHHC-----
Q ss_conf             87578417502355-68887652233210267868998504--0010463112114332-589999999875203-----
Q T0591           211 GATVIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGP--SKTESLSGYRLGVAFG-SRAIIARMEKLQAIV-----  281 (406)
Q Consensus       211 ~~~ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~--SK~~~~~GlRiG~~~~-~~~~i~~l~~~~~~~-----  281 (406)
                      ++++|+|.+.+... ++|...   .    ...+  +.+.||  +|.++. | .-|.++. ++++.+.++.++.+.     
T Consensus       153 ~i~lIeD~a~a~g~~~~g~~~---G----~~gd--~~~~Sf~~~K~i~~-g-~GG~i~t~d~~~~~~~~~~~~~g~~~~~  221 (388)
T 1b9h_A          153 GVPLLQDAAHAHGARWQGKRV---G----ELDS--IATFSFQNGKLMTA-G-EGGAVVFPDGETEKYETAFLRHSCGRPR  221 (388)
T ss_dssp             TCCBCEECTTCTTCEETTEEG---G----GSSS--CEEEECCTTSSSCS-S-SCEEEEECTTCHHHHHHHHHHTBTTCCT
T ss_pred             CCEEEECCCCCCCCEECCEEE---C----CCCC--EEEECCCCCCCCCC-C-CCEEEEECCHHHHHHHHHHHHCCCCCCC
T ss_conf             982331212113815899871---3----5534--23213665546767-6-7817872898999999999973899788


Q ss_pred             ----------CC--CHHHHHHHH-HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC-----CCEEE-EEE
Q ss_conf             ----------67--612457999-999985652589999999999999999999727994553588-----73078-776
Q T0591           282 ----------SL--RAAGYSQAV-LRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ-----AGSYL-FPR  342 (406)
Q Consensus       282 ----------~~--~~~~~~q~a-~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~-----gg~~~-w~~  342 (406)
                                ..  ..+.+ |++ +..-|+    .+.+..+..+++.+.+.+.|.+++++......     ..+|. .+.
T Consensus       222 ~~~~~~~~~~G~n~rm~~l-~Aaig~~qL~----~l~~~~~~R~~~~~~y~~~L~~~~~i~~~~~~~~~~~~~~~~~~~~  296 (388)
T 1b9h_A          222 DDRRYFHKIAGSNMRLNEF-SASVLRAQLA----RLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFR  296 (388)
T ss_dssp             TCSSCCCCSCCCBCBCBHH-HHHHHHHHHT----THHHHHHHHHHHHHHHHHHHHTSTTCEECCCCTTCCBCCCSEEEEE
T ss_pred             CCCCEEECCCCCCCCCCHH-HHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEEE
T ss_conf             7642010236666664246-6999999999----9999999999999999997037998404665766552000100023


Q ss_pred             CCCCC-CCHHHHHHHHHHHCCEEEEECC-------C---CCCCC-----------------CCEEEEEEC--C-CHHHHH
Q ss_conf             68878-8989999999986891896161-------0---26799-----------------985899850--9-979999
Q T0591           343 LPKLA-VAPAEFVKILRLQAGVVVTPGT-------E---FSPHT-----------------ADSVRLNFS--Q-DHEAAV  391 (406)
Q Consensus       343 ~~~~~-~~~~~~~~~Ll~~~gV~v~pG~-------~---Fg~~~-----------------~~~iRis~~--~-~~e~l~  391 (406)
                      ++... .+..++.+.| .+.||-+....       .   ++...                 +..+.|.+-  . ++++++
T Consensus       297 ~~~~~~~~R~~l~~~L-~~~gI~~~~~y~plh~~~~f~~~~~~~~~~~~~~~~~Pna~~i~~~~l~LP~~~~Lt~e~di~  375 (388)
T 1b9h_A          297 IPGLTEERRNALVDRL-VEAGLPAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNTDAISSDCVWLHHRVLLAGEPELH  375 (388)
T ss_dssp             CTTCCHHHHHHHHHHH-HHTTCCEEECCCCGGGSHHHHHSSCCSSCHHHHHHTCHHHHHHHHHEEEEEGGGGGSCHHHHH
T ss_pred             EECCCHHHHHHHHHHH-HHCCCCEEECCCCHHCCHHHHHCCCCCCCCCCCCCCCHHHHHHHHCEEECCCCCCCCCHHHHH
T ss_conf             3012246899999999-987998753684221397888649874444333467989999982989864899999899999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999998
Q T0591           392 AAARRIVTLVER  403 (406)
Q Consensus       392 ~al~rl~~~~~~  403 (406)
                      ..++.|++++++
T Consensus       376 ~I~~~i~~~l~~  387 (388)
T 1b9h_A          376 ATAEIIADAVAR  387 (388)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHC
T ss_conf             999999999961


No 128
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A*
Probab=99.73  E-value=1.5e-14  Score=116.23  Aligned_cols=324  Identities=13%  Similarity=0.100  Sum_probs=198.5

Q ss_pred             CCEEECC--CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             8334156--78678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSH--GDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~--G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.||+..  |...+.+-.|.+.+++.+++......  +..... +.+..+++.+....+.   .-+.+..+++++++...
T Consensus        46 ~~iD~~~g~~~~~lGh~~p~v~~ai~~~~~~~~~~--~~~~~~-~~~~~la~~l~~~~~~---~~~~v~f~~sGseAve~  119 (395)
T 1vef_A           46 EYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAM--PQTLPT-PMRGEFYRTLTAILPP---ELNRVFPVNSGTEANEA  119 (395)
T ss_dssp             EEEESSHHHHTCTTCBTCHHHHHHHHHHHHHCCCC--CTTSCC-HHHHHHHHHHHHTSCT---TEEEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHCCC--CCCCCC-CHHHHHHHHCCCCCCC---CCCEEEECCCCCHHHHH
T ss_conf             99985607876645179699999999999750324--664564-0566766530332334---44303421575348999


Q ss_pred             HHHHH---HHCCHHHHHHHCCCHHHHHHHHHHCCE-------------EEEEEECCCCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             99999---720010101310551389999982996-------------99986044666776667788999998502540
Q T0591           117 AVAAT---VARGDKVAIVQPDYFANRKLVEFFEGE-------------MVPVQLDYVSADETRAGLDLTGLEEAFKAGAR  180 (406)
Q Consensus       117 ~~~~l---~~pGd~Vl~~~P~y~~~~~~~~~~g~~-------------~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k  180 (406)
                      +++..   .+ ...|+...-+|++...........             .+.+|           ..|++.|++.+.+++.
T Consensus       120 Alk~ar~~t~-r~~ii~~~~~yHG~t~~a~~~s~~~~~~~~~~p~~~~~~~~p-----------~nd~~~l~~~~~~~ia  187 (395)
T 1vef_A          120 ALKFARAHTG-RKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIP-----------YNDVEALKRAVDEETA  187 (395)
T ss_dssp             HHHHHHHHHS-CCEEEEETTCCCCSSHHHHHTCCCHHHHGGGCSCSSCEEEEC-----------TTCHHHHHHHCCTTEE
T ss_pred             HHHHHHHHCC-CCEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCEEEC-----------CCCHHHHHHHCCCCEE
T ss_conf             9999887133-422312246789986433763478655678878899826867-----------8979999975689747


Q ss_pred             EEECCCC--CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCC
Q ss_conf             3421566--643233-4437899999999863787578417502355688876522332102678689985040010463
Q T0591           181 VFLFSNP--NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLS  257 (406)
Q Consensus       181 ~i~l~~P--~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~  257 (406)
                      ++++ -|  .| .|. ..+++.++++.++|++||+++|.||+...|.-.|.-+.. .. ....||  +  -.++|.++ .
T Consensus       188 avi~-EPi~g~-~G~~~~~~~~l~~l~~lc~~~gillI~DEV~tGfgRtG~~~~~-~~-~gv~PD--i--~~~gK~l~-~  258 (395)
T 1vef_A          188 AVIL-EPVQGE-GGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAF-EH-FGIVPD--I--LTLAKALG-G  258 (395)
T ss_dssp             EEEE-CSEETT-TTSEECCHHHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSTH-HH-HTCCCS--E--EEECGGGG-T
T ss_pred             EEEE-ECCCCC-CCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCC-CC-CCCCCC--E--EEEEECCC-C
T ss_conf             9999-787787-7885499899999999999869169841121157736777542-25-786777--7--89703477-8


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC--CEEECCCC
Q ss_conf             1121143325899999998752036761245799999998565258999999999999999999972799--45535887
Q T0591           258 GYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEG--VFARTPQA  335 (406)
Q Consensus       258 GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g--~~~~~p~g  335 (406)
                      |+-++.+++..++++.+.......+++.++++..++.+.|+...  -.+..++.+++-+.+.+.|+++..  +.-.... 
T Consensus       259 G~~~~a~~~~~~~~~~~~~~~~~~T~~gnpla~aAa~a~L~~i~--~~~~~~~~~~~g~~l~~~L~~l~~~~v~~vrg~-  335 (395)
T 1vef_A          259 GVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLE--RTRLWERAAELGPWFMEKLRAIPSPKIREVRGM-  335 (395)
T ss_dssp             TSSCEEEEEEHHHHHTSCTTSSCCSSTTCHHHHHHHHHHHHHHH--HHTTHHHHHHHHHHHHHHHHTSCCTTEEEEEEE-
T ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHCCCCCCC--CCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCC-
T ss_conf             67775433310232022368735537998620021010122212--322014799974899999996179857985245-


Q ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHH
Q ss_conf             30787766887889899999999868918961610267999858998--5099799999999999999
Q T0591           336 GSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVTLV  401 (406)
Q Consensus       336 g~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~~~  401 (406)
                      |++.-+.+.+.  ....+.. ++.++|+++.+.      +++.+|++  +..+++++++++++|.+++
T Consensus       336 G~m~~i~~~~~--~~~~~~~-~~~~~g~l~~~~------g~~~i~~~PpL~it~~eid~~l~~l~~aL  394 (395)
T 1vef_A          336 GLMVGLELKEK--AAPYIAR-LEKEHRVLALQA------GPTVIRFLPPLVIEKEDLERVVEAVRAVL  394 (395)
T ss_dssp             TTEEEEEESSC--SHHHHHH-HHHHHCEECEES------STTEEEECCCTTCCHHHHHHHHHHHHHHH
T ss_pred             CEEEEEEECCC--CHHHHHH-HHHHCCCEEEEC------CCCEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             48999997177--5689999-999789769942------89999997972499999999999999985


No 129
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3
Probab=99.72  E-value=4e-14  Score=113.38  Aligned_cols=316  Identities=17%  Similarity=0.126  Sum_probs=185.8

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHC
Q ss_conf             88999999999980878888788889889999999999864886788670788248727899999999720010101310
Q T0591            54 TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQP  133 (406)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P  133 (406)
                      ++.++++    +.....++..+.  ..++-+.+.+.+++.++.+  + +.|+++.|+|.++..++..++.|||+|++..-
T Consensus        13 ~~~V~~A----m~~~~~~hr~~~--f~~~~~~~~~~l~~ll~~~--~-~~i~~~gsgT~a~e~~~~nl~~~g~~vl~~~~   83 (352)
T 1iug_A           13 HPKALEA----LARPQLHHRTEA--AREVFLKARGLLREAFRTE--G-EVLILTGSGTLAMEALVKNLFAPGERVLVPVY   83 (352)
T ss_dssp             CHHHHHH----HHSCCCCTTSHH--HHHHHHHHHHHHHHHHTCS--S-EEEEEESCHHHHHHHHHHHHCCTTCEEEEEEC
T ss_pred             CHHHHHH----HCCCCCCCCCHH--HHHHHHHHHHHHHHHHCCC--C-CEEEEECCHHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             8999998----667878978899--9999999999999996899--9-68999684699999999974356885699842


Q ss_pred             CCHH--HHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             5513--89999982996999860446667766677889999985025403421566643233443789999999986378
Q T0591           134 DYFA--NRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYG  211 (406)
Q Consensus       134 ~y~~--~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~  211 (406)
                      ++.+  ....++.+|.+++.+..+.      +..++.++   ...++++.++++...|.||...+   +++|.++|++++
T Consensus        84 G~fg~~~~~~a~~~~~~~~~~~~~~------g~~~~~~~---~~~~~~~~v~~~h~etstG~~~~---i~~i~~~~~~~~  151 (352)
T 1iug_A           84 GKFSERFYEIALEAGLVVERLDYPY------GDTPRPED---VAKEGYAGLLLVHSETSTGALAD---LPALARAFKEKN  151 (352)
T ss_dssp             SHHHHHHHHHHHHTTCEEEEEECCT------TCCCCTTT---SCCSSCSEEEEESEETTTTEECC---HHHHHHHHHHHC
T ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCC------CCCCCHHH---HCCCCCCEEEEEECCCCCEEECC---HHHHHHHHHHHC
T ss_conf             7148789999998088642231225------76554133---03678874899931686413343---788999876300


Q ss_pred             --CEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHC-CCCCCCCHHHHHHHHHHHHHH-------------
Q ss_conf             --7578417502355688876522332102678689985040010-463112114332589999999-------------
Q T0591           212 --ATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTE-SLSGYRLGVAFGSRAIIARME-------------  275 (406)
Q Consensus       212 --~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~-~~~GlRiG~~~~~~~~i~~l~-------------  275 (406)
                        .++++|.+-+..   ..+ -.+...   ..+  +++.|--|.+ +.||  +|+++.+++.++++.             
T Consensus       152 ~~~l~~vDavss~g---~~~-~~~d~~---~iD--~~~~s~qK~l~gp~G--~~~v~~s~~~le~~~~~~~~~dl~~~~~  220 (352)
T 1iug_A          152 PEGLVGADMVTSLL---VGE-VALEAM---GVD--AAASGSQKGLMCPPG--LGFVALSPRALERLKPRGYYLDLARELK  220 (352)
T ss_dssp             TTCEEEEECTTTBT---TBC-CCSGGG---TCS--EEEEESSSTTCCCSC--EEEEEECHHHHHTCCCCSSTTCHHHHHH
T ss_pred             CCCCEECHHHCCCC---CCC-CCCCCC---CCC--EEEECCCCCCCCCCC--CCCHHCCHHHHHHHCCCCCCCCHHHHHH
T ss_conf             02331000111443---332-102466---888--799657664246997--0210058999986207777677999986


Q ss_pred             HHHHHCCCCHHHH-HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCC-EEEEEECCCCCCCHHHH
Q ss_conf             8752036761245-799999998565258999999999999999999972799455358873-07877668878898999
Q T0591           276 KLQAIVSLRAAGY-SQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAG-SYLFPRLPKLAVAPAEF  353 (406)
Q Consensus       276 ~~~~~~~~~~~~~-~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg-~~~w~~~~~~~~~~~~~  353 (406)
                      ......+.+++.. .-.++..+|+.......+..++.+...+.+.+ +.+..|++......+ .-+-+.+|+ +.+..++
T Consensus       221 ~~~~g~~~~Tp~v~~i~al~~aL~~~~~~~~~~~~~~~~~~~~~~~-~~~~~gl~~~~~~~s~~v~~~~~p~-g~~~~~~  298 (352)
T 1iug_A          221 AQKEGESAWTPAINLVLAVAAVLEEVLPRLEEHLALKAWQNALLYG-VGEEGGLRPVPKRFSPAVAAFYLPE-GVPYARV  298 (352)
T ss_dssp             HHTTTCCSSCCCHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHHH-HHHHTTCEESCSSBCTTCEEEECCT-TCCHHHH
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCCCCCCCCCEEEEECCC-CCCHHHH
T ss_conf             5434898876753799999999999998868999999998877777-9985686657534699469997999-9999999


Q ss_pred             HHHHHHHCCEEEEECCCCCCCCCCEEEEE-EC-CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999868918961610267999858998-50-9979999999999999998569
Q T0591           354 VKILRLQAGVVVTPGTEFSPHTADSVRLN-FS-QDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       354 ~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis-~~-~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      ...| +++||.+.+|.  ++-....+||+ ++ .++++++..++.|++++++.+.
T Consensus       299 ~~~l-~~~gi~i~~G~--~~l~~~~~RIg~mG~~~~~di~~~~~~l~~~l~~~~~  350 (352)
T 1iug_A          299 KEAF-AQRGAVIAGGQ--GPLKGKVFRLSLMGAYDRYEALGVAGMFREVLEEILP  350 (352)
T ss_dssp             HHHH-HTTTEECEECC--GGGTTTEEEECCCSSCCHHHHHHHHHHHHHHHHHHC-
T ss_pred             HHHH-HHCCEEEECCC--CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999-97792997677--3137968988689999999999999999999999727


No 130
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyridoxal phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A*
Probab=99.72  E-value=3.9e-14  Score=113.50  Aligned_cols=347  Identities=14%  Similarity=0.059  Sum_probs=192.7

Q ss_pred             CCEEECC--CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             8334156--786788788899999999998087888878888-9889999999999864886788670788248727899
Q T0591            39 RPVDFSH--GDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRG-DLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        39 ~~i~ls~--G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G-~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      +.|||..  |...+-+-.|.+.+++.+++....   |....+ .-+....+++.+......+  ..+.++.+++++++..
T Consensus        57 ~ylD~~~g~~~~~lGh~hP~i~~Ai~~q~~~~~---~~~~~~~~~~~~~~lae~L~~~~p~~--~~~~v~f~~sGseAve  131 (452)
T 3dxv_A           57 ELIDLSGAWGAASLGYGHPAIVAAVSAAAANPA---GATILSASNAPAVTLAERLLASFPGE--GTHKIWFGHSGSDANE  131 (452)
T ss_dssp             EEEESSTTTTTCTTCBSCHHHHHHHHHHHHSCS---CSCSSSSEEHHHHHHHHHHHHTTTCT--TTEEEEEESSHHHHHH
T ss_pred             EEEEECHHHHHHHHCCCCHHHHHHHHHHHHCCC---CCCCCCCCCHHHHHHHHHHHHHCCCC--CCCEEEECCCHHHHHH
T ss_conf             998802218889856997899999999974205---84468768889999999999867735--7898998596599999


Q ss_pred             HHHHHHHH-C-CHHHHHHHCCCHHHHHHHHH-HCC----------EEEEEEECCCCCCCCCCCCC----HHHHHHHHC--
Q ss_conf             99999972-0-01010131055138999998-299----------69998604466677666778----899999850--
Q T0591           116 LAVAATVA-R-GDKVAIVQPDYFANRKLVEF-FEG----------EMVPVQLDYVSADETRAGLD----LTGLEEAFK--  176 (406)
Q Consensus       116 ~~~~~l~~-p-Gd~Vl~~~P~y~~~~~~~~~-~g~----------~~v~v~~~~~~~~~~~~~~d----~~~l~~~~~--  176 (406)
                      .+++.... . .+.|+..+-+|++....... .|.          ....++....... ....+.    .+.+++.+.  
T Consensus       132 ~AlklAr~~tgr~~ii~~~~~yHG~t~~als~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~e~~~~~  210 (452)
T 3dxv_A          132 AAYRAIVKATGRSGVIAFAGAYHGCTVGSMAFSGHSVQADAAKADGLILLPYPDPYRP-YRNDPTGDAILTLLTEKLAAV  210 (452)
T ss_dssp             HHHHHHHHHHSCCEEEEETTCCCCSSHHHHTTCC------------EEEECCCCSSSC-BTTBTTSHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCCEEEEECCCCCCCCCCCCCCCCEECCCCCCCCC-CCCCCHHHHHHHHHHHHHHHC
T ss_conf             9999999975899699963577887410244357876566667778322588987667-788716899999999999723


Q ss_pred             --CCCEEEECCCC--CCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCH
Q ss_conf             --25403421566--64323344378999999998637875784175023556888765223321026786899850400
Q T0591           177 --AGARVFLFSNP--NNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSK  252 (406)
Q Consensus       177 --~~~k~i~l~~P--~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK  252 (406)
                        +++.++++ -|  .+--....+++.+++|.++|++||+++|.||++..|...|..... . .....||  |++  ++|
T Consensus       211 ~~~~iaAvii-EPv~g~~G~~~p~~~~L~~l~~lc~~~gillI~DEV~tG~gRtG~~~~~-~-~~gv~PD--iv~--~gK  283 (452)
T 3dxv_A          211 PAGSIGAAFI-EPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCF-E-HEGFVPD--ILV--LGK  283 (452)
T ss_dssp             CTTCEEEEEE-CSSBSTTTSBCCCTTHHHHHHHHHHHTTCEEEEECTTTCTTTTSSSSGG-G-GTTCCCS--EEE--ECG
T ss_pred             CCCCEEEEEE-ECCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCE-E-CCCCCCC--EEE--ECC
T ss_conf             6887689999-3745788953789999999999999809479954653247777683210-0-0698887--787--413


Q ss_pred             HCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             104631121143325899999998752036761245799999998565--258999999999999999999972799455
Q T0591           253 TESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEGVFA  330 (406)
Q Consensus       253 ~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~  330 (406)
                      ..+ .|+-+|.+++.+++.+..... ...+++.+.++..++.+.|+..  +...+.....-+..++.+.+...+.+.+.-
T Consensus       284 ~~~-gg~Pi~av~~~~ei~~~~~~~-~~~t~~g~p~~~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~~v~~  361 (452)
T 3dxv_A          284 GLG-GGLPLSAVIAPAEILDCASAF-AMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGD  361 (452)
T ss_dssp             GGG-TTSCCEEEEEEHHHHTSCSSS-SCCTTTTCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHCTTEEE
T ss_pred             CCC-CCCCCCCCCCHHHHHCCCCCC-CCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             466-777751224518875056766-667678986999999999999981777999999999999999999974898689


Q ss_pred             ECCCCCEEEEEEC--C-CCCC-C---HHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHH
Q ss_conf             3588730787766--8-8788-9---899999999868918961610267999858998--5099799999999999999
Q T0591           331 RTPQAGSYLFPRL--P-KLAV-A---PAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVTLV  401 (406)
Q Consensus       331 ~~p~gg~~~w~~~--~-~~~~-~---~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~~~  401 (406)
                      ....| +++=+.+  + .... +   ...++.++++ .||++.+..   . ..+.+|+.  +..+++++++++++|.+.+
T Consensus       362 vrG~G-l~~gie~~~~~~~~~~~~~~~~~~~~~~~~-~Gvl~~~~~---~-~~~~ir~~Ppl~~t~~eid~~~~~l~~al  435 (452)
T 3dxv_A          362 IRGRG-LACGMELVCDRQSREPARAETAKLIYRAYQ-LGLVVYYVG---M-NGNVLEFTPPLTITETDIHKALDLLDRAF  435 (452)
T ss_dssp             EEEET-TEEEEEEEEETTTTEECHHHHHHHHHHHHH-HTEECEEES---T-TSCEEEECCCTTCCHHHHHHHHHHHHHHH
T ss_pred             EEECC-EEEEEEEEECCCCCCCCHHHHHHHHHHHHH-CCCEEECCC---C-CCCEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             96113-499999950566567448999999999997-898883246---8-89999996988889999999999999999


Q ss_pred             HHHCC
Q ss_conf             98569
Q T0591           402 ERYRA  406 (406)
Q Consensus       402 ~~~ra  406 (406)
                      +++.|
T Consensus       436 ~~l~a  440 (452)
T 3dxv_A          436 SELSA  440 (452)
T ss_dssp             HTGGG
T ss_pred             HHHHH
T ss_conf             99987


No 131
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippurate, 3-hydroxyhippuric acid; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A*
Probab=99.71  E-value=6.4e-15  Score=118.79  Aligned_cols=318  Identities=13%  Similarity=0.081  Sum_probs=181.0

Q ss_pred             HHHHHHHHHHHHC-------CCCCCCCCC-CCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHH---
Q ss_conf             8999999999980-------878888788-88988999999999986488678867078824872789999999972---
Q T0591            55 PGAFDLFSAGVQS-------GGVQAYTEY-RGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVA---  123 (406)
Q Consensus        55 ~~~~~~~~~~~~~-------~~~~~Y~~~-~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~---  123 (406)
                      ....+++.+.+..       +...+..+. .....+|+.+|+++    |.+  + ++|++|+|+|++++.++.++..   
T Consensus        81 ~~~~~~i~~~l~~w~~~~~~~~~~~~~~w~~~~e~~r~~iA~li----GA~--~-~EVv~t~s~T~~l~~~l~~~~~~~~  153 (465)
T 3e9k_A           81 KMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIV----GAN--E-KEIALMNALTVNLHLLMLSFFKPTP  153 (465)
T ss_dssp             TTHHHHHHHHHHHHHHHGGGGGTSSSSCGGGTTHHHHGGGHHHH----TCC--G-GGEEECSCHHHHHHHHHHHHCCCCS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHH----CCC--C-CCEEEECCCHHHHHHHHHHHHHHCC
T ss_conf             89999999999999863647776676535579999999998870----949--7-8589978807999999974244337


Q ss_pred             CCHHHHHHHCCCHHHHHHH----HHHCCEEE--EEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCH
Q ss_conf             0010101310551389999----98299699--98604466677666778899999850254034215666432334437
Q T0591           124 RGDKVAIVQPDYFANRKLV----EFFEGEMV--PVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSA  197 (406)
Q Consensus       124 pGd~Vl~~~P~y~~~~~~~----~~~g~~~v--~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~  197 (406)
                      .+++|++..-.|++-...+    +..|.++.  .+.......+......|++++.+.++++|+++.++.-||-||.+++ 
T Consensus       154 ~~~~Ii~~~~efps~~~~~~~~~~~~g~~~~~~~v~~~~~~~~~~~~~~d~~~l~~~~~~~t~lV~ls~V~~~tG~~~d-  232 (465)
T 3e9k_A          154 KRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFN-  232 (465)
T ss_dssp             SSCEEEEETTCCHHHHHHHHHHHHHTTCCHHHHEEEECCCTTCSSCCHHHHHHHHHHHGGGEEEEEEESBCTTTCBBCC-
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCCEECC-
T ss_conf             8852553100265349999999998099751333314777876644554199999626899769999576777754676-


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCC-CCCCCCHHHHHHHHHHHHHH-
Q ss_conf             8999999998637875784175023556888765223321026786899850400104-63112114332589999999-
Q T0591           198 EEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTES-LSGYRLGVAFGSRAIIARME-  275 (406)
Q Consensus       198 ~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~-~~GlRiG~~~~~~~~i~~l~-  275 (406)
                        +++|.++|+++|+++++|-+++-    |.-+..+....   .+  +++.|..|.+. -|| =+|++...+++.+.+. 
T Consensus       233 --i~~I~~~a~~~g~~v~vD~aqa~----G~~pidv~~~~---vD--f~~~s~hK~l~~GP~-G~g~lyv~~~~~~~~~p  300 (465)
T 3e9k_A          233 --IPAITKAGQAKGCYVGFDLAHAV----GNVELYLHDWG---VD--FACWCSYKYLNAGAG-GIAGAFIHEKHAHTIKP  300 (465)
T ss_dssp             --HHHHHHHHHHTTCEEEEECTTTT----TTSCCCHHHHT---CC--EEEECSSSTTCCCTT-CCCEEEECGGGTTTSCC
T ss_pred             --HHHHHHHHHHCCCEEEEECCCCC----CCCCCCHHHHC---CC--EEEEECCCCCCCCCC-EEEEEEECHHHHHHHHC
T ss_conf             --99999998545967999873442----00265477745---78--189763556357997-38999845677765213


Q ss_pred             ------------HHH------------HHCCCCHHHHHHHHHHHHHHCCC-HHHHHHHHHHHHHHHHHHHHHHHC-----
Q ss_conf             ------------875------------20367612457999999985652-589999999999999999999727-----
Q T0591           276 ------------KLQ------------AIVSLRAAGYSQAVLRGWFDEAP-GWMEDRIARHQAIRDELLHVLRGC-----  325 (406)
Q Consensus       276 ------------~~~------------~~~~~~~~~~~q~a~~~~l~~~~-~~~~~~~~~~~~~r~~l~~~L~~~-----  325 (406)
                                  ++.            .......+.....+....++... .-+.+.+++.....+.+.+.+...     
T Consensus       301 ~~~g~~~~~~~~~f~~~~~~~~~~~~~~~~~gt~~~~~~~~~~a~l~~~~~~g~~~i~~~~~~L~~~~~~~l~~~~~~~~  380 (465)
T 3e9k_A          301 ALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHNYGKDK  380 (465)
T ss_dssp             SSCCGGGBCHHHHTTCCSCCCBCSSGGGGCCSCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHCC---
T ss_pred             CCCCCCCCCCCCEECCCCCCCCCCCHHHHHCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             56687653354000101345655304555405764014678999999987536999999999999999999875437422


Q ss_pred             -----CCCEEECCC-----CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC---CCHHHHHH
Q ss_conf             -----994553588-----73078776688788989999999986891896161026799985899850---99799999
Q T0591           326 -----EGVFARTPQ-----AGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS---QDHEAAVA  392 (406)
Q Consensus       326 -----~g~~~~~p~-----gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~---~~~e~l~~  392 (406)
                           .++.+..|.     |+. +-+.++..   +.++.+. |.++||++.    |.  .++.||+|++   ++.++++.
T Consensus       381 ~~~~~~~~~i~tP~~~~~Rg~~-vs~~~~~~---~~~v~~~-L~~~gIi~d----~R--~~~~iRis~~~~Ynt~edId~  449 (465)
T 3e9k_A          381 AATKKPVVNIITPSHVEERGCQ-LTITFSVP---NKDVFQE-LEKRGVVCD----KR--NPNGIRVAPVPLYNSFHDVYK  449 (465)
T ss_dssp             ------CEEECSCSSGGGBCSC-EEEEECCT---TCCHHHH-HHTTTEECE----EE--TTTEEEEBCCTTTCCHHHHHH
T ss_pred             CCCCCCCEEEECCCCHHHCCCE-EEEECCCC---HHHHHHH-HHHCCCEEC----CC--CCCEEEEECCCCCCCHHHHHH
T ss_conf             3346786257467767353047-99975898---7999999-998798862----45--889799968977899999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999998
Q T0591           393 AARRIVTLVER  403 (406)
Q Consensus       393 al~rl~~~~~~  403 (406)
                      +++.|+++++.
T Consensus       450 ~i~~L~~il~~  460 (465)
T 3e9k_A          450 FTNLLTSILDS  460 (465)
T ss_dssp             HHHHHHHHHTC
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999850


No 132
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent enzyme, pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A*
Probab=99.71  E-value=4.5e-14  Score=113.02  Aligned_cols=338  Identities=14%  Similarity=0.106  Sum_probs=195.1

Q ss_pred             CEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHH
Q ss_conf             3341567--86788788899999999998087888878888988999999999986488678867078824872789999
Q T0591            40 PVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLA  117 (406)
Q Consensus        40 ~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~  117 (406)
                      .+||..|  ...+-+-.|.+.+++.+.+...........   .++...+++.+.+..+     .+.++.+++++++...+
T Consensus        78 ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~~~~~~~~~~---~~~~~~la~~l~~~~~-----~~~v~f~~SGseA~e~A  149 (439)
T 2oat_A           78 YFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFY---NNVLGEYEEYITKLFN-----YHKVLPMNTGVEAGETA  149 (439)
T ss_dssp             EEESSGGGGTTTTCBTCHHHHHHHHHHHTTCSCCCTTSE---ESSHHHHHHHHHHHHT-----CSEEEEESSHHHHHHHH
T ss_pred             EEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCC---CHHHHHHHHHHHHHCC-----CCEEEEECCCCHHHHHH
T ss_conf             998157898775457999999999999875114675434---4699999999986258-----77699706732356899


Q ss_pred             HHHHHH---------C-CHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCC---CCCCCHHHHHHHHCC-CCEEEE
Q ss_conf             999972---------0-01010131055138999998299699986044666776---667788999998502-540342
Q T0591           118 VAATVA---------R-GDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADET---RAGLDLTGLEEAFKA-GARVFL  183 (406)
Q Consensus       118 ~~~l~~---------p-Gd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~---~~~~d~~~l~~~~~~-~~k~i~  183 (406)
                      +.....         . ...++...-.|++................ ...+....   --.-|++++++.+.+ ++.+++
T Consensus       150 iklar~~~~~~~~~~~~~~~i~~~~~~~hg~t~~~~s~~~~~~~~~-~~~p~~~~~~~~~~~d~~~l~~~l~~~~iAavi  228 (439)
T 2oat_A          150 CKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYD-GFGPFMPGFDIIPYNDLPALERALQDPNVAAFM  228 (439)
T ss_dssp             HHHHHHHHHHTTCCCTTCCEEEEETTCCCCSSHHHHTTCCCHHHHT-TSCSCCTTEEEECSSCHHHHHHHTTSTTEEEEE
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCEEECCCCHHHHHHHCCCCCEEEEE
T ss_conf             9999988875078677750267436787877643444778865555-778888880574477799999854899869999


Q ss_pred             CCCCCCCC-CC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CC
Q ss_conf             15666432-33-44378999999998637875784175023556888765223321026786899850400104631-12
Q T0591           184 FSNPNNPA-GV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YR  260 (406)
Q Consensus       184 l~~P~NPT-G~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lR  260 (406)
                      + -|-.=. |. ..+++.+++|.++|++||+++|.||+...|.-.|.-+..- . ....||    +-+++|.++ .| +-
T Consensus       229 ~-EPiqg~gG~~~p~~~fl~~lr~lc~~~g~llI~DEV~tG~GRtG~~~a~~-~-~gv~PD----ivt~gK~l~-~G~~p  300 (439)
T 2oat_A          229 V-EPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVD-Y-ENVRPD----IVLLGKALS-GGLYP  300 (439)
T ss_dssp             E-CSSBTTTTSBCCCTTHHHHHHHHHHHTTCEEEEECTTTTTTTTSSSSGGG-G-GTCCCS----EEEECGGGG-TTSSC
T ss_pred             E-CCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCHHH-H-CCCCCC----EEEECCHHH-CCCCC
T ss_conf             7-88328889843999999999999986383798335330668558851577-6-499999----999686656-89845


Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC--CEEECCCCCEE
Q ss_conf             1143325899999998752036761245799999998565258999999999999999999972799--45535887307
Q T0591           261 LGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEG--VFARTPQAGSY  338 (406)
Q Consensus       261 iG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g--~~~~~p~gg~~  338 (406)
                      +|.+++.+++.+.+.......+++.++++..++.+.++.-++  ++..++.+++-+.+.+.|+++..  +.-.... |++
T Consensus       301 ~~av~~~~~i~~~~~~~~~~~Tf~gnp~~~Aaa~a~l~~i~~--~~l~~~~~~~g~~l~~~L~~l~~~~v~~vRG~-Gl~  377 (439)
T 2oat_A          301 VSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEE--ENLAENADKLGIILRNELMKLPSDVVTAVRGK-GLL  377 (439)
T ss_dssp             CEEEEECHHHHTTSCTTSSCCSSTTCHHHHHHHHHHHHHHHH--TTHHHHHHHHHHHHHHHHTTSCTTTEEEEEEE-TTE
T ss_pred             CEEEECHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHHCCCCCCEEECCC-CCE
T ss_conf             213530188996347888677888798999989999999870--36116999999999999985523662220357-628


Q ss_pred             EEEECCCC-CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             87766887-889899999999868918961610267999858998--5099799999999999999985
Q T0591           339 LFPRLPKL-AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       339 ~w~~~~~~-~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      +=+.+.+. ..+..+++..++ +.||++.|      .+.+.+|++  +..+++++++++++|.+.+++|
T Consensus       378 ~~i~l~~~~~~~~~~~~~~~~-~~Gll~~~------~~~~~irl~PpL~it~~eid~~~~~l~~al~~f  439 (439)
T 2oat_A          378 NAIVIKETKDWDAWKVCLRLR-DNGLLAKP------THGDIIRFAPPLVIKEDELRESIEIINKTILSF  439 (439)
T ss_dssp             EEEEECCCSSCCHHHHHHHHH-HTTEECCB------SSSSEEEECCCTTCCHHHHHHHHHHHHHHHHTC
T ss_pred             EEEEEECCCCCCHHHHHHHHH-HCCEEEEC------CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             999982688601999999999-69938933------799989997996889999999999999999719


No 133
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, structural genomics, JCSG, PSI, protein structure initiative; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3
Probab=99.70  E-value=1.3e-14  Score=116.74  Aligned_cols=317  Identities=14%  Similarity=0.109  Sum_probs=183.9

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHC
Q ss_conf             88999999999980878888788889889999999999864886788670788248727899999999720010101310
Q T0591            54 TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQP  133 (406)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P  133 (406)
                      +|.++++    +......++++  ...++-+.+.+.+++..|.+-  ...|+++.|+|.+++.++..++.+|+.+++...
T Consensus        46 ~~~Vl~A----m~~~~~~HR~~--~f~~l~~ear~~L~~ll~~~~--~~~i~~~g~gT~a~~a~i~~l~~~~~~~~~~~~  117 (393)
T 1vjo_A           46 HPSVLQA----MNVSPVGHLDP--AFLALMDEIQSLLRYVWQTEN--PLTIAVSGTGTAAMEATIANAVEPGDVVLIGVA  117 (393)
T ss_dssp             CHHHHHH----HSSCCCCTTSH--HHHHHHHHHHHHHHHHHTCCC--SCEEEESSCHHHHHHHHHHHHCCTTCEEEEEES
T ss_pred             CHHHHHH----HCCCCCCCCCH--HHHHHHHHHHHHHHHHHCCCC--CCEEEECCCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             8999997----57689997868--999999999999999958999--828998882999999999976403566453101


Q ss_pred             CCHHHHHHH--HHHCCEEEEEEECCCCCCCCCCCCCHHHHH-HHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             551389999--982996999860446667766677889999-98502540342156664323344378999999998637
Q T0591           134 DYFANRKLV--EFFEGEMVPVQLDYVSADETRAGLDLTGLE-EAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY  210 (406)
Q Consensus       134 ~y~~~~~~~--~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~-~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~  210 (406)
                      ++.......  ...+.....+...      .+...+.+..+ ....++++++.+++-+|.||...+   +++|.++|+++
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~tG~~~~---i~~i~~~~~~~  188 (393)
T 1vjo_A          118 GYFGNRLVDMAGRYGADVRTISKP------WGEVFSLEELRTALETHRPAILALVHAETSTGARQP---LEGVGELCREF  188 (393)
T ss_dssp             SHHHHHHHHHHHHTTCEEEEEECC------TTCCCCHHHHHHHHHHHCCSEEEEESEETTTTEECC---CTTHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHCCCCEECCCC------CCCCCCHHHHHHHHCCCCCCEEEEEEEEECCCCCCC---HHHHHHHHHCC
T ss_conf             100001245665422221000357------787441135567650686400266664320223465---36543234205


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHH-----------
Q ss_conf             875784175023556888765223321026786899850400104631121143325899999998752-----------
Q T0591           211 GATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQA-----------  279 (406)
Q Consensus       211 ~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~-----------  279 (406)
                      |+++++|.+.+.    |.....+.     ..+-.+++.|-.|.++.|+ -+|+++..+..++.......           
T Consensus       189 g~~~ivDa~~s~----g~~~~~~d-----~~~~D~~~~s~~K~~~gp~-G~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~  258 (393)
T 1vjo_A          189 GTLLLVDTVTSL----GGVPIFLD-----AWGVDLAYSCSQKGLGCSP-GASPFTMSSRAIEKLQRRRTKVANWYLDMNL  258 (393)
T ss_dssp             TCEEEEECTTTT----TTSCCCTT-----TTTCSEEECCSSSTTCSCS-SCEEEEECHHHHHHHHTCSSCCSCSTTCHHH
T ss_pred             CCEEEEEECCCC----CCEEECCC-----CCCCCEEEECCCCCCCCCC-EEEEEECCHHHHHHHHCCCCCCCCCCCHHHH
T ss_conf             650789701355----40100122-----4567256302222457997-4783423045776542147886643301344


Q ss_pred             -------HCC-CC-HHHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC---CCEEEEEECCCC
Q ss_conf             -------036-76-1245799999998565-2589999999999999999999727994553588---730787766887
Q T0591           280 -------IVS-LR-AAGYSQAVLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ---AGSYLFPRLPKL  346 (406)
Q Consensus       280 -------~~~-~~-~~~~~q~a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~---gg~~~w~~~~~~  346 (406)
                             ... .. ++.....+....+... ..-.....++.+++.+.+.+.+... |+....+.   ....+-+.+|+ 
T Consensus       259 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~l~~~l~~~-~~~~~~~~~~rs~~v~~~~~p~-  336 (393)
T 1vjo_A          259 LGKYWGSERVYHHTAPINLYYALREALRLIAQEGLANCWQRHQKNVEYLWERLEDI-GLSLHVEKEYRLPTLTTVCIPD-  336 (393)
T ss_dssp             HHHHHSTTCCCCSCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHT-TCCBSSCGGGBCSSEEEEECCT-
T ss_pred             HHHHCCCCCCCCCCCCEEHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCC-CCEEECCHHHHCCEEEEEECCC-
T ss_conf             44311545666887634323336788887764263355442011334345454237-8168268387097599998999-


Q ss_pred             CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE-EC--CCHHHHHHHHHHHHHHH
Q ss_conf             889899999999868918961610267999858998-50--99799999999999999
Q T0591           347 AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN-FS--QDHEAAVAAARRIVTLV  401 (406)
Q Consensus       347 ~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis-~~--~~~e~l~~al~rl~~~~  401 (406)
                      +.++.++...|++++||.+..|...  ...+.||+| ++  ++.|+++..++.|++++
T Consensus       337 ~~~~~~l~~~L~~~~gI~v~~G~~~--~~g~~~Ris~~g~~~t~edv~~lv~aL~~vL  392 (393)
T 1vjo_A          337 GVDGKAVARRLLNEHNIEVGGGLGE--LAGKVWRVGLMGFNSRKESVDQLIPALEQVL  392 (393)
T ss_dssp             TCCHHHHHHHHHHHHCEECEECCGG--GTTTEEEEECCGGGCSHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHCCCEEEECCCCC--CCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9899999999986499899668612--2699899836667899999999999999985


No 134
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1; HET: MSE; 1.81A {Vibrio parahaemolyticus rimd 2210633}
Probab=99.70  E-value=1.1e-13  Score=110.31  Aligned_cols=319  Identities=12%  Similarity=0.098  Sum_probs=182.8

Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHH----------------C----C
Q ss_conf             8087888878888988999999999986488678867078824872789999999972----------------0----0
Q T0591            66 QSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVA----------------R----G  125 (406)
Q Consensus        66 ~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~----------------p----G  125 (406)
                      .......|--+.+..++-+.+.+|+.+.+|.+-..  .=++|+|+|++...++.+--+                |    .
T Consensus       125 ~n~~~~~~~~sp~~t~lE~~vi~wl~~~~g~~~~~--~G~~tsGGT~aNl~al~~AR~~~~~~~~~~~~~~~g~~~~~~~  202 (497)
T 2qma_A          125 LNQSMDSWDQASSATYVEQKVVNWLCDKYDLSEKA--DGIFTSGGTQSNQMGLMLARDWIADKLSGHSIQKLGLPDYADK  202 (497)
T ss_dssp             HCCCTTCGGGCHHHHHHHHHHHHHHHHHTTCCTTC--EEEEESSHHHHHHHHHHHHHHHHHHHHHCCCHHHHCSCGGGGG
T ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCC--CEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCCC
T ss_conf             57565444455789999999999999983959888--8799281799999999999999987733343000266445687


Q ss_pred             HHHHHHHCCCHHHHHHHHHHCC---EEEEEEECCCCCCCCCCCCCHHHHHHHHCCC------CEEEECCCCCCCCCCCCC
Q ss_conf             1010131055138999998299---6999860446667766677889999985025------403421566643233443
Q T0591           126 DKVAIVQPDYFANRKLVEFFEG---EMVPVQLDYVSADETRAGLDLTGLEEAFKAG------ARVFLFSNPNNPAGVVYS  196 (406)
Q Consensus       126 d~Vl~~~P~y~~~~~~~~~~g~---~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~------~k~i~l~~P~NPTG~~~s  196 (406)
                      -.|++.+=.+++....+...|.   .++.||.+.      ++.+|+++|++.+.+.      +-+++.+-.++.||.+=+
T Consensus       203 ~~i~~S~~aH~Sv~Kaa~~lGlg~~~v~~Vp~d~------~g~md~~~L~~~i~~~~~~G~~p~~VvataGTT~~GaiDp  276 (497)
T 2qma_A          203 LRIVCSKKSHFTVQKSASWMGLGEKAVMTVDANA------DGTMDITKLDEVIAQAKAEGLIPFAIVGTAGTTDHGAIDD  276 (497)
T ss_dssp             EEEEEETTSCTHHHHHHHHTTSCGGGEEEECBCT------TSSBCGGGHHHHHHHHHHTTCEEEEEEEEBSCTTTCCBCC
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC------CCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCC
T ss_conf             3999877116999999998188970489855687------8857899999999988864996299983377656202467


Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHH-HHHHHHHHH
Q ss_conf             7899999999863787578417502355688876522332102678689985040010463112114332-589999999
Q T0591           197 AEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFG-SRAIIARME  275 (406)
Q Consensus       197 ~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~-~~~~i~~l~  275 (406)
                         +++|.++|++||+|+.+|-+|+....-......+.....  . .. +..+++|.++.| .-+|.+.. ++...+.+.
T Consensus       277 ---l~eIa~i~~~~~~wlHVDaA~gg~~l~~~~~~~~~gie~--a-DS-it~d~HK~l~~P-~~~g~llvrd~~~l~~~~  348 (497)
T 2qma_A          277 ---LDFIADMAVKHDMWMHVDGAYGGALILSSHKSRLKGVER--A-HS-ISVDFHKLFYQT-ISCGALLVNDKSNFKFLL  348 (497)
T ss_dssp             ---HHHHHHHHHHHTCEEEEEETTGGGGGGSTTGGGGTTGGG--C-SE-EEEETTTTTCCC-SSCEEEEESCGGGGGGGC
T ss_pred             ---HHHHHHHHHHHCEEEEEECCCCCCCCCCHHHHHHCCCCC--E-EE-EEECCCCCCCCC-CCCCEEEEECHHHHHHHH
T ss_conf             ---999999997504357885043443210000033258651--0-58-863542136778-775158873377787761


Q ss_pred             HHHHH-------------CCCCHHH-HH-HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC-CCCCEEE
Q ss_conf             87520-------------3676124-57-9999999856525899999999999999999997279945535-8873078
Q T0591           276 KLQAI-------------VSLRAAG-YS-QAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFART-PQAGSYL  339 (406)
Q Consensus       276 ~~~~~-------------~~~~~~~-~~-q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~-p~gg~~~  339 (406)
                      ....+             .++..+. .. -.....+..-+..-+.+...+..+..+.+.+.|++.+++++.. |+-+..+
T Consensus       349 ~~~~yl~~~~~~~~~~~~~~l~~sRr~~aLklw~~l~~~G~~g~~~~i~~~~~lA~~l~~~l~~~~~~el~~~p~l~iV~  428 (497)
T 2qma_A          349 HHADYLNREHDELPNLVDKSIATTKRFDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTNDQFELLAEPSLSTVL  428 (497)
T ss_dssp             C--------------------CCSCCCTHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHTCTTEEECSCCSSSEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCEEEEE
T ss_conf             35652367776678742356666865136899999986339999999999999999999997369996996798768999


Q ss_pred             EEECCCCCCCHHH----HHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC---CCHHHHHHHHHHHHHHHHHH
Q ss_conf             7766887889899----99999986891896161026799985899850---99799999999999999985
Q T0591           340 FPRLPKLAVAPAE----FVKILRLQAGVVVTPGTEFSPHTADSVRLNFS---QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       340 w~~~~~~~~~~~~----~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~---~~~e~l~~al~rl~~~~~~~  404 (406)
                      | ++.....+..+    +..++..+ |..+...+..  .+..++|++++   ++++++++.++.|.++-+++
T Consensus       429 F-r~~~~~~~~d~ln~~l~~~l~~~-G~~~~~~t~~--~g~~~lR~~v~np~tt~~did~l~~~i~~~a~eL  496 (497)
T 2qma_A          429 F-RATHETADLDELNKALRLEALTR-GIAVLGETIV--DGKTALKFTILNPCLTTSDFESLLSKINMLAVEL  496 (497)
T ss_dssp             E-EECCSSSCHHHHHHHHHHHHHHH-TSCBCEEEEE--TTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHHC
T ss_pred             E-EECCCCCCHHHHHHHHHHHHHHC-CCEEEECCEE--CCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9-82786216899999999999946-9899940259--9967999996899999999999999999999975


No 135
>3bb8_A CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartate aminotransferase fold, oxidoreductase; HET: PLP; 2.35A {Yersinia pseudotuberculosis} PDB: 3bcx_A
Probab=99.70  E-value=2.6e-14  Score=114.72  Aligned_cols=310  Identities=15%  Similarity=0.182  Sum_probs=189.8

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH---------HHC
Q ss_conf             88999999999980878888788889889999999999864886788670788248727899999999---------720
Q T0591            54 TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT---------VAR  124 (406)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l---------~~p  124 (406)
                      ..+-++++.+.+.++-.+. ++.  ..++-+.++++    .|..     .++.++.+|.||++++.++         +.|
T Consensus        42 ~~~e~~~v~~~l~sg~~~~-G~~--v~~fE~~~a~~----~g~k-----~~v~~~sgT~Al~lal~al~~~~~~~~gl~~  109 (437)
T 3bb8_A           42 GTKELQLMVEASLDGWLTT-GRF--NDAFEKKLGEY----LGVP-----YVLTTTSGSSANLLALTALTSPKLGVRALKP  109 (437)
T ss_dssp             CHHHHHHHHHHHHHCCCBS-CHH--HHHHHHHHHHH----HTCS-----EEEEESCHHHHHHHHHHHTTCGGGGGGSCCT
T ss_pred             CHHHHHHHHHHHHCCCCCC-CHH--HHHHHHHHHHH----HCCC-----EEEEECCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             9999999999997598757-987--99999999999----7989-----2999578899999999974212100036799


Q ss_pred             CHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             01010131055138999998299699986044666776667788999998502540342156664323344378999999
Q T0591           125 GDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIA  204 (406)
Q Consensus       125 Gd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~  204 (406)
                      ||+|++|.-+|+.....+..+|++++.+.++     .+.+.+|++.+++.++++||+|++++-   -|...   ++.+|.
T Consensus       110 gdeVi~p~~t~~at~~ai~~~G~~pvfvDid-----~~t~~~d~~~l~~~it~~tkaIi~vh~---~G~~~---d~~~i~  178 (437)
T 3bb8_A          110 GDEVITVAAGFPTTVNPTIQNGLIPVFVDVD-----IPTYNVNASLIEAAVSDKTKAIMIAHT---LGNLF---DLAEVR  178 (437)
T ss_dssp             TCEEEECSSSCHHHHHHHHHTTCEEEECCEE-----TTTTEECGGGHHHHCCTTEEEEEEECG---GGCCC---CHHHHH
T ss_pred             CCEEEECCCCHHHHHHHHHHCCCEEEEECCC-----CCCCCCCHHHHHHHHCCCCCEEEEECC---CCCCC---CHHHHH
T ss_conf             8999983974799999999859989997056-----663201099999872369838998437---77766---608899


Q ss_pred             HHHHHCCCEEEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEECC--HHCCCCCCCCHHHHH-HHHHHHHHHHHHHH
Q ss_conf             99863787578417502355-688876522332102678689985040--010463112114332-58999999987520
Q T0591           205 ALAARYGATVIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGPS--KTESLSGYRLGVAFG-SRAIIARMEKLQAI  280 (406)
Q Consensus       205 ~~a~~~~~~ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~S--K~~~~~GlRiG~~~~-~~~~i~~l~~~~~~  280 (406)
                      ++|+++|+.||+|-+++... |+|....+       ..+  +.++||.  |.+...+  -|.++. ++++.+.++.++..
T Consensus       179 ~i~~~~~i~vIED~A~a~ga~~~g~~~G~-------~gd--~~~fSF~~~K~ittge--GG~i~tnd~~l~~~~~~lr~~  247 (437)
T 3bb8_A          179 RVADKYNLWLIEDCCDALGSTYDGKMAGT-------FGD--IGTVSFYPAKHITMGE--GGAVFTQSAELKSIIESFRDW  247 (437)
T ss_dssp             HHHHHHTCEEEEECTTCTTCEETTEETTS-------SSS--EEEEECSTTSSSCCSS--CEEEEESCHHHHHHHHHHHBT
T ss_pred             HHHHHCCCEEEECCHHHHCCEECCEECCC-------CCC--EEEEECCCCCCCCCCC--CCEEECCCHHHHHHHHHHHHH
T ss_conf             99998597488033143077069986136-------766--3579676774245688--754643899999999999984


Q ss_pred             CC---------------------------------------CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             36---------------------------------------761245799999998565258999999999999999999
Q T0591           281 VS---------------------------------------LRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHV  321 (406)
Q Consensus       281 ~~---------------------------------------~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~  321 (406)
                      ..                                       ...+.+....+..-|    +.+.+..++.++..+.+.+.
T Consensus       248 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ky~~~~~G~n~rmsei~Aaigl~QL----~rl~~~~~~Rr~~~~~y~~~  323 (437)
T 3bb8_A          248 GRDCYCAPGCDNTCKKRFGQQLGSLPFGYDHKYTYSHLGYNLKITDMQAACGLAQL----ERIEEFVEKRKANFKYLKDA  323 (437)
T ss_dssp             TBCC----------------CCSCCCTTCCGGGCBCSCCCBCCCBHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCHHHHHHCCHHH----HHHHHHHHHHHHHHHHHHHH
T ss_conf             83533332222200011233444333688622689743852047699997580566----42038999999999999998


Q ss_pred             HHHCCCCEEE-C-CCC---CEEEE-EECCC-CCCCHHHHHHHHHHHCCEEEEECCC--------CCC-----CC--C---
Q ss_conf             9727994553-5-887---30787-76688-7889899999999868918961610--------267-----99--9---
Q T0591           322 LRGCEGVFAR-T-PQA---GSYLF-PRLPK-LAVAPAEFVKILRLQAGVVVTPGTE--------FSP-----HT--A---  376 (406)
Q Consensus       322 L~~~~g~~~~-~-p~g---g~~~w-~~~~~-~~~~~~~~~~~Ll~~~gV~v~pG~~--------Fg~-----~~--~---  376 (406)
                      |.+.++.... . +.+   .++.+ +.++. ...+..++...| .++||-+.+...        |..     .+  +   
T Consensus       324 l~~~~~~~~l~~~~~~~~~~~~~f~i~l~~~~~~~Rd~l~~~L-~~~gI~t~~~y~~~l~~~p~~~~~~~~~~~~lpna~  402 (437)
T 3bb8_A          324 LQSCADFIELPEATENSDPSWFGFPITLKEDSGVSRIDLVKFL-DEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTD  402 (437)
T ss_dssp             GGGGTTTEECCCCCTTEECCCSSEEEEECGGGSSCHHHHHHHH-HHTTBCCBCCTTSSGGGSGGGSSCCCEECSCCHHHH
T ss_pred             HCCCCCCEECCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHH-HHCCCCEEEECCCHHHCCHHHHHCCCCCCCCCHHHH
T ss_conf             3378884782566889864524789998356601199999999-977997455258713318888856988768898999


Q ss_pred             ----CEEEEEE--CCCHHHHHHHHHHHHHHHH
Q ss_conf             ----8589985--0997999999999999999
Q T0591           377 ----DSVRLNF--SQDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       377 ----~~iRis~--~~~~e~l~~al~rl~~~~~  402 (406)
                          ..+.|.+  ..++++++.-++.|++++.
T Consensus       403 ~i~~~~l~LP~~~~Lt~~di~~Iv~~ik~f~~  434 (437)
T 3bb8_A          403 RIMNQTFWIGIYPGLTHDHLDYVVSKFEEFFG  434 (437)
T ss_dssp             HHHHHEEEECCSTTCCHHHHHHHHHHHHHHTT
T ss_pred             HHHHCEEECCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             99839498638999999999999999999966


No 136
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens}
Probab=99.70  E-value=2.6e-14  Score=114.69  Aligned_cols=308  Identities=14%  Similarity=0.075  Sum_probs=175.4

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEEECCCCH-HHHHHHHHH--HHC-CHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCC
Q ss_conf             9999999999864886788670788248727-899999999--720-010101310551389999982996999860446
Q T0591            82 IRDLLAPRLAAFTGAPVDARDGLIITPGTQG-ALFLAVAAT--VAR-GDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYV  157 (406)
Q Consensus        82 Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~-~l~~~~~~l--~~p-Gd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~  157 (406)
                      +-..+..|+.+..|.+...  ..++++|+++ .+.+++.++  ..| ++.|+++.-.+.+....+.++|++++.|+... 
T Consensus       117 le~~~v~~~~~l~g~~~~~--~~~~~~~~t~~~l~~~l~a~~~~~~~~~~ii~~~~aH~S~~ka~~~~G~~~v~v~~~~-  193 (501)
T 3hl2_A          117 ITNSLVLDIIKLAGVHTVA--NCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVL-  193 (501)
T ss_dssp             HHHHHHHHHHHHTTCTTCC--EEEEESSCHHHHHHHHHHHHHHHCTTCCEEEEECCCCHHHHHHHHHTTCEEEEECEEE-
T ss_pred             HHHHHHHHHHHHCCCCCCC--CEEEECCCHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHCCCEEEEEEEEC-
T ss_conf             9999999999971999888--6576166259999999999998388999899977214899999998099468997312-


Q ss_pred             CCCCCCCCCCHHHHHHHHCC----CCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCC-CCCCCCCC
Q ss_conf             66776667788999998502----54034215666432334437899999999863787578417502355-68887652
Q T0591           158 SADETRAGLDLTGLEEAFKA----GARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLR-YAGASYTH  232 (406)
Q Consensus       158 ~~~~~~~~~d~~~l~~~~~~----~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~-~~~~~~~~  232 (406)
                        +++.+.+|++++++++++    ++-+++.+.|+++.|.+-+   +++|+++|++||+++++|+||+-.. +..    .
T Consensus       194 --~~~~~~~d~~~le~~i~~~~~~~~~~v~~t~~~~~~g~~d~---i~~I~~l~~~~~i~~~~d~a~g~~~~~~~----~  264 (501)
T 3hl2_A          194 --EGDELRTDLKAVEAKVQELGPDCILCIHSTTSCFAPRVPDR---LEELAVICANYDIPHIVNNAYGVQSSKCM----H  264 (501)
T ss_dssp             --ETTEEEECHHHHHHHHHHHCGGGEEEEEEECSCCTTBCCCC---HHHHHHHHHHHTCCEEEECTTCTTCHHHH----H
T ss_pred             --CHHCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC---HHHHHHHHHHHCCEEEEECCCHHHHHHCC----C
T ss_conf             --50104638999999997613457179996689988866654---99999999996995999677577642015----5


Q ss_pred             HHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHH-HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             233210267868998504001046311211433-2589999999875203676124579999999856525899999999
Q T0591           233 LRAEAAVDAENVVTIMGPSKTESLSGYRLGVAF-GSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARH  311 (406)
Q Consensus       233 ~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~-~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~  311 (406)
                      ..........--+++.|.+|.+..| .-.|++. .++++++.+.+.-  .....+.+.-...+.++.-+.....+..+..
T Consensus       265 ~~~~~~~~g~~D~v~~s~hK~l~~p-~gg~il~~~~~~~~~~i~~~y--~g~~s~~p~~~~~asl~~~g~~~~~~~~~~~  341 (501)
T 3hl2_A          265 LIQQGARVGRIDAFVQSLDKNFMVP-VGGAIIAGFNDSFIQEISKMY--PGRASASPSLDVLITLLSLGSNGYKKLLKER  341 (501)
T ss_dssp             HHHHHHHHSCCCEEEEEHHHHHCCC-SSCEEEEESCHHHHHHHHHTS--CSCBCSHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHCCCCCCCEEEECCCCCCCCC-CCCCEEECCCHHHHHHHHHHC--CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             6332025688337980288646678-887655228867888787535--8987626779999999999998899999999


Q ss_pred             HHHHHHHHHHHHHC---CCCEEEC-CCCCEEEEEECCC---C-CCCHHHHHHHHHHHCCEE----EEEC----------C
Q ss_conf             99999999999727---9945535-8873078776688---7-889899999999868918----9616----------1
Q T0591           312 QAIRDELLHVLRGC---EGVFART-PQAGSYLFPRLPK---L-AVAPAEFVKILRLQAGVV----VTPG----------T  369 (406)
Q Consensus       312 ~~~r~~l~~~L~~~---~g~~~~~-p~gg~~~w~~~~~---~-~~~~~~~~~~Ll~~~gV~----v~pG----------~  369 (406)
                      .+..+.+.+.|+++   .+..... |......-+.+..   . ..+..++.. .+.+.||.    +.|.          .
T Consensus       342 ~~~~~~l~~~L~~i~~~~~~~~l~~~~n~~~~~i~~~~~~~~~~~d~~~l~~-~L~~~gi~g~~v~~~~~~~~i~~~~~~  420 (501)
T 3hl2_A          342 KEMFSYLSNQIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRDKAVTQLGS-MLFTRQVSGARVVPLGSMQTVSGYTFR  420 (501)
T ss_dssp             HHHHHHHHHHHHHHHHTTTCCBCCCTTCSSEEEEECTTSCTTTSCHHHHHHH-HHHHTTCCSCEEECTTCCEEETTEEES
T ss_pred             HHHHHHHHHHHHHHHHHCCCEECCCCCCCEEEEEECCCCCCCCCCCHHHHHH-HHHHCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             9999999999999876428163357988526887313346555668899999-999759876311046765420221000


Q ss_pred             CCCCCC----CCEEEEEE--CCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             026799----98589985--0997999999999999999856
Q T0591           370 EFSPHT----ADSVRLNF--SQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       370 ~Fg~~~----~~~iRis~--~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      .|+...    ..|+.+..  +.+.+++++-+++|.+.+++++
T Consensus       421 ~~g~~~e~~~~~~i~~~~siG~~kediD~~v~~L~ki~~~~~  462 (501)
T 3hl2_A          421 GFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVR  462 (501)
T ss_dssp             STTTTSSCCSSCEEEEECCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             158655557776189980278999999999999999999998


No 137
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A*
Probab=99.69  E-value=3e-13  Score=107.50  Aligned_cols=341  Identities=14%  Similarity=0.128  Sum_probs=199.2

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.|||..|  ...+.+-.|.+.+++.+.+.......++ ....++. ..+++.+.......   .+.+..+++++++...
T Consensus        44 ~ylD~~~g~g~~~lGh~~p~i~~Ai~~q~~~~~~~~~~-~~~~~~~-~~l~~~l~~~~~~~---~~~v~~~~sGseA~e~  118 (429)
T 1s0a_A           44 RLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFG-GITHAPA-IELCRKLVAMTPQP---LECVFLADSGSVAVEV  118 (429)
T ss_dssp             EEEESSTTTTTCTTCBSCHHHHHHHHHHHHHCSCCCCS-SEECHHH-HHHHHHHHHHSCTT---CCEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCC-CCCCHHH-HHHHHHHHHHCCCC---CCEEEECCCCCCHHHH
T ss_conf             99987627987751589799999999999755675467-7676688-99999986420467---6136631455410134


Q ss_pred             HHHHHH----H---CCHHHHHHHCCCHHHHHH-HHHHC-------------CEEEEEEECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             999997----2---001010131055138999-99829-------------96999860446667766677889999985
Q T0591           117 AVAATV----A---RGDKVAIVQPDYFANRKL-VEFFE-------------GEMVPVQLDYVSADETRAGLDLTGLEEAF  175 (406)
Q Consensus       117 ~~~~l~----~---pGd~Vl~~~P~y~~~~~~-~~~~g-------------~~~v~v~~~~~~~~~~~~~~d~~~l~~~~  175 (406)
                      ++....    .   +...|+....+|++.... ....+             ......|.............+++.+++.+
T Consensus       119 A~k~ar~~~~~kg~~~~~ii~~~~~yHG~t~~a~~~t~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  198 (429)
T 1s0a_A          119 AMKMALQYWQAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDGEWDERDMVGFARLM  198 (429)
T ss_dssp             HHHHHHHHHHHHTCCCCEEEEETTCCCCSSHHHHTTSCTTTTTGGGGTTTSCCCEEECCCCSBC-CCCCGGGGHHHHHHH
T ss_pred             HHHHHHHEEECCCCCCCEEEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             45554310000246776799997876366513333058852334555543334422357632222102567889888899


Q ss_pred             C---CCCEEEECCCC--CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEE
Q ss_conf             0---25403421566--643233-44378999999998637875784175023556888765223321026786899850
Q T0591           176 K---AGARVFLFSNP--NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMG  249 (406)
Q Consensus       176 ~---~~~k~i~l~~P--~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S  249 (406)
                      .   .++.++++. |  .+--|. ..+++.+++|.++|++||+++|.||++..|...|.-...-.  ....||    +-+
T Consensus       199 ~~~~~~iaavivE-Pv~~~~gg~~~~~~~fl~~lr~lc~~~gillI~DEV~tG~GRtG~~~a~~~--~~v~PD----iv~  271 (429)
T 1s0a_A          199 AAHRHEIAAVIIE-PIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEH--AEIAPD----ILC  271 (429)
T ss_dssp             HHHTTTEEEEEEC-SSEECTTTCEEBCTHHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSGGGG--GTCCCS----EEE
T ss_pred             HHCCCCCCEEEEE-CEECCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECEEECCCCCCCCCCCCC--EEECCC----CEE
T ss_conf             8658862215761-202277876789989999999999980978872011113550222354422--043464----000


Q ss_pred             CCHHCCCCCCCCHHHHHHHHHHHHHHHHH-----HHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             40010463112114332589999999875-----2036761245799999998565258999999999999999999972
Q T0591           250 PSKTESLSGYRLGVAFGSRAIIARMEKLQ-----AIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRG  324 (406)
Q Consensus       250 ~SK~~~~~GlRiG~~~~~~~~i~~l~~~~-----~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~  324 (406)
                      ++|.++-.+.-+|.+++.+++.+.+..-.     ...+++.++++..++.+.|+..++  ++...+.+++-+.+.+.|++
T Consensus       272 ~gK~l~gG~~p~~~~~~~~~i~~~~~~~~~~~~~h~~T~~gnp~~~aaa~a~L~~l~~--~~~~~~~~~~g~~l~~~L~~  349 (429)
T 1s0a_A          272 LGKALTGGTMTLSATLTTREVAETISNGEAGCFMHGPTFMGNPLACAAANASLAILES--GDWQQQVADIEVQLREQLAP  349 (429)
T ss_dssp             ECGGGGTSSSCCEEEEECHHHHHHHHTSTTSSCSCCCTTTTCHHHHHHHHHHHHHHHT--CHHHHHHHHHHHHHHHHHGG
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCEEEEECCCCCCC--CCCCCHHHHHHHHHHHHHHH
T ss_conf             0133321000232114579998523788876333068778887553553102532113--46531256899999999998


Q ss_pred             C---CCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHH
Q ss_conf             7---994553588730787766887889899999999868918961610267999858998--50997999999999999
Q T0591           325 C---EGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIVT  399 (406)
Q Consensus       325 ~---~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~~  399 (406)
                      +   +.+.-.... |++.-+.+.+ ..+...+...++ ++||.+.|.       .+.+|++  +..+++++++++++|.+
T Consensus       350 l~~~~~v~~vrg~-Gl~~~i~~~~-~~~~~~l~~~~~-~~Gll~~~~-------gn~i~l~Ppl~it~~eid~~i~~l~~  419 (429)
T 1s0a_A          350 ARDAEMVADVRVL-GAIGVVETTH-PVNMAALQKFFV-EQGVWIRPF-------GKLIYLMPPYIILPQQLQRLTAAVNR  419 (429)
T ss_dssp             GGGCTTEEEEEEE-TTEEEEEESS-CBCHHHHHHHHH-HTTEECCCB-------TTEEEECCCTTCCHHHHHHHHHHHHH
T ss_pred             HCCCCCEEEEEEC-CCEEEEEECC-CCCHHHHHHHHH-HCCCEEEEC-------CCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             5469966777212-6289999158-465999999999-789779854-------99999928847889999999999999


Q ss_pred             HHHH
Q ss_conf             9998
Q T0591           400 LVER  403 (406)
Q Consensus       400 ~~~~  403 (406)
                      .+++
T Consensus       420 al~e  423 (429)
T 1s0a_A          420 AVQD  423 (429)
T ss_dssp             HTSS
T ss_pred             HHHH
T ss_conf             9976


No 138
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A*
Probab=99.68  E-value=6.7e-14  Score=111.88  Aligned_cols=320  Identities=12%  Similarity=0.089  Sum_probs=185.5

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHC
Q ss_conf             88999999999980878888788889889999999999864886788670788248727899999999720010101310
Q T0591            54 TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQP  133 (406)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P  133 (406)
                      ++.+++++    .....+++++.  ..++-+.+.+.+++.+|.+-  ...|+++.|+|.++..++..++.+|+++++..-
T Consensus        30 ~~~V~~Am----~~~~~~Hrs~e--f~~~~~~~r~~L~~ll~~~~--~~~v~~~gsgT~a~ea~~~~~~~~~~~~l~~~~  101 (396)
T 2ch1_A           30 SKRVLTAM----TNTVLSNFHAE--LFRTMDEVKDGLRYIFQTEN--RATMCVSGSAHAGMEAMLSNLLEEGDRVLIAVN  101 (396)
T ss_dssp             CHHHHHHT----TSCCCCTTCHH--HHHHHHHHHHHHHHHHTCCC--SCEEEESSCHHHHHHHHHHHHCCTTCEEEEEES
T ss_pred             CHHHHHHH----CCCCCCCCCHH--HHHHHHHHHHHHHHHHCCCC--CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             99999975----76778878999--99999999999999968999--719997684899999999974557870111013


Q ss_pred             CCHHH--HHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHH-CCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             55138--9999982996999860446667766677889999985-02540342156664323344378999999998637
Q T0591           134 DYFAN--RKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAF-KAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY  210 (406)
Q Consensus       134 ~y~~~--~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~-~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~  210 (406)
                      +..+.  ...+..++...+.+....      +...+.++++... ..+++++.+++-+|.||...+.+   ++.++|+++
T Consensus       102 g~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~v~~~~~~t~tg~~~~~~---~i~~~~~~~  172 (396)
T 2ch1_A          102 GIWAERAVEMSERYGADVRTIEGPP------DRPFSLETLARAIELHQPKCLFLTHGDSSSGLLQPLE---GVGQICHQH  172 (396)
T ss_dssp             SHHHHHHHHHHHHTTCEEEEEECCT------TSCCCHHHHHHHHHHHCCSEEEEESEETTTTEECCCT---THHHHHHHT
T ss_pred             CHHHCCCHHHHHHHHCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCHH---HHHHHHHCC
T ss_conf             2011001245555320333345654------5663100000101368751046541112533232023---342112036


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCC-CCCCCHHHHHHHHHHHHHHHHHHHC--------
Q ss_conf             8757841750235568887652233210267868998504001046-3112114332589999999875203--------
Q T0591           211 GATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESL-SGYRLGVAFGSRAIIARMEKLQAIV--------  281 (406)
Q Consensus       211 ~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~-~GlRiG~~~~~~~~i~~l~~~~~~~--------  281 (406)
                      ++++++|.+.+...    .+..+..     ..--+++.|--|.++. +|  +|+++..++..+.+.......        
T Consensus       173 ~~~~~vDavss~g~----~~id~~~-----~~iD~~~~s~~K~l~gp~G--~g~~~~~~~~l~~~~~~~~~~~~~~~~~~  241 (396)
T 2ch1_A          173 DCLLIVDAVASLCG----VPFYMDK-----WEIDAVYTGAQKVLGAPPG--ITPISISPKALDVIRNRRTKSKVFYWDLL  241 (396)
T ss_dssp             TCEEEEECTTTBTT----BCCCTTT-----TTCCEEECCCC-CCCCCSS--CEEEEECHHHHHHHHTCSSCCSCGGGCHH
T ss_pred             CCEEEEECHHHHCC----CCCCHHC-----CCCEEEEECCCCCCCCCCE--EEEECCCHHHHHHHHHHCCCCCCCCCCHH
T ss_conf             74499984243115----6500112-----4664899448765369987--98744567899876530245431125357


Q ss_pred             -------------CC-C-HHHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC----CCEEEEE
Q ss_conf             -------------67-6-1245799999998565-2589999999999999999999727994553588----7307877
Q T0591           282 -------------SL-R-AAGYSQAVLRGWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ----AGSYLFP  341 (406)
Q Consensus       282 -------------~~-~-~~~~~q~a~~~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~----gg~~~w~  341 (406)
                                   .. . .....-.+....+... .........+.+.....+...+... +.....++    ...-+.+
T Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~s~~v~s~  320 (396)
T 2ch1_A          242 LLGNYWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKM-GLDIFVKDPRHRLPTVTGI  320 (396)
T ss_dssp             HHHHHTTCSSSCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH-TCCBSSCSGGGBCTTEEEE
T ss_pred             HHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCHHHCCCEEEEE
T ss_conf             676642011100123453246788888878889987643468999999888888765420-1233357746519848999


Q ss_pred             ECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE-EC--CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             66887889899999999868918961610267999858998-50--997999999999999999856
Q T0591           342 RLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN-FS--QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       342 ~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis-~~--~~~e~l~~al~rl~~~~~~~r  405 (406)
                      .+|+ +.+..++...|++++||.+.+|..  ....+.|||+ ++  ++.|+++..++.|+++++...
T Consensus       321 ~~p~-~~~~~~l~~~L~~~~gI~i~~G~~--~~~~~~~RIs~~g~~~~~edId~l~~al~e~L~~~~  384 (396)
T 2ch1_A          321 MIPK-GVDWWKVSQYAMNNFSLEVQGGLG--PTFGKAWRVGIMGECSTVQKIQFYLYGFKESLKATH  384 (396)
T ss_dssp             ECCT-TCCHHHHHHHHHHHHCBCCBCCCG--GGTTTEEEEECCGGGCSHHHHHHHHHHHHHHHHHHC
T ss_pred             ECCC-CCCHHHHHHHHHHCCCEEEECCCC--CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             8999-999999999996159989968876--656988997077077999999999999999999829


No 139
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A*
Probab=99.68  E-value=1.8e-13  Score=108.91  Aligned_cols=340  Identities=14%  Similarity=0.141  Sum_probs=185.6

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.||+..|  ...+-+-.|.+.+++.+++.......+     .....+.+++.+....+.    .+.|..+++++++...
T Consensus        53 ~ylD~~~~~~~~~lGh~~p~v~~A~~~q~~~~~~~~~-----~~~~~~~la~~~~~~~~~----~~~v~f~~sGseAve~  123 (427)
T 3fq8_A           53 RYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGA-----PCALENVLAEMVNDAVPS----IEMVRFVNSGTEACMA  123 (427)
T ss_dssp             EEEESSGGGTTCTTCBTCHHHHHHHHHHHTTCSCCSS-----CCHHHHHHHHHHHHHSTT----CSEEEEESSHHHHHHH
T ss_pred             EEEEECCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCC-----CHHHHHHHHHHHHHCCCC----CCCCEECCCCHHHHHH
T ss_conf             9997062089773168959999999999984576553-----045799999987640876----5544015870689999


Q ss_pred             HHHHHH--HCCHHHHHHHCCCHHHHHHH-HHH-------CCEEE-EEEECCCCCCCCCCCCCHHHHHHHHCC---CCEEE
Q ss_conf             999997--20010101310551389999-982-------99699-986044666776667788999998502---54034
Q T0591           117 AVAATV--ARGDKVAIVQPDYFANRKLV-EFF-------EGEMV-PVQLDYVSADETRAGLDLTGLEEAFKA---GARVF  182 (406)
Q Consensus       117 ~~~~l~--~pGd~Vl~~~P~y~~~~~~~-~~~-------g~~~v-~v~~~~~~~~~~~~~~d~~~l~~~~~~---~~k~i  182 (406)
                      ++..-.  ...+.|+...-+|++..... ...       +.... .+.............-|++++++.+++   +..++
T Consensus       124 Alk~ar~~t~r~~ii~~~~~yHG~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~le~~~~~~~~~iaav  203 (427)
T 3fq8_A          124 VLRIMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGV  203 (427)
T ss_dssp             HHHHHHHHHCCCEEEEEETCCCCSCGGGCSSCCTHHHHHTCCSCSSSCHHHHTTEEEEETTCHHHHHHHHHHSTTTEEEE
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCEECCCCCHHHHHHHHHHHCCCCEEEE
T ss_conf             99999984089879999466557875122106886434689988898766666310367103999999997389976999


Q ss_pred             ECCCC--CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCC
Q ss_conf             21566--643233-443789999999986378757841750235568887652233210267868998504001046311
Q T0591           183 LFSNP--NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGY  259 (406)
Q Consensus       183 ~l~~P--~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~Gl  259 (406)
                      ++ .|  .+ .|. ..+++.+++|.++|++||+++|.||++..+.. +..+ . .......||  +  -.++|.++ .|+
T Consensus       204 i~-Epi~g~-~G~~~~~~~~l~~l~~lc~~~g~llI~DEv~tG~~~-~~~~-a-~~~~gi~PD--i--v~~gK~l~-gG~  273 (427)
T 3fq8_A          204 IL-EPIVGN-SGFIVPDAGFLEGLREITLEHDALLVFDEVITGFRI-AYGG-V-QEKFGVTPD--L--TTLGKIIG-GGL  273 (427)
T ss_dssp             EE-CSSBCT-TSCBCCCTTHHHHHHHHHHHTTCEEEEECTTTBTTT-BTTH-H-HHHTTCCCS--E--EEECGGGG-TTS
T ss_pred             EE-ECCCCC-CCCEECCHHHHHHHHHHHHHHCEEEEECCCCEECCC-CCCC-C-HHHCCCCHH--H--HHHHCCCC-CCC
T ss_conf             98-023688-885638999999999999975406884466523133-2467-4-232388727--7--66410357-972


Q ss_pred             CCHHHHHHHHHHHHHHHHH---HHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC
Q ss_conf             2114332589999999875---2036761245799999998565--2589999999999999999999727994553588
Q T0591           260 RLGVAFGSRAIIARMEKLQ---AIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ  334 (406)
Q Consensus       260 RiG~~~~~~~~i~~l~~~~---~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~  334 (406)
                      -+|.+++.+++.+.+....   ...+++.+++...++.+.|+..  +...++..+.-+..++.+.+...+.+.......-
T Consensus       274 p~~av~~~~~i~~~~~~~~~~~~~~T~~~npl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~l~~l~~~~~~~~~v~~v  353 (427)
T 3fq8_A          274 PVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQV  353 (427)
T ss_dssp             SCEEEEECHHHHTTBTTTSSBCCCCTTTTCHHHHHHHHHHHHHHTSTTHHHHHHHHHHHHHHHHHHHHHHTTCCCEEEEE
T ss_pred             EEEEEEEHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCEECCC
T ss_conf             14666421999976331467766678688834777777665554211466650114566667778777655997177551


Q ss_pred             CCEE-EEE-ECC-C-----CCCCH---HHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             7307-877-668-8-----78898---99999999868918961610267999858998509979999999999999998
Q T0591           335 AGSY-LFP-RLP-K-----LAVAP---AEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       335 gg~~-~w~-~~~-~-----~~~~~---~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~  403 (406)
                      ++++ ++. +-+ .     ...+.   ..+...|+ ++||.+.|+. +    .. +-++++.++++|++.++.+++++++
T Consensus       354 g~m~gi~f~~~~v~~~~~~~~~d~~~~~~~~~~ll-~~GI~l~p~~-~----~~-~f~sl~~te~dId~~l~al~~al~~  426 (427)
T 3fq8_A          354 SGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGML-EQGIYLAPSQ-F----EA-GFTSLAHTEEDIDATLAAARTVMSA  426 (427)
T ss_dssp             TTEEEEESSSCCCCSHHHHTTSCHHHHHHHHHHHH-HTTEECCSST-T----SC-EECCTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEEECCCCCCHHHHHCCCHHHHHHHHHHHH-HCCEEECCCC-C----CC-EECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             87689997246777978861264999999999999-7998988888-7----36-5277778899999999999999973


Q ss_pred             H
Q ss_conf             5
Q T0591           404 Y  404 (406)
Q Consensus       404 ~  404 (406)
                      +
T Consensus       427 L  427 (427)
T 3fq8_A          427 L  427 (427)
T ss_dssp             C
T ss_pred             C
T ss_conf             9


No 140
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin B6, lyase; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A*
Probab=99.68  E-value=1e-12  Score=103.93  Aligned_cols=319  Identities=11%  Similarity=0.071  Sum_probs=187.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCC------CCCEEEEECCCCHHHHHHHHHHHH---C-------C--------H
Q ss_conf             88878888988999999999986488678------867078824872789999999972---0-------0--------1
Q T0591            71 QAYTEYRGDLGIRDLLAPRLAAFTGAPVD------ARDGLIITPGTQGALFLAVAATVA---R-------G--------D  126 (406)
Q Consensus        71 ~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~------~~~~I~it~G~~~~l~~~~~~l~~---p-------G--------d  126 (406)
                      ..|..+.....+-+.+.+|+.+..|.+..      ....-++|+|++++...++.+--+   +       |        +
T Consensus       103 ~~~~~sp~~t~iE~~v~~wl~~l~g~p~~~~~~~~~~~gg~~tsGgs~anl~al~~AR~~~~~~~~~~~~g~~~~~~~~~  182 (486)
T 1js3_A          103 FSWAASPACTELETVMMDWLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAARTKVVRRLQAASPGLTQGAVLEK  182 (486)
T ss_dssp             SSGGGCHHHHHHHHHHHHHHHHHTTCCGGGCCTTTCSCEEEEESCHHHHHHHHHHHHHHHHHHHHHHHSTTCCHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCCCCEECCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             76122704899999999999998569811104788998827886489999999999999877641444667544466676


Q ss_pred             -HHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCC------CEEEECCCCCCCCCCCCCHHH
Q ss_conf             -0101310551389999982996999860446667766677889999985025------403421566643233443789
Q T0591           127 -KVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAG------ARVFLFSNPNNPAGVVYSAEE  199 (406)
Q Consensus       127 -~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~------~k~i~l~~P~NPTG~~~s~~~  199 (406)
                       .|++++=++++....+...|..++.||++      .++.+|+++|++.+.+.      +-+|+.+.....||.+=+   
T Consensus       183 ~vv~~s~~aH~Si~Kaa~~lGl~~~~V~~d------~~~~md~~~L~~~i~~~~~~g~~p~~VvataGtT~~Ga~Dp---  253 (486)
T 1js3_A          183 LVAYASDQAHSSVERAGLIGGVKLKAIPSD------GKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSFDN---  253 (486)
T ss_dssp             EEEEEETTCCHHHHHHHHHHTCEEEEECCC------TTSCCCHHHHHHHHHHHHHTTCEEEEEEEEBSCTTTCCBCC---
T ss_pred             EEEEECHHHHHHHHHHHHHCCCCEEEECCC------CCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCC---
T ss_conf             599965054699999998579982674138------88785999999999987636998669994058855311267---


Q ss_pred             HHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHH-HHHHHHHHHH--
Q ss_conf             9999999863787578417502355688876522332102678689985040010463112114332-5899999998--
Q T0591           200 IGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFG-SRAIIARMEK--  276 (406)
Q Consensus       200 l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~-~~~~i~~l~~--  276 (406)
                      +++|.++|++|++|+.+|-+|+.+..--.....+..  ....-..| ..++.|.+..| .-+|++.. +++.......  
T Consensus       254 l~~I~~i~~~~~~wlHVDaA~Gg~~~~~~~~~~~~~--gi~~aDSi-t~d~HK~l~~P-~~~g~~l~r~~~~~~~~~~~~  329 (486)
T 1js3_A          254 LLEVGPICHEEDIWLHVDAAYAGSAFICPEFRHLLN--GVEFADSF-NFNPHKWLLVN-FDCSAMWVKRRTDLTGAFKLD  329 (486)
T ss_dssp             HHHHHHHHHHTTCEEEEECTTGGGGGGSTTTGGGGT--TGGGCSEE-EECHHHHSSCC-SSCEEEEESCHHHHHGGGC--
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCHHCCCCHHHHHC--CCCCCCEE-EECCCCCCCCC-CCCEEEEEECHHHHHHHHHCC
T ss_conf             999999997527806860103421440801067646--99887241-02743226768-874278994278889987304


Q ss_pred             ------HHH---------HCCCCHHHHHH-HHH-HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC-CCCCEE
Q ss_conf             ------752---------03676124579-999-999856525899999999999999999997279945535-887307
Q T0591           277 ------LQA---------IVSLRAAGYSQ-AVL-RGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFART-PQAGSY  338 (406)
Q Consensus       277 ------~~~---------~~~~~~~~~~q-~a~-~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~-p~gg~~  338 (406)
                            ...         ..+...+.... ..+ ..+..-+..-.++...+.-+..+.+.+.|.+.+++++.. |+-+. 
T Consensus       330 ~~y~~~~~~~~~~~~~~~~~tl~~sR~~~al~lw~~l~~~G~~G~~~~i~~~~~~A~~l~~~l~~~~~fel~~~p~~~i-  408 (486)
T 1js3_A          330 PVYLKHSHQGSGLITDYRHWQLPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVTLGL-  408 (486)
T ss_dssp             ----------CCSCCCGGGSSSCSCCCCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTEEECSCCCSSE-
T ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCEEE-
T ss_conf             5764365335666777433566667523699999999986088999999999999999999985499969967995589-


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC---CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8776688788989999999986891896161026799985899850---9979999999999999998569
Q T0591           339 LFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS---QDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       339 ~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~---~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      +-.++.....-..++.+++.++.++.+.+.. +  .+..++|+++.   +++++++..++.|++..+++.|
T Consensus       409 V~Fr~~~~d~~n~~l~~~l~~~g~~~~s~t~-~--~g~~~lR~~~~n~~t~~~dvd~l~~~i~~~a~~l~a  476 (486)
T 1js3_A          409 VCFRLKGSDGLNEALLERINSARKIHLVPCR-L--RGQFVLRFAICSRKVESGHVRLAWEHIRGLAAELLA  476 (486)
T ss_dssp             EEEEESSCHHHHHHHHHHHHHHTSCBCEEEE-E--TTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHHHHC
T ss_pred             EEEEECCCHHHHHHHHHHHHHHCCEEEEEEE-E--CCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9998169808899999999850989996546-9--999899999689999999999999999999999985


No 141
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A*
Probab=99.68  E-value=3e-13  Score=107.48  Aligned_cols=166  Identities=12%  Similarity=0.082  Sum_probs=106.6

Q ss_pred             HHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHH-HHHHHHCCEEEEEEECCCCCCCCC--
Q ss_conf             99999864886788670788248727899999999720010101310551389-999982996999860446667766--
Q T0591            87 APRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANR-KLVEFFEGEMVPVQLDYVSADETR--  163 (406)
Q Consensus        87 a~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~-~~~~~~g~~~v~v~~~~~~~~~~~--  163 (406)
                      -+...+.||.+    .-.+++||++++...++.+++.|||.|++..-++-+.. ..+.+.|+.+++++..... ...-  
T Consensus       179 q~~aA~~fgAd----~t~FlvNGTS~~N~avi~al~~pGD~VLvdRn~HkSv~~~gl~LsGa~Pvyl~p~~n~-~G~i~~  253 (730)
T 1c4k_A          179 EKHAARVYNAD----KTYFVLGGSSNANNTVTSALVSNGDLVLFDRNNHKSVYNSALAMAGGRPVYLQTNRNP-YGFIGG  253 (730)
T ss_dssp             HHHHHHHTTCS----EEEEESSHHHHHHHHHHHHHCCTTCEEEEETTCCHHHHHHHTTTTCCEEEEECEEECT-TCCEEE
T ss_pred             HHHHHHHHCCC----CEEEECCHHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCC-CCCCCC
T ss_conf             99999984999----1799897289999999996569879999836147999999999779976995883766-665079


Q ss_pred             ---CCCCHHHHHHH---------HCC-CCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC-CCCCCCCC
Q ss_conf             ---67788999998---------502-54034215666432334437899999999863787578417502-35568887
Q T0591           164 ---AGLDLTGLEEA---------FKA-GARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYS-RLRYAGAS  229 (406)
Q Consensus       164 ---~~~d~~~l~~~---------~~~-~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~-~l~~~~~~  229 (406)
                         ..++.+.+...         ... ..+++++++|+ =.|.+++   +++|+++|++++..|++||+++ ++.|.+..
T Consensus       254 i~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~vvit~pt-Y~G~i~d---l~~I~~~~~~~~~~llvDeAhga~~~f~p~~  329 (730)
T 1c4k_A          254 IYDSDFDEKKIRELAAKVDPERAKWKRPFRLAVIQLGT-YDGTIYN---AHEVVKRIGHLCDYIEFDSAWVGYEQFIPMM  329 (730)
T ss_dssp             ECGGGSCHHHHHHHTTTSSHHHHTCSCCBSEEEEESBC-TTSEEEC---HHHHHHHHGGGBSEEEEECTTCCGGGSSGGG
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHHHCCCCCCEEEEECCC-CCCCCCC---HHHHHHHHHHCCCEEEEECHHCCCCCCCCCC
T ss_conf             88288848987613201148877334887289997798-8754259---9999999986399799930111131058888


Q ss_pred             CCCHHHHHCC---CCCCEEEEEECCHHCCCCCCCCHH
Q ss_conf             6522332102---678689985040010463112114
Q T0591           230 YTHLRAEAAV---DAENVVTIMGPSKTESLSGYRLGV  263 (406)
Q Consensus       230 ~~~~~~~~~~---~~~~~i~~~S~SK~~~~~GlRiG~  263 (406)
                      ..+.......   +....+++.|++|++  +|+.-|.
T Consensus       330 ~~~~~~~~~d~~~~~~~d~vvqS~HKtL--~altQ~S  364 (730)
T 1c4k_A          330 RNSSPLLIDDLGPEDPGIIVVQSVHKQQ--AGFSQTS  364 (730)
T ss_dssp             GGGCTTSCCCCCTTSCEEEEEECHHHHS--SCCTTCE
T ss_pred             CCCHHHHCCCCCCCCCCCEEEEECCCCC--CCCCCEE
T ss_conf             7414440022377666536997131025--5540006


No 142
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA; HET: PLP; 1.90A {Sulfolobus tokodaii str}
Probab=99.67  E-value=3.9e-13  Score=106.72  Aligned_cols=337  Identities=11%  Similarity=0.114  Sum_probs=193.4

Q ss_pred             CCEEECCC--CCCCCC-CCHHHHHHHHHHHHCCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHH
Q ss_conf             83341567--867887-88899999999998087888878888-988999999999986488678867078824872789
Q T0591            39 RPVDFSHG--DVDAHE-PTPGAFDLFSAGVQSGGVQAYTEYRG-DLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGAL  114 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~-p~~~~~~~~~~~~~~~~~~~Y~~~~G-~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l  114 (406)
                      +.|||..|  ...+.+ ..|.+.+++.+.+.....   ....+ .-+.+..+++.+........  .+.++.+++++++.
T Consensus        43 ~ylD~~~g~g~~~lGh~~hP~v~~a~~~ql~~~~~---~~~~~~~~~~~~~lae~L~~~~p~~~--~~~v~f~~sgsea~  117 (419)
T 2eo5_A           43 KYLDFTSGIGVNNLGWPSHPEVIKIGIEQMQKLAH---AAANDFYNIPQLELAKKLVTYSPGNF--QKKVFFSNSGTEAI  117 (419)
T ss_dssp             EEEESSGGGGTTTTCBSCCHHHHHHHHHHHTTSCC---CSCSCSCCHHHHHHHHHHHHHSSCSS--CEEEEEESSHHHHH
T ss_pred             EEEECCCCHHHHHCCCCCCHHHHHHHHHHHHHCCC---CCCCCCCCHHHHHHHHHHHHHCCCCC--CCEEEECCCCHHHH
T ss_conf             99986611898854887889999999999975256---46564368799999999886478764--40799617848999


Q ss_pred             HHHHHHHHHC-CHHHHHHHCCCHHHH-HHHHHHCC-------------EEEEEEE--CCCCCCCCCCCCCHHHHHH----
Q ss_conf             9999999720-010101310551389-99998299-------------6999860--4466677666778899999----
Q T0591           115 FLAVAATVAR-GDKVAIVQPDYFANR-KLVEFFEG-------------EMVPVQL--DYVSADETRAGLDLTGLEE----  173 (406)
Q Consensus       115 ~~~~~~l~~p-Gd~Vl~~~P~y~~~~-~~~~~~g~-------------~~v~v~~--~~~~~~~~~~~~d~~~l~~----  173 (406)
                      ..++..-... ...|+...-+|++.. ......|.             ..+.+|.  ............+.++...    
T Consensus       118 ~~a~k~a~~~~r~~ii~~~~~yHG~t~~~~~~s~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (419)
T 2eo5_A          118 EASIKVVKNTGRKYIIAFLGGFHGRTFGSISLTASKAVQRSIVGPFMPGVIHVPYPNPYRNPWHINGYENPSELVNRVIE  197 (419)
T ss_dssp             HHHHHHHHTTSCCEEEEETTCCCCSSHHHHHHCCSCGGGGCSSCCCCTTEEEECCCCSSSCTTCCCTTTCHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999755414662288867646865203443179633445678999997456788720002345665666765556777


Q ss_pred             -------HH---CCCCEEEECCCC--CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCC
Q ss_conf             -------85---025403421566--643233-44378999999998637875784175023556888765223321026
Q T0591           174 -------AF---KAGARVFLFSNP--NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVD  240 (406)
Q Consensus       174 -------~~---~~~~k~i~l~~P--~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~  240 (406)
                             ..   .+++.++++ -|  +| .|. ..+++.+++|.++|++||+++|.||++..|.-.|.-+.. .. ....
T Consensus       198 ~~~~~~~~~~~~~~~iaavi~-EPi~g~-~G~~~~~~~fl~~l~~lc~~~gillI~DEV~tGfGRtG~~~~~-~~-~~v~  273 (419)
T 2eo5_A          198 FIEDYIFVNLVPPEEVAGIFF-EPIQGE-GGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKLFAI-EN-FNTV  273 (419)
T ss_dssp             HHHHTHHHHTCCGGGEEEEEE-CSSBTT-TTSBCCCTTHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSGG-GG-GTCC
T ss_pred             HHHHHHHHHHCCCCCEEEEEE-CCCCCC-CCCCCCCHHHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCC-CC-CCCC
T ss_conf             667789886337886569997-886378-8875189999999999999849888624665468766677620-15-6754


Q ss_pred             CCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             78689985040010463112114332589999999875203676124579999999856525899999999999999999
Q T0591           241 AENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       241 ~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      ++  +  -+++|.++..+.-+|.++..+++..... . ...+++.+.++..++.+.|+..    ++..++.+++-+++.+
T Consensus       274 PD--i--v~~gK~l~~g~~~~~~~~~~~~~~~~~~-~-~~~T~~g~p~~~aaa~a~L~~i----e~~~~~~~~~g~~l~~  343 (419)
T 2eo5_A          274 PD--V--ITLAKALGGGIMPIGATIFRKDLDFKPG-M-HSNTFGGNALACAIGSKVIDIV----KDLLPHVNEIGKIFAE  343 (419)
T ss_dssp             CS--E--EEECGGGGTTTSCCEEEEEEGGGCCC--------CCCCCHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHH
T ss_pred             CC--C--EECCCCCCCCCCCEEEEEEHHHHCCCCC-C-CCCCCCCCCHHHHHHHHHHHHH----HCCCHHHHHHHHHHHH
T ss_conf             23--1--0013334577663378987223145776-6-5878899961057899999999----7122679999999999


Q ss_pred             HHHHCCCCEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHH
Q ss_conf             99727994553588730787766887889899999999868918961610267999858998--5099799999999999
Q T0591           321 VLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAARRIV  398 (406)
Q Consensus       321 ~L~~~~g~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al~rl~  398 (406)
                      .|+++.+ .+. .. |+++-+.+.+. ....+++..++ ++||++.|.      +++.+|++  +..+++++++++++|.
T Consensus       344 ~L~~l~~-~vr-g~-Gl~~~i~~~~~-~~~~~~~~~~~-~~Gll~~~~------g~~~ir~~Ppl~it~~~id~~l~~l~  412 (419)
T 2eo5_A          344 ELQGLAD-DVR-GI-GLAWGLEYNEK-KVRDRIIGESF-KRGLLLLPA------GRSAIRVIPPLVISEEEAKQGLDILK  412 (419)
T ss_dssp             HHTTSSS-EEE-EE-TTEEEEECSCH-HHHHHHHHHHH-HTTEECEEE------TTTEEEECCCTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHH-HHC-CC-CEEEEEEECCH-HHHHHHHHHHH-HCCCEEEEC------CCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             9998776-636-00-36999995777-88999999999-789799646------99989997997889999999999999


Q ss_pred             HHHHHHC
Q ss_conf             9999856
Q T0591           399 TLVERYR  405 (406)
Q Consensus       399 ~~~~~~r  405 (406)
                      +.++++|
T Consensus       413 ~~l~~v~  419 (419)
T 2eo5_A          413 KVIKVVK  419 (419)
T ss_dssp             HHHHHC-
T ss_pred             HHHHHHC
T ss_conf             9999759


No 143
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resistance, structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi NT} PDB: 3gwp_A*
Probab=99.67  E-value=1.1e-14  Score=117.08  Aligned_cols=227  Identities=13%  Similarity=0.047  Sum_probs=140.5

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEE--ECCCCHHHHHHHHHHHHCCHHHHHHHCC-CHHHHHHH-----------HHHCC
Q ss_conf             9999999999864886788670788--2487278999999997200101013105-51389999-----------98299
Q T0591            82 IRDLLAPRLAAFTGAPVDARDGLII--TPGTQGALFLAVAATVARGDKVAIVQPD-YFANRKLV-----------EFFEG  147 (406)
Q Consensus        82 Lr~aia~~~~~~~g~~~~~~~~I~i--t~G~~~~l~~~~~~l~~pGd~Vl~~~P~-y~~~~~~~-----------~~~g~  147 (406)
                      -|+++-+.+.+.+|.    ++-++.  .+.++.++..++.+++.|||+|++.+.. |..+....           ...|.
T Consensus        74 ~r~~LE~~~A~l~G~----E~ALv~p~f~SGt~An~~aL~all~pGDeIl~~~~~~~~t~~~v~g~t~~~~~~~l~~~Gi  149 (427)
T 3i16_A           74 GRDSLDAVYARVFNT----ESALVRPHFVNGTHALGAALFGNLRPGNTMLSVCGEPYDTLHDVIGITENSNMGSLKEFGI  149 (427)
T ss_dssp             HHHHHHHHHHHHHTC----SEEEEETTCCSHHHHHHHHHHHHCCTTCEEEESSSSCCGGGHHHHTCSCCCSSCCTGGGTC
T ss_pred             CHHHHHHHHHHHHCC----CCEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             389999999998499----5467306765099999999998379999899777876652053044688999988987391


Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCC---CCCCCHHHHHHHHHHHHHC--CCEEEECCCCCC
Q ss_conf             69998604466677666778899999850254034215666432---3344378999999998637--875784175023
Q T0591           148 EMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPA---GVVYSAEEIGQIAALAARY--GATVIADQLYSR  222 (406)
Q Consensus       148 ~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPT---G~~~s~~~l~~i~~~a~~~--~~~ii~De~Y~~  222 (406)
                      +...++..      .+..+|++++++++++++|.+++.+++||.   +.+++.+++++++++++++  ++++++|++|..
T Consensus       150 ~~~~vd~~------~~~~~D~~~l~~aI~~~tk~~~v~~~~s~~~~~~~~~~i~dI~~i~~~~k~~~~~i~v~vDn~~g~  223 (427)
T 3i16_A          150 NYKQVDLK------EDGKPNLEEIEKVLKEDESITLVHIQRSTGYGWRRALLIEDIKSIVDCVKNIRKDIICFVDNCYGE  223 (427)
T ss_dssp             EEEECCCC------TTSSCCHHHHHHHHHTCTTEEEEEEECSCCSSSSCCCCHHHHHHHHHHHHHHCTTSEEEEECTTTT
T ss_pred             EEEEECCC------CCCCCCHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             79985798------766669999998725457769999706987667774249999999999985146866982487665


Q ss_pred             CCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCC-CHHHHHHHHHHHHHHHHHHHCCCC----HHHHHHHHHHHHH
Q ss_conf             55688876522332102678689985040010463112-114332589999999875203676----1245799999998
Q T0591           223 LRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYR-LGVAFGSRAIIARMEKLQAIVSLR----AAGYSQAVLRGWF  297 (406)
Q Consensus       223 l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlR-iG~~~~~~~~i~~l~~~~~~~~~~----~~~~~q~a~~~~l  297 (406)
                      +.....+   +. . ..|    ++++|+||.++--|-- -|+++++++++++.+........+    .+.....   .++
T Consensus       224 ~~~~~~P---l~-~-GaD----iv~~SltK~lgG~~a~~GG~IaG~kelIe~a~~~l~a~g~~~~~g~~~~~~r---~~~  291 (427)
T 3i16_A          224 FMDTKEP---TD-V-GAD----LIAGSLIKNIGGGIAPTGGYLAGTKDCIEKTSYRLTVPGIGGECGSTFGVVR---SMY  291 (427)
T ss_dssp             TSSSSCG---GG-G-TCS----EEEEETTSGGGTTTCCSCEEEEECHHHHHHHHHHHSCTTTGGGCCCCTTCHH---HHH
T ss_pred             CCCCCCC---HH-H-CCC----EEEEEEHHCCCCCCCCEEEEEECCHHHHHHHHHHHCCCCCCCCCCCCHHHHH---HHH
T ss_conf             2224454---54-3-788----7999981016898675479997369999998777528876776423778999---996


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             56525899999999999999999997279945535
Q T0591           298 DEAPGWMEDRIARHQAIRDELLHVLRGCEGVFART  332 (406)
Q Consensus       298 ~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~  332 (406)
                       .+-.....+.....+....+.+.|..+ |+.+.+
T Consensus       292 -qGl~~~p~~v~~a~k~a~~~a~~le~~-g~~~~P  324 (427)
T 3i16_A          292 -QGLFLAPHISMEALKGAILCSRIMELA-GFEVMP  324 (427)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHHHHHHHHT-TCEEES
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCC
T ss_conf             -572253899999999999999999976-998799


No 144
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3
Probab=99.67  E-value=9.9e-14  Score=110.73  Aligned_cols=294  Identities=16%  Similarity=0.140  Sum_probs=168.7

Q ss_pred             HHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHH--HHHHHHHHCCEEEEEEECCCCCCC
Q ss_conf             999999998648867886707882487278999999997200101013105513--899999829969998604466677
Q T0591            84 DLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFA--NRKLVEFFEGEMVPVQLDYVSADE  161 (406)
Q Consensus        84 ~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~--~~~~~~~~g~~~v~v~~~~~~~~~  161 (406)
                      +.+.+.+.+..|.+-+ +..|++|+|+|+++..++..+..+++.+++..-.+..  ........+.....+....    .
T Consensus        40 ~~~r~~l~~ll~~~~~-~~~v~~t~s~T~a~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~  114 (366)
T 1m32_A           40 EQIRQQLTALATASEG-YTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMGIAHHAYDCGE----V  114 (366)
T ss_dssp             HHHHHHHHHHHCSSSS-EEEEEEESCHHHHHHHHHHHSCCTTCCEEEEESSHHHHHHHHHHHHHTCCEEEEECCT----T
T ss_pred             HHHHHHHHHHHCCCCC-CEEEEECCCHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCCCCCCCCC----C
T ss_conf             9999999998098999-8899989879999999999877523521355426216689999998477753444577----8


Q ss_pred             CCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCC
Q ss_conf             66677889999985025403421566643233443789999999986378757841750235568887652233210267
Q T0591           162 TRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDA  241 (406)
Q Consensus       162 ~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~  241 (406)
                      .....+.........++++++.++.-+|-||...+   ++++.++|+++|+++++|-+.+.-.    .+..+..     .
T Consensus       115 ~~~~~~~~~~~~~~~~~~~~v~~~~~~~~tG~~~~---v~~i~~~~~~~g~~~~vDa~qs~G~----~~~d~~~-----~  182 (366)
T 1m32_A          115 ARPDVQAIDAILNADPTISHIAMVHSETTTGMLNP---IDEVGALAHRYGKTYIVDAMSSFGG----IPMDIAA-----L  182 (366)
T ss_dssp             SCCCHHHHHHHHHHCTTCCEEEEESEETTTTEECC---HHHHHHHHHHHTCEEEEECTTTTTT----SCCCTTT-----T
T ss_pred             CCCCHHHHHHHHHCCCCCEEEEEECEECHHCEEEE---HHHHHHHHHCCCCEEEEECCCCCCC----CCEEEEC-----C
T ss_conf             77770267888606988159999650331035341---1134443313697068863124576----3201100-----1


Q ss_pred             CCEEEEEECCHHC-CCCCCCCHHHHHHHHHHHHHHH------------------HHHHCCCCHHHHHHHHHHHHHHCC--
Q ss_conf             8689985040010-4631121143325899999998------------------752036761245799999998565--
Q T0591           242 ENVVTIMGPSKTE-SLSGYRLGVAFGSRAIIARMEK------------------LQAIVSLRAAGYSQAVLRGWFDEA--  300 (406)
Q Consensus       242 ~~~i~~~S~SK~~-~~~GlRiG~~~~~~~~i~~l~~------------------~~~~~~~~~~~~~q~a~~~~l~~~--  300 (406)
                      .--+++.|..|.+ +-+|  +|++...++..+....                  ........++...-.+....+...  
T Consensus       183 ~~D~~~~~~~K~l~gP~G--~g~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~al~~~~~  260 (366)
T 1m32_A          183 HIDYLISSANKCIQGVPG--FAFVIAREQKLAACKGHSRSLSLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAK  260 (366)
T ss_dssp             TCSEEEEESSSTTCCCSS--EEEEEEEHHHHTTCTTCCSCSTTCHHHHHHHHHHTTTCCSSCCCHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHCCCCCCCCCC--EEEEHHHHHHHHHCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             000211221567789998--886130499998440568986631122220122356765676742677899999999998


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC----CCEEEEEECCC-CCCCHHHHHHHHHHHCCEEEEECCCCCCCC
Q ss_conf             2589999999999999999999727994553588----73078776688-788989999999986891896161026799
Q T0591           301 PGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ----AGSYLFPRLPK-LAVAPAEFVKILRLQAGVVVTPGTEFSPHT  375 (406)
Q Consensus       301 ~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~----gg~~~w~~~~~-~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~  375 (406)
                      +.......++.+...+.+.+.+... |.....+.    .+. +-+.+|+ ...+..++...| .+.||.+.+|...   .
T Consensus       261 ~~~~~~~~~~~~~~~~~l~~~~~~~-g~~~~~~~~~~s~~v-~~~~~p~~~~~~~~~~~~~L-~~~giiv~~G~~~---~  334 (366)
T 1m32_A          261 EGGVAARHQRYQQNQRSLVAGMRAL-GFNTLLDDELHSPII-TAFYSPEDPQYRFSEFYRRL-KEQGFVIYPGKVS---Q  334 (366)
T ss_dssp             HTHHHHHHHHHHHHHHHHHHHHHHT-TCCBSSCGGGBCSSE-EEEECCCCTTCCHHHHHHHH-HHTTEECEECCCS---S
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCHHHCCCCE-EEEECCCCCCCCHHHHHHHH-HHCCEEEECCCCC---C
T ss_conf             4359999999999998888788715-986357835539967-99989998887899999999-9789099789868---8


Q ss_pred             CCEEEEEE-C-CCHHHHHHHHHHHHHHHH
Q ss_conf             98589985-0-997999999999999999
Q T0591           376 ADSVRLNF-S-QDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       376 ~~~iRis~-~-~~~e~l~~al~rl~~~~~  402 (406)
                      .+.+|+++ . .++++++..++.|++.+.
T Consensus       335 ~~~~Ris~~g~~~~~di~~~~~al~~~L~  363 (366)
T 1m32_A          335 SDCFRIGNIGEVYAADITALLTAIRTAMY  363 (366)
T ss_dssp             SCEEEEECCSSCCHHHHHHHHHHHHHHCT
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             99899837888999999999999999844


No 145
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, csgid, cytoplasm, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis}
Probab=99.67  E-value=1.4e-13  Score=109.61  Aligned_cols=341  Identities=14%  Similarity=0.123  Sum_probs=189.4

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.+||..|  ...+.+-.|.+.+++.+++.....+. .+    .......++..... ..   ..+.++.+++++++...
T Consensus        56 ~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~~~~~~-~~----~~~~~~~~~~~~~~-~~---~~~~v~f~~sGseA~e~  126 (434)
T 3l44_A           56 KYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYG-TP----TALEVKFAKMLKEA-MP---ALDKVRFVNSGTEAVMT  126 (434)
T ss_dssp             EEEECCGGGTTCSSCBTCHHHHHHHHHHHHHCSCCS-SC----CHHHHHHHHHHHHH-CT---TCSEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CC----CHHHHHHHHHHHHH-CC---CCEEEEECCCCCHHHHH
T ss_conf             999856589871234795999999999997388546-77----25799999999752-66---43046633884089999


Q ss_pred             HHHHHHH-C-CHHHHHHHCCCHHHHHHHH-HHCCEEEE--EEECC------CCCCCCCCCCCHHHHHHHHCC---CCEEE
Q ss_conf             9999972-0-0101013105513899999-82996999--86044------666776667788999998502---54034
Q T0591           117 AVAATVA-R-GDKVAIVQPDYFANRKLVE-FFEGEMVP--VQLDY------VSADETRAGLDLTGLEEAFKA---GARVF  182 (406)
Q Consensus       117 ~~~~l~~-p-Gd~Vl~~~P~y~~~~~~~~-~~g~~~v~--v~~~~------~~~~~~~~~~d~~~l~~~~~~---~~k~i  182 (406)
                      +++..-. . ...|+...-+|++...... ..+.....  .|...      .........-+++.+++.+++   ++.++
T Consensus       127 AlklAr~~t~r~~vi~~~~~yHG~t~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~iaav  206 (434)
T 3l44_A          127 TIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAI  206 (434)
T ss_dssp             HHHHHHHHHCCCEEEEETTCCCCSSGGGGBC-------CCCBSSTTCCHHHHTTEEEECTTCHHHHHHHHHHHGGGEEEE
T ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             99999885299969999788668877575503798765799986799876566554677454999999998479974799


Q ss_pred             ECCCC-CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCC
Q ss_conf             21566-643233-4437899999999863787578417502355688876522332102678689985040010463112
Q T0591           183 LFSNP-NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYR  260 (406)
Q Consensus       183 ~l~~P-~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlR  260 (406)
                      ++ -| ..-.|. ..+++.+++|.++|++||+++|.||++..+.. +.-+.. . .....||  |  -+++|.++ .|+-
T Consensus       207 ii-EPi~g~~G~~~p~~~yl~~lr~lc~~~gilLI~DEV~tG~~~-g~~~~~-~-~~gv~PD--i--v~~gK~lg-gG~p  277 (434)
T 3l44_A          207 LV-EPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRF-MYGGAQ-D-LLGVTPD--L--TALGKVIG-GGLP  277 (434)
T ss_dssp             EE-CSSBCTTSCBCCCTTHHHHHHHHHHTTTCEEEEECTTTTTTS-SSSCHH-H-HHTCCCS--E--EEEEGGGG-TTSS
T ss_pred             EE-CCCCCCCCCEECCHHHHHHHHHHHHHCCCEEEEECCCCCCCC-CCCCCH-H-HCCCCCH--H--HEECCCCC-CCCC
T ss_conf             96-864266995889899999999999862977998657312344-355545-5-3288833--4--30103567-8763


Q ss_pred             CHHHHHHHHHHHHHHHHH---HHCCCCHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEECCC
Q ss_conf             114332589999999875---203676124579999999856--5258999999999999999999972799-4553588
Q T0591           261 LGVAFGSRAIIARMEKLQ---AIVSLRAAGYSQAVLRGWFDE--APGWMEDRIARHQAIRDELLHVLRGCEG-VFARTPQ  334 (406)
Q Consensus       261 iG~~~~~~~~i~~l~~~~---~~~~~~~~~~~q~a~~~~l~~--~~~~~~~~~~~~~~~r~~l~~~L~~~~g-~~~~~p~  334 (406)
                      +|.+++.+++.+.+....   ...+++.+.++..++.+.|+.  .+...+...+.-+..++.+.+.+.+.+. +.... -
T Consensus       278 ~~av~~~~~i~~~~~~~~~~~~~sT~~gnpl~~Aaa~a~L~~i~~~~l~~~~~~~g~~l~~~l~~l~~~~~~~v~~~~-~  356 (434)
T 3l44_A          278 IGAYGGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGATLEKGILEQAAKHNIDITLNR-L  356 (434)
T ss_dssp             CEEEEECHHHHTTBTTTSSBCCCCTTTTCHHHHHHHHHHHHHHTSTTHHHHHHHHHHHHHHHHHHHHHHTTCCEEEEE-E
T ss_pred             CEEEEEHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE-C
T ss_conf             111445299999861268874668999870666899999999971678999999999999999999987799889972-4


Q ss_pred             CCEEEEEECCCCCCC--------H---HHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             730787766887889--------8---99999999868918961610267999858998509979999999999999998
Q T0591           335 AGSYLFPRLPKLAVA--------P---AEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       335 gg~~~w~~~~~~~~~--------~---~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~  403 (406)
                      +|++...-..+...+        .   ..|...++ ++||.+.|+      +..-++++...++|+++++++.|.+.+++
T Consensus       357 ~g~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~l-~~Gv~~~p~------~~~~~~is~~~t~eeid~~~~~l~~al~~  429 (434)
T 3l44_A          357 KGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLML-QEGVNLAPS------KYEAWFLTTEHTKEDIEYTIEAVGRAFAA  429 (434)
T ss_dssp             TTEEEEEESSSCCCSHHHHHHSCHHHHHHHHHHHH-HTTEECCSS------TTCCEECCTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEEECCCCCCHHHHHCCCHHHHHHHHHHHH-HCCEEECCC------CCCCEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             87789998057767878761365999999999999-799398268------98425588888299999999999999999


Q ss_pred             HC
Q ss_conf             56
Q T0591           404 YR  405 (406)
Q Consensus       404 ~r  405 (406)
                      ++
T Consensus       430 l~  431 (434)
T 3l44_A          430 LA  431 (434)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             97


No 146
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana}
Probab=99.67  E-value=3e-13  Score=107.47  Aligned_cols=338  Identities=13%  Similarity=0.064  Sum_probs=195.5

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC--CEEEEECCCCHHHHHHHHHHHH---C---
Q ss_conf             8889999999999808788887888898899999999998648867886--7078824872789999999972---0---
Q T0591            53 PTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDAR--DGLIITPGTQGALFLAVAATVA---R---  124 (406)
Q Consensus        53 p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~--~~I~it~G~~~~l~~~~~~l~~---p---  124 (406)
                      +.|.+-+.+...+.. ....+....+..++-+.+.+|+.+..|.+....  ..=.+|+|+++++.+++.+..+   +   
T Consensus        68 ~~~~a~~~~~~~~~~-n~~~~~~~p~~~~lE~~~~~~la~l~g~p~~~~~~~~G~~t~Ggs~a~l~a~~aar~~~~~~~~  146 (502)
T 3hbx_A           68 MEPECDKLIMSSINK-NYVDMDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGTVGSSEAIMLAGLAFKRKWQNKRK  146 (502)
T ss_dssp             CCHHHHHHHHHTTTC-BTTCTTTCHHHHHHHHHHHHHHHHHTTCCCCSSCCCEEEEESSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHCC-CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             899999999998526-8888420677999999999999998688943257975577452799999999999999999876


Q ss_pred             --C-----HHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCH
Q ss_conf             --0-----101013105513899999829969998604466677666778899999850254034215666432334437
Q T0591           125 --G-----DKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSA  197 (406)
Q Consensus       125 --G-----d~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~  197 (406)
                        |     -.|++++-.+.+....++.+|.+++.|+++     ++++.+|+++|++++.+++.+++++.++|+||.+-+.
T Consensus       147 ~~g~~~~~~~i~~s~~aH~s~~kaa~~~Gi~~~~V~~~-----~~~~~~D~~~L~~~i~~~t~~v~~~~~tt~tg~~d~i  221 (502)
T 3hbx_A          147 AEGKPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLS-----EGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDV  221 (502)
T ss_dssp             HTTCCCSCCEEEEETTCCHHHHHHHHHTTCEEEEECCB-----TTBCSCCHHHHHHHCCTTEEEEEEEBSCTTTCCBCCH
T ss_pred             HCCCCCCCCEEEEECCCCHHHHHHHHHCCCCEEEEEEC-----CCCCCCCHHHHHHHHCCCCCEEEEEEEEECCCCCCCH
T ss_conf             22788778479975887779999999728961899878-----9887318999999851587269986466077543439


Q ss_pred             HHHHHHHHHH---HHCCCEEEECCCCCCCC--CCCCCCCCHHHHHCCCCCCE-EEEEECCHHCCCCCCCCHHHHH-HHHH
Q ss_conf             8999999998---63787578417502355--68887652233210267868-9985040010463112114332-5899
Q T0591           198 EEIGQIAALA---ARYGATVIADQLYSRLR--YAGASYTHLRAEAAVDAENV-VTIMGPSKTESLSGYRLGVAFG-SRAI  270 (406)
Q Consensus       198 ~~l~~i~~~a---~~~~~~ii~De~Y~~l~--~~~~~~~~~~~~~~~~~~~~-i~~~S~SK~~~~~GlRiG~~~~-~~~~  270 (406)
                      +++.+|++..   ..+++++.+|-+|..+.  |........     ...+++ ....+..|.+..| .-+|++.. ++..
T Consensus       222 ~~I~~i~~~~~~~~~~d~~~HvDaA~~g~~~~~~~~~~~~~-----~~~~~~dSi~~~~HK~~~~p-~g~g~~~~r~~~~  295 (502)
T 3hbx_A          222 KLLNDLLVEKNKETGWDTPIHVDAASGGFIAPFLYPELEWD-----FRLPLVKSINVSGHKYGLVY-AGIGWVIWRNKED  295 (502)
T ss_dssp             HHHHHHHHHHHHHHCCCCCEEEECTTGGGTHHHHCTTCCCS-----TTSTTEEEEEEETTTTTCCC-SSCEEEEESSGGG
T ss_pred             HHHHHHHHHHCCCCCCCHHHCCCHHHCCCCCCCCHHHHHHH-----CCCCCCCEEEECCCCCCCCC-CCEEEEEEECHHH
T ss_conf             99999999957543553221241321353124460022443-----47888776864653226888-7858999977566


Q ss_pred             HHHHHHHH-HH-------CCCCHHH-HHHH-HHHHHH-HCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECC-CC-CE
Q ss_conf             99999875-20-------3676124-5799-999998-565258999999999999999999972799455358-87-30
Q T0591           271 IARMEKLQ-AI-------VSLRAAG-YSQA-VLRGWF-DEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTP-QA-GS  337 (406)
Q Consensus       271 i~~l~~~~-~~-------~~~~~~~-~~q~-a~~~~l-~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p-~g-g~  337 (406)
                      ........ .+       .+...+. .... .+...+ .-+..-+++..++...+.+.+.+.|.+++++++..+ .+ +.
T Consensus       296 l~~~~~~~~~y~~~~~~~~~~~~sr~~~~~~~~~~~l~~lG~~G~~~~~~~~~~~A~yl~~~L~~~~~~el~~~p~~~~i  375 (502)
T 3hbx_A          296 LPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEGVPL  375 (502)
T ss_dssp             SCGGGCEEECSSSSCEEECCSCCSCBSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCEEECSCSSSSSE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCEE
T ss_conf             02223346775678777635677775466999999999957599999999999999999999974899599827998408


Q ss_pred             EEEEECC-CCCCCHHHHHHHHHHHCCEEEEECCCCCCCC--CCEEEEEEC--CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             7877668-8788989999999986891896161026799--985899850--997999999999999999856
Q T0591           338 YLFPRLP-KLAVAPAEFVKILRLQAGVVVTPGTEFSPHT--ADSVRLNFS--QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       338 ~~w~~~~-~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~--~~~iRis~~--~~~e~l~~al~rl~~~~~~~r  405 (406)
                      .. .+++ ..+.+..+++.+| .++|..+ |...|-+.+  ...+|+.+.  .+.+++++-++-|++.+++++
T Consensus       376 V~-F~~~~~~~~~~~dia~~L-~~~G~~~-~~~~~pp~~~~~~~lrv~~~~~~t~~~id~fv~dl~~i~~el~  445 (502)
T 3hbx_A          376 VA-FSLKDSSCHTEFEISDML-RRYGWIV-PAYTMPPNAQHITVLRVVIREDFSRTLAERLVIDIEKVMRELD  445 (502)
T ss_dssp             EE-EEESSCSSCCHHHHHHHH-HTTTCBC-CEEECCTTCTTCEEEEEECCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             EE-EECCCCCCCCHHHHHHHH-HHCCCEE-ECCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99-974799887899999999-9859874-1577898645635788882189999999999999999999999


No 147
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A
Probab=99.67  E-value=8.7e-15  Score=117.87  Aligned_cols=347  Identities=15%  Similarity=0.125  Sum_probs=182.3

Q ss_pred             CEEECCC--CCCCCCCCHHHHHHHHHHHHCCC--CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             3341567--86788788899999999998087--8888788889889999999999864886788670788248727899
Q T0591            40 PVDFSHG--DVDAHEPTPGAFDLFSAGVQSGG--VQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        40 ~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~--~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      .|||..|  ...+.+-.|.+.+++.+.+....  ........-.......+++.+.+..+-+.  -+.++.+++++++..
T Consensus        56 ylD~~~g~~~~~lGh~~p~i~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~--~~~v~f~~SGsEAve  133 (449)
T 2cjg_A           56 YLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKPSNSDVYSVAMARFVETFARVLGDPA--LPHLFFVEGGALAVE  133 (449)
T ss_dssp             EEESSHHHHTCSSCBSCHHHHTCHHHHHHHHHHHTCCCCTTTCCCHHHHHHHHHHHHHHCCTT--CCEEEEESSHHHHHH
T ss_pred             EEECCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCC--CCEEEECCCCCCHHH
T ss_conf             888553188755067989999999999999999870567752023999999999998648866--686996378870788


Q ss_pred             HHHHHH---HHC-C----------HHHHHHHCCCHHHHHHHH-HHC-------------CEEEEEEECCCCCCCC----C
Q ss_conf             999999---720-0----------101013105513899999-829-------------9699986044666776----6
Q T0591           116 LAVAAT---VAR-G----------DKVAIVQPDYFANRKLVE-FFE-------------GEMVPVQLDYVSADET----R  163 (406)
Q Consensus       116 ~~~~~l---~~p-G----------d~Vl~~~P~y~~~~~~~~-~~g-------------~~~v~v~~~~~~~~~~----~  163 (406)
                      .+++.-   .+. +          -.|+...-+|++...... ..+             ...++.|......+..    .
T Consensus       134 ~AlKlAr~~t~~~~~~~~~~~~~~~~ii~~~gsyHG~t~~~~s~t~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~  213 (449)
T 2cjg_A          134 NALKAAFDWKSRHNQAHGIDPALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPKFDWPRIDAPYMRPGLDEPAMAAL  213 (449)
T ss_dssp             HHHHHHHHHHHHHHHHTTSCTTCCCEEEEETTCCCCSSTTGGGTCCSCHHHHTTSCCCCCCEECCCCCCTTCCHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             99999988874036655567666758999247515765631104578865445656655676554333222222103344


Q ss_pred             CCCCHHHHHHHHC---CCCEEEECCCC--CCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             6778899999850---25403421566--643233443789999999986378757841750235568887652233210
Q T0591           164 AGLDLTGLEEAFK---AGARVFLFSNP--NNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAA  238 (406)
Q Consensus       164 ~~~d~~~l~~~~~---~~~k~i~l~~P--~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~  238 (406)
                      ..-+++++++.+.   +++.++++ .|  ++--+...+++.++++.++|++||+++|.||++..|...|..+..-.  ..
T Consensus       214 ~~~~l~~l~~~l~~~~~~iAAvi~-EPi~g~~G~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfgrtG~~~~~~~--~~  290 (449)
T 2cjg_A          214 EAEALRQARAAFETRPHDIACFVA-EPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQ--LD  290 (449)
T ss_dssp             HHHHHHHHHHHHHHSTTTEEEEEE-CSEETTTTCEECCHHHHHHHHHHHHHTTCEEEEECTTTTTTTTSSSSTHHH--HT
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEE-ECCCCCCCCCCCHHHHHHHHHHHHHHHHCCEEHHCCCCCCCCCCCCCCCCC--CC
T ss_conf             566777766666417875468994-034555544430677777899999876145003115432334665442123--44


Q ss_pred             CCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHH
Q ss_conf             26786899850400104631121143325899999998752036761245799999998565--2589999999999999
Q T0591           239 VDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRD  316 (406)
Q Consensus       239 ~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~  316 (406)
                      ..||  +  -+++|.++..+.-+|.++................+++.+.++..++.+.++..  +...+...+.-+..++
T Consensus       291 v~PD--i--v~~gK~l~~G~~~~~~~~~~~~~~~~~~~~~~~~T~~g~p~~~aaa~a~l~~~~~~~~~~~~~~~g~~l~~  366 (449)
T 2cjg_A          291 VAPD--I--VAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRA  366 (449)
T ss_dssp             CCCS--E--EEECGGGSSEEEEECGGGGGSTTCTTTSTTSSCCSSSSCHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHH
T ss_pred             CCCC--H--HHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             3552--5--65531024442012456666665403677432233344432222203332100000257789999999999


Q ss_pred             HHHHHHHHCCC-CEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHH
Q ss_conf             99999972799-4553588730787766887889899999999868918961610267999858998--50997999999
Q T0591           317 ELLHVLRGCEG-VFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAA  393 (406)
Q Consensus       317 ~l~~~L~~~~g-~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~a  393 (406)
                      .+.+...+.+. +.-.... |+++-+.++.. ....+++..++ ++||++.|+      +.+.+|++  ++.++++++++
T Consensus       367 ~L~~l~~~~p~~v~~vrG~-Gl~~~ie~~~~-~~~~~~~~~~~-~~Gl~~~~~------g~~~ir~~Ppl~it~~~id~~  437 (449)
T 2cjg_A          367 RLDELAADFPAVVLDPRGR-GLMCAFSLPTT-ADRDELIRQLW-QRAVIVLPA------GADTVRFRPPLTVSTAEIDAA  437 (449)
T ss_dssp             HHHHHHHHSTTTSEEEEEE-TTEEEEECSSH-HHHHHHHHHHH-HTTEECEEE------TTTEEEECCCTTCCHHHHHHH
T ss_pred             HHHHHHHHCCCCEEEEECC-CEEEEEEECCC-CCHHHHHHHHH-HCCCEEEEC------CCCEEEEECCCCCCHHHHHHH
T ss_conf             9999985688834776304-57999993783-02999999999-789489116------999899969847899999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999985
Q T0591           394 ARRIVTLVERY  404 (406)
Q Consensus       394 l~rl~~~~~~~  404 (406)
                      +++|.+.++..
T Consensus       438 l~~l~~al~~v  448 (449)
T 2cjg_A          438 IAAVRSALPVV  448 (449)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999986


No 148
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'- phosphate, hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3
Probab=99.66  E-value=2.5e-14  Score=114.78  Aligned_cols=334  Identities=16%  Similarity=0.133  Sum_probs=179.0

Q ss_pred             HCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCC---CCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCC
Q ss_conf             037898334156786788788899999999998087888---87888898899999999998648867886707882487
Q T0591            34 APIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQA---YTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGT  110 (406)
Q Consensus        34 ~~~~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~---Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~  110 (406)
                      .+.....+-|..+...  .++..+.+++.+.+.+.....   +.......++-+.+.+.+.+..|.  +| ++|++|.|+
T Consensus        23 F~~~~~~~YLd~as~~--~~p~~v~~a~~~~l~~~~~n~~~~~~~~~~~~~~~e~aR~~ia~ll~a--~~-~ei~~~~~~   97 (416)
T 1qz9_A           23 FALPEGVIYLDGNSLG--ARPVAALARAQAVIAEEWGNGLIRSWNSAGWRDLSERLGNRLATLIGA--RD-GEVVVTDTT   97 (416)
T ss_dssp             BCCCTTCEECCTTTSC--CCBTTHHHHHHHHHHTCCCCCGGGHHHHTSGGGHHHHHHHHHHTTTTC--CT-TSEEECSCH
T ss_pred             CCCCCCCEECCCCCCC--CCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCC--CC-CCEEEECCC
T ss_conf             8999999985685004--367999999999999986245756555133899999999999998197--97-588997585


Q ss_pred             CHHHHHHHHHH------HHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             27899999999------720010101310551389999982996999860446667766677889999985025403421
Q T0591           111 QGALFLAVAAT------VARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLF  184 (406)
Q Consensus       111 ~~~l~~~~~~l------~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l  184 (406)
                      |++++.++..+      ..+|+.|++..-.++.........+.++..++.+      .....+++.++++++++|+++.+
T Consensus        98 T~~~~~~~~~~~~~~~~~~~~~~vvv~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~i~~~T~lV~v  171 (416)
T 1qz9_A           98 SINLFKVLSAALRVQATRSPERRVIVTETSNFPTDLYIAEGLADMLQQGYT------LRLVDSPEELPQAIDQDTAVVML  171 (416)
T ss_dssp             HHHHHHHHHHHHHHHHHHSTTCCEEEEETTSCHHHHHHHHHHHHHHCSSCE------EEEESSGGGHHHHCSTTEEEEEE
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEECCCCC------CCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             278777766678764046899779996443015679999710223202211------34568999999746888359999


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCC-CHH
Q ss_conf             5666432334437899999999863787578417502355688876522332102678689985040010463112-114
Q T0591           185 SNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYR-LGV  263 (406)
Q Consensus       185 ~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlR-iG~  263 (406)
                      +.-+|-||.+++   +++|+++|+++++++++|-+..-    |..+..+....   .  -+++.|.+|.+..+ .. +|+
T Consensus       172 ~~v~n~tG~~~p---i~~i~~~~~~~~~~~~vDa~q~~----g~~~~d~~~~~---~--d~~~~s~~K~~~~~-~g~~g~  238 (416)
T 1qz9_A          172 THVNYKTGYMHD---MQALTALSHECGALAIWDLAHSA----GAVPVDLHQAG---A--DYAIGCTYKYLNGG-PGSQAF  238 (416)
T ss_dssp             ESBCTTTCBBCC---HHHHHHHHHHHTCEEEEECTTTT----TTSCCCHHHHT---C--SEEEECSSSTTCCC-TTCCCE
T ss_pred             EEECCCCCCEEC---HHHHHHHHHHCCCEEEEECCCCC----CCCCCCCCCCC---C--CEEEECCCCCCCCC-CCEEEE
T ss_conf             752488774616---99999886205742898513320----12454332448---8--67750233533679-955999


Q ss_pred             HHHHHHHHHHHHHH-----------------------HHHCCCCHHHHHHHHH---HHHHH-CCCHHHHHHHHHHHHHHH
Q ss_conf             33258999999987-----------------------5203676124579999---99985-652589999999999999
Q T0591           264 AFGSRAIIARMEKL-----------------------QAIVSLRAAGYSQAVL---RGWFD-EAPGWMEDRIARHQAIRD  316 (406)
Q Consensus       264 ~~~~~~~i~~l~~~-----------------------~~~~~~~~~~~~q~a~---~~~l~-~~~~~~~~~~~~~~~~r~  316 (406)
                      +...+.+.+.....                       ................   ...+. .+...++...........
T Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~  318 (416)
T 1qz9_A          239 VWVSPQLCDLVPQPLSGWFGHSRQFAMEPRYEPSNGIARYLCGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFI  318 (416)
T ss_dssp             EEECTTTTTTSCCSCCCGGGBCTTSCCCSSCCBCSSGGGGCCSCCCHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHH
T ss_pred             EEECHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             99747877327787776788776521222210013402331158307899987767899874019999999999999999


Q ss_pred             HHHHHHHHCCCCEEECCC-----CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC---CCHH
Q ss_conf             999999727994553588-----73078776688788989999999986891896161026799985899850---9979
Q T0591           317 ELLHVLRGCEGVFARTPQ-----AGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS---QDHE  388 (406)
Q Consensus       317 ~l~~~L~~~~g~~~~~p~-----gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~---~~~e  388 (406)
                      .+.+.+....++....|.     ++. +-+..+    ++.++.+.| .++||.+.    +  ..++.||+|++   ++++
T Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~r~~~-vs~~~~----~~~~v~~~L-~~~gI~~~----~--r~~~~iRvS~~h~ynt~~  386 (416)
T 1qz9_A          319 ELVEQRCAAHELTLVTPREHAKRGSH-VSFEHP----EGYAVIQAL-IDRGVIGD----Y--REPRIMRFGFTPLYTTFT  386 (416)
T ss_dssp             HHHHHHHTTSCCEECSCSSGGGBCSE-EEEECT----THHHHHHHH-HTTTEECE----E--ETTTEEEEECCTTTCCHH
T ss_pred             HHHHHHCCCCCEEEECCCCCCCCEEE-EEECCC----CHHHHHHHH-HHCCCEEE----C--CCCCEEEEECCCCCCCHH
T ss_conf             99974125788256258873322469-998379----999999999-87898973----2--699879997997789999


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999998
Q T0591           389 AAVAAARRIVTLVER  403 (406)
Q Consensus       389 ~l~~al~rl~~~~~~  403 (406)
                      +++..++.|++++++
T Consensus       387 dId~~i~~L~~~l~~  401 (416)
T 1qz9_A          387 EVWDAVQILGEILDR  401 (416)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999970


No 149
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.subtilis ortholog; NP_348457.1; HET: LLP MSE; 2.00A {Clostridium acetobutylicum}
Probab=99.66  E-value=7.6e-15  Score=118.30  Aligned_cols=230  Identities=11%  Similarity=0.021  Sum_probs=136.7

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCEEE-E-ECCCCHHHHHHHHHHHHCCHHHHHHH-CCCHHHHHHH-----------H
Q ss_conf             8988999999999986488678867078-8-24872789999999972001010131-0551389999-----------9
Q T0591            78 GDLGIRDLLAPRLAAFTGAPVDARDGLI-I-TPGTQGALFLAVAATVARGDKVAIVQ-PDYFANRKLV-----------E  143 (406)
Q Consensus        78 G~~~Lr~aia~~~~~~~g~~~~~~~~I~-i-t~G~~~~l~~~~~~l~~pGd~Vl~~~-P~y~~~~~~~-----------~  143 (406)
                      |.|.+.+..    .+.+|.+    +-.+ + ++.+++|+..++.+++.|||+|++.. +.|......+           .
T Consensus        75 Gnptle~l~----A~l~g~E----~Alv~~~f~SGtaAI~~aLlalLrPGDeIL~~~g~~Ydtl~~v~G~t~~~~~~~L~  146 (427)
T 3hvy_A           75 GRDSLDRVY----ANIFNTE----SAFVRPHFVNGTHAIGAALFGNLRPNDTMMSICGMPYDTLHDIIGMDDSKKVGSLR  146 (427)
T ss_dssp             HHHHHHHHH----HHHHTCS----EEEEETTCCSHHHHHHHHHHHTCCTTCEEEECSSSCCGGGHHHHTCCTTCCSCCTG
T ss_pred             CCHHHHHHH----HHHHCCC----CCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECHHHHHHHHHHH
T ss_conf             998999999----9985626----87033686588999999999975799989991488775420230456677763688


Q ss_pred             HHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCC---CCCCHHHHHHHHHHHHHC--CCEEEECC
Q ss_conf             8299699986044666776667788999998502540342156664323---344378999999998637--87578417
Q T0591           144 FFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAG---VVYSAEEIGQIAALAARY--GATVIADQ  218 (406)
Q Consensus       144 ~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG---~~~s~~~l~~i~~~a~~~--~~~ii~De  218 (406)
                      .+|.+...++.       .+...|++++++++++++|..++..++||..   -.++..++++++++++++  ++++++|+
T Consensus       147 ~~GI~~~~vd~-------~d~~~d~~~i~~ai~~~tkt~lV~~e~~~~~~~~p~~~i~dI~~i~~~ak~~~~~viv~vDN  219 (427)
T 3hvy_A          147 EYGVKYKMVDL-------KDGKVDINTVKEELKKDDSIKLIHIQRSTGYGWRKSLRIAEIAEIIKSIREVNENVIVFVDN  219 (427)
T ss_dssp             GGTCEEEECCC-------BTTBCCHHHHHHHHHHCTTEEEEEEESSCCSSSSCCCCHHHHHHHHHHHHHHCSSSEEEEEC
T ss_pred             HCCEEEEECCC-------CCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             70917774598-------87344399999861656774999957888777786377999999999999856898899716


Q ss_pred             CCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCC-CCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             50235568887652233210267868998504001046311-21143325899999998752036761245799999998
Q T0591           219 LYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGY-RLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWF  297 (406)
Q Consensus       219 ~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~Gl-RiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l  297 (406)
                      +|..+.....+   + ... .|    ++++|++|.++-.|- --|+++++++++++.+........+.+...-.....-+
T Consensus       220 t~~~p~~~~eP---l-~~G-AD----iV~~SltK~lgGh~d~~GG~IvG~kelIe~~~~rl~~~G~g~~~g~~~~~lRgl  290 (427)
T 3hvy_A          220 CYGEFVEEKEP---T-DVG-AD----IIAGSLIKNIGGGIATTGGYIAGKEEYVTQATFRVTVPGIGGECGSTFGVMRSL  290 (427)
T ss_dssp             TTCTTTSSSCG---G-GGT-CS----EEEEETTSGGGTTTCCSCEEEEECHHHHHHHHHHHSCTTTGGGCCCCTTCHHHH
T ss_pred             CCCCHHHCCCC---H-HHC-CC----EEEEEEEECCCCCCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
T ss_conf             76541104686---2-207-95----899973104788877647999828999999999974898677862489998787


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             56525899999999999999999997279945535
Q T0591           298 DEAPGWMEDRIARHQAIRDELLHVLRGCEGVFART  332 (406)
Q Consensus       298 ~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~  332 (406)
                      ....-..++....-.+....+.+.|..+ |+.+.+
T Consensus       291 ~tl~~r~~~~~~nA~k~A~flA~~~e~~-g~~v~P  324 (427)
T 3hvy_A          291 YEGLFMAPHVTIEAVKGAVFCARIMELA-GFDVLP  324 (427)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHT-TCEEES
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCC
T ss_conf             5526448999999999999999999975-981489


No 150
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, cytoplasm, one-carbon metabolism, pyridoxal phosphate; 1.60A {Burkholderia pseudomallei}
Probab=99.66  E-value=3.4e-13  Score=107.09  Aligned_cols=337  Identities=17%  Similarity=0.104  Sum_probs=201.1

Q ss_pred             CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC---C---CHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCH
Q ss_conf             833415678678878889999999999808788887888---8---9889999999999864886788670788248727
Q T0591            39 RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYR---G---DLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQG  112 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~---G---~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~  112 (406)
                      .-|+|-..+   ...+|.+.+++...+...-.-|||-.+   |   ..++-+...+..++.+|...   -+|=.-+| +.
T Consensus        33 ~~l~LiaSE---N~~S~~v~~a~gS~l~nkYaeG~pg~ryy~G~~~iD~iE~la~~ra~~lF~a~~---anvqp~SG-s~  105 (425)
T 3ecd_A           33 SQVELIASE---NIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGH---ANVQPHSG-AQ  105 (425)
T ss_dssp             HSEECCTTC---CCCCHHHHHHHTSGGGSSCTTC------------CCHHHHHHHHHHHHHHTCSE---EECCCSSH-HH
T ss_pred             CCCEEECCC---CCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC---CCCCCCCH-HH
T ss_conf             687486378---867999999856842264668899963658874399999999999998549975---36766855-99


Q ss_pred             HHHHHHHHHHHCCHHHHHHHCCCHHHHH---H--HHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CCCEEEECCC
Q ss_conf             8999999997200101013105513899---9--99829969998604466677666778899999850-2540342156
Q T0591           113 ALFLAVAATVARGDKVAIVQPDYFANRK---L--VEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AGARVFLFSN  186 (406)
Q Consensus       113 ~l~~~~~~l~~pGd~Vl~~~P~y~~~~~---~--~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~~  186 (406)
                      +...++.+++.|||+|+..++...+|..   .  +...+.+.++++++     .+.+.+|.+++++..+ .++|+|++..
T Consensus       106 An~av~~all~pGD~il~l~l~~GGHlshg~~~~~~g~~~~~~~y~~~-----~~~~~IDyd~~~~~a~~~kPklIi~G~  180 (425)
T 3ecd_A          106 ANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVS-----RDTMLIDYDQVEALAQQHKPSLIIAGF  180 (425)
T ss_dssp             HHHHHHHHHCCTTCEEEEECC------------------CEEEEECCC-----TTTSSCCHHHHHHHHHHHCCSEEEEEC
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEEC-----CCCCCCCHHHHHHHHHHCCCCEEEECC
T ss_conf             999999985699998998553458875756666654217887885452-----466750199999998651998799676


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC-CCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHH
Q ss_conf             66432334437899999999863787578417502-35568887652233210267868998504001046311211433
Q T0591           187 PNNPAGVVYSAEEIGQIAALAARYGATVIADQLYS-RLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAF  265 (406)
Q Consensus       187 P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~-~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~  265 (406)
                      -..|-  .+   +.+++.++|.+.|.+++.|-++- .|+-.|.-+.++..     .+  |+.+|..|+|  +|-|-|.+.
T Consensus       181 S~y~r--~~---d~~~~reIad~vga~l~~D~aH~~GLIa~g~~pnPl~~-----aD--vvt~tTHKTL--rGPrgGiIl  246 (425)
T 3ecd_A          181 SAYPR--KL---DFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEH-----AH--VVTSTTHKTL--RGPRGGFVL  246 (425)
T ss_dssp             SCCCS--CC---CHHHHHHHHHHHTCEEEEECGGGHHHHHTTSSCCGGGT-----CS--EEEEESSGGG--CCCSCEEEE
T ss_pred             CCCCC--CC---CHHHHHHHHHHHCCEEEECHHHHHHHHHCCCCCCCCCC-----CC--EEECCCCCCC--CCCCCEEEE
T ss_conf             25766--35---79999977886396786034557777525678992002-----40--5865245456--788842898


Q ss_pred             HH-HHHHHHHHHHHHHCCCCHHHHHHHHH-HHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECC-CCCEEEEE
Q ss_conf             25-89999999875203676124579999-999856-5258999999999999999999972799455358-87307877
Q T0591           266 GS-RAIIARMEKLQAIVSLRAAGYSQAVL-RGWFDE-APGWMEDRIARHQAIRDELLHVLRGCEGVFARTP-QAGSYLFP  341 (406)
Q Consensus       266 ~~-~~~i~~l~~~~~~~~~~~~~~~q~a~-~~~l~~-~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p-~gg~~~w~  341 (406)
                      .. +++.+++....-....+.+...+.++ +..+.+ .....++..++.-++.+.|.+.|.+. |+.+... .-.-.+|+
T Consensus       247 ~~~~~~~~kI~~avfPg~qggph~~~iAa~aval~Ea~~~~f~~Ya~qVv~NAkaLa~~L~~~-G~~vv~ggTdnH~vlv  325 (425)
T 3ecd_A          247 TNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAG-GVDLVTGGTDNHLLLV  325 (425)
T ss_dssp             ESCHHHHHHHHHHHC-----CCCHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHHHHHHHHHT-TCEEGGGSCSSSEEEE
T ss_pred             ECCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCEEEE
T ss_conf             467789999865519654567126679999999999708889999999999999999887518-9279717987656999


Q ss_pred             ECCCCCCCHHHHHHHHHHHCCEEEE----ECCCCCCCCCCEEEEEE------CCCHHHHHHHHHHHHHHHHH
Q ss_conf             6688788989999999986891896----16102679998589985------09979999999999999998
Q T0591           342 RLPKLAVAPAEFVKILRLQAGVVVT----PGTEFSPHTADSVRLNF------SQDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       342 ~~~~~~~~~~~~~~~Ll~~~gV~v~----pG~~Fg~~~~~~iRis~------~~~~e~l~~al~rl~~~~~~  403 (406)
                      ++...+.+..+. +..+++.||.+.    |++.=.+..+.-+||..      +..++++++-.+-|.++++.
T Consensus       326 d~~~~~~~g~~a-~~~Le~~gI~vNkn~iP~d~~~~~~~sGiRlGT~a~TtrG~~e~dm~~iA~lI~~~l~~  396 (425)
T 3ecd_A          326 DLRPKGLKGAQV-EQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEA  396 (425)
T ss_dssp             ECGGGTCCHHHH-HHHHHHTTEECEECCCTTCSSCTTTCSEEEEESHHHHHTTCCHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHH-HHHHHHCCEEECCCCCCCCCCCCCCCCCEEECCHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             706778879999-99987489897578588999889999852657789984899889999999999999997


No 151
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A*
Probab=99.66  E-value=2.2e-12  Score=101.57  Aligned_cols=349  Identities=14%  Similarity=0.092  Sum_probs=192.3

Q ss_pred             CCC-CEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             898-3341567--8678878889999999999808788887888898899999999998648867886707882487278
Q T0591            37 EGR-PVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        37 ~~~-~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      +|+ .||+..|  ...+.+-.|.+.+++.+.+.....   .......+.+..+|+.+.......   -+.++.+++++++
T Consensus        41 dG~~ylD~~~g~~~~~lGh~~p~v~~ai~~q~~~~~~---~~~~~~~~~~~~la~~L~~~~~~~---~~~v~f~~sGseA  114 (433)
T 1zod_A           41 DGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDH---LFSEMLSRPVVDLATRLANITPPG---LDRALLLSTGAES  114 (433)
T ss_dssp             TCCEEEETTHHHHTCTTCBTCHHHHHHHHHHHHHCCC---CCTTCCCHHHHHHHHHHHHHSCTT---CCEEEEESCHHHH
T ss_pred             CCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCC---CCCCCCCHHHHHHHHHHHHHCCCC---CCEEEECCCCCCH
T ss_conf             9699998552888663168989999999999863455---445411689999999788747844---1314530465520


Q ss_pred             HHHHHHHHH-HCC-HHHHHHHCCCHHHHHHH-HHHCC-----------EEEEEEECCCCCCCCC---CCCC---HHHHHH
Q ss_conf             999999997-200-10101310551389999-98299-----------6999860446667766---6778---899999
Q T0591           114 LFLAVAATV-ARG-DKVAIVQPDYFANRKLV-EFFEG-----------EMVPVQLDYVSADETR---AGLD---LTGLEE  173 (406)
Q Consensus       114 l~~~~~~l~-~pG-d~Vl~~~P~y~~~~~~~-~~~g~-----------~~v~v~~~~~~~~~~~---~~~d---~~~l~~  173 (406)
                      ...+++..- -.| ..|+...-.|++..... ...+.           ....++..........   ....   .++++.
T Consensus       115 ~e~AlklAr~~t~r~~ii~~~~~yHG~t~~~~s~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  194 (433)
T 1zod_A          115 NEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAFD  194 (433)
T ss_dssp             HHHHHHHHHHHHTCCEEEEETTCCCCSSHHHHHTCCSSCCSSSCCCCTTEEEECCCCTTSCCCEETTEECHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCEEECCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             89999999984299622203433454100000346762102457865674122322344665333443114677889888


Q ss_pred             HH----CCCCEEEECCCCC-CCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEE
Q ss_conf             85----0254034215666-43233-443789999999986378757841750235568887652233210267868998
Q T0591           174 AF----KAGARVFLFSNPN-NPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTI  247 (406)
Q Consensus       174 ~~----~~~~k~i~l~~P~-NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~  247 (406)
                      .+    ..++.++++ -|= .--|. ..+++.+++|.++|++||+++|.||++..|.-.|.-+.. .. ....||    +
T Consensus       195 ~~~~~~~~~iaavi~-EPi~g~gG~~~~~~~yl~~l~~lc~~~gillI~DEV~tGfGRtG~~~a~-~~-~gv~PD----i  267 (433)
T 1zod_A          195 LIDRQSSGNLAAFIA-EPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFAC-QR-DGVTPD----I  267 (433)
T ss_dssp             HHHHHCCSCEEEEEE-CSEETTTTCEECCTTHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSTH-HH-HTCCCS----E
T ss_pred             HHHHHCCCCCCCEEE-CCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCC-CC-CCCCCC----H
T ss_conf             877514665443244-4322678876799999999999997648579843511267566687655-56-898876----3


Q ss_pred             EECCHHCCCCCCCCHHHHHHHHHHHHHHHHH--HHCCCCHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5040010463112114332589999999875--203676124579999999856--525899999999999999999997
Q T0591           248 MGPSKTESLSGYRLGVAFGSRAIIARMEKLQ--AIVSLRAAGYSQAVLRGWFDE--APGWMEDRIARHQAIRDELLHVLR  323 (406)
Q Consensus       248 ~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~--~~~~~~~~~~~q~a~~~~l~~--~~~~~~~~~~~~~~~r~~l~~~L~  323 (406)
                      ..++|.++ .|+-++.+++.++++..+..-.  ...+.+.+.+...++.+.++.  .+...++....-+..++.+.+.+.
T Consensus       268 ~~~gK~l~-~G~p~~av~~~~~~~~~~~~~~~~~~~T~~~~p~~~aaa~~~l~~~~~~~~~~~~~~~g~~l~~~l~~~~~  346 (433)
T 1zod_A          268 LTLSKTLG-AGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLME  346 (433)
T ss_dssp             EEECHHHH-TTSSCEEEEECHHHHHHHHHTTCCCCCTTTTCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HCCCCCCC-CCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             10344345-66532204553102223454333346776777406678777657652003556677765568888766665


Q ss_pred             HCCCCEEECCCCCEEEEEECC---CC----CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--ECCCHHHHHHHH
Q ss_conf             279945535887307877668---87----889899999999868918961610267999858998--509979999999
Q T0591           324 GCEGVFARTPQAGSYLFPRLP---KL----AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FSQDHEAAVAAA  394 (406)
Q Consensus       324 ~~~g~~~~~p~gg~~~w~~~~---~~----~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~~~~e~l~~al  394 (406)
                      +.+.+.-....|.++- +.+.   ..    ......+.+.++ +.|+...  ........+.+|++  +..+++++++++
T Consensus       347 ~~~~v~~vrG~Glm~~-ie~~~d~~~~~~~~~~~~~l~~~~~-~~gl~~~--~~~~~~~~~~i~~~PpL~it~~eid~~~  422 (433)
T 1zod_A          347 RFDCIGDVRGRGLLLG-VEIVKDRRTKEPADGLGAKITRECM-NLGLSMN--IVQLPGMGGVFRIAPPLTVSEDEIDLGL  422 (433)
T ss_dssp             HCTTEEEEEEETTEEE-EEEEEETTTTEECTTHHHHHHHHHH-HTTEECC--EECCTTSCCEEEECCCTTCCHHHHHHHH
T ss_pred             CCCCEEEEEECCEEEE-EEEECCCCCCCCCHHHHHHHHHHHH-HHCCHHC--EEEECCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             0897478872141899-9992377656723899999999999-8472107--0640689998999799788999999999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999998
Q T0591           395 RRIVTLVER  403 (406)
Q Consensus       395 ~rl~~~~~~  403 (406)
                      ++|.+.+++
T Consensus       423 ~~l~~al~~  431 (433)
T 1zod_A          423 SLLGQAIER  431 (433)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
T ss_conf             999999998


No 152
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3
Probab=99.65  E-value=4.3e-13  Score=106.42  Aligned_cols=215  Identities=18%  Similarity=0.155  Sum_probs=137.8

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHH----HHHCCEEEEEEECCC
Q ss_conf             9999999999864886788670788248727899999999720010101310551389999----982996999860446
Q T0591            82 IRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLV----EFFEGEMVPVQLDYV  157 (406)
Q Consensus        82 Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~----~~~g~~~v~v~~~~~  157 (406)
                      |.+.+|..    .|.    + ..++++.+..|+..++.++++|||+|++..+.|..-...+    ...|.++..+.    
T Consensus         3 LE~~la~L----eg~----~-~a~~~sSGmaAi~~~l~~ll~~Gd~vv~~~~~Yg~T~~l~~~~l~~~Gi~~~~~d----   69 (331)
T 1pff_A            3 LEGKIAKL----EHA----E-ACAATASGMGAIAASVWTFLKAGDHLISDDCLYGCTHALFEHQLRKFGVEVDFID----   69 (331)
T ss_dssp             HHHHHHHH----HTC----S-EEEEESSHHHHHHHHHHHHCCTTCEEEEESCCCHHHHHHHHTHHHHTTCEEEEEC----
T ss_pred             HHHHHHHH----HCC----C-EEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCEEEEEEC----
T ss_conf             89999998----599----8-6999667899999999997299999999289801699999999876486899955----


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHH-HHHCCCEEEECCCCCCCCCCCCCCCCHHHH
Q ss_conf             6677666778899999850254034215666432334437899999999-863787578417502355688876522332
Q T0591           158 SADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAAL-AARYGATVIADQLYSRLRYAGASYTHLRAE  236 (406)
Q Consensus       158 ~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~-a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~  236 (406)
                             .-|++.+++++++++|++++.+|.||+-.+..   ++.++++ ++++++++|+|+.+....+-    .++ ..
T Consensus        70 -------~~d~~~~~~~i~~~t~~i~~Es~~np~l~v~d---l~~~~~~~a~~~~~~~vvDnT~atp~~~----~Pl-~~  134 (331)
T 1pff_A           70 -------MAVPGNIEKHLKPNTRIVYFETPANPTLKVID---IEDAVKQARKQKDILVIVDNTFASPILT----NPL-DL  134 (331)
T ss_dssp             -------TTSTTHHHHTCCTTEEEEEEESSCTTTCCCCC---HHHHHHHHTTSSSCEEEEECTTTHHHHC----CGG-GG
T ss_pred             -------CCCHHHHHHHHHCCCEEEEECCCCCCCCCCCC---HHHHHHHHHCCCCCEEEEECEEECCCCC----CCC-CC
T ss_conf             -------68979999986138718984267787763121---4666666540378489985749875314----665-24


Q ss_pred             HCCCCCCEEEEEECCHHCCCCC-CCCHHHHHHHHHHHHHHHH--HHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             1026786899850400104631-1211433258999999987--520367612457999999985652589999999999
Q T0591           237 AAVDAENVVTIMGPSKTESLSG-YRLGVAFGSRAIIARMEKL--QAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQA  313 (406)
Q Consensus       237 ~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~~~~~~i~~l~~~--~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~  313 (406)
                      + .|    |+++|.||.++-.+ .=.|.++++++........  +.......+...   +..++. +-+-+..+.++..+
T Consensus       135 G-aD----ivv~S~TKy~~Gh~d~~~G~v~~~~~~~~~~~~~~~~~~~G~~l~p~d---a~ll~r-gl~Tl~~Rm~~~~~  205 (331)
T 1pff_A          135 G-VD----IVVHSATKYINGHTDVVAGLVCSRADIIAKVKSQGIKDITGAIISPHD---AWLITR-GTLTLDMRVKRAAE  205 (331)
T ss_dssp             T-CS----EEEEETTTTTSSSSSCCCEEEEECHHHHHHHHHTCCCCCCCCCCCHHH---HHHHHH-HHHHHHHHHHHHHH
T ss_pred             C-CC----EEEEECCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHH---HHHHHC-CCHHHHHHHHHHHH
T ss_conf             7-87----798604356448987767743333056899986420103688689899---999974-55288899999999


Q ss_pred             HHHHHHHHHHHCCCCE-EECC
Q ss_conf             9999999997279945-5358
Q T0591           314 IRDELLHVLRGCEGVF-ARTP  333 (406)
Q Consensus       314 ~r~~l~~~L~~~~g~~-~~~p  333 (406)
                      +...+.+.|++.+.+. +..|
T Consensus       206 nA~~lA~~L~~hp~V~~V~yP  226 (331)
T 1pff_A          206 NAQKVAEFLHEHKAVKKVYYP  226 (331)
T ss_dssp             HHHHHHHHHHHCTTCCCEECT
T ss_pred             HHHHHHHHHHHCCCEEECCCC
T ss_conf             999999978758984341168


No 153
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent enzyme, lyase, cytoplasm, acid resistance; HET: LLP; 2.4A {Escherichia coli}
Probab=99.65  E-value=4.6e-13  Score=106.23  Aligned_cols=162  Identities=13%  Similarity=0.080  Sum_probs=110.3

Q ss_pred             HHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCC----CC
Q ss_conf             99999864886788670788248727899999999720010101310551389999982996999860446667----76
Q T0591            87 APRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSAD----ET  162 (406)
Q Consensus        87 a~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~----~~  162 (406)
                      -+...+.+|.+    .-.+++||++.+...++.+++.|||.|+++.-|+-+....+.+.|++++++........    -.
T Consensus       211 E~~aA~~fGAd----~t~fvvNGTS~~N~avi~a~~~pGD~VlvdRn~HkSv~~gl~lsGA~Pvyl~p~~n~~giig~i~  286 (755)
T 2vyc_A          211 EKYAARVFGAD----RSWSVVVGTSGSNRTIMQACMTDNDVVVVDRNCHKSIEQGLMLTGAKPVYMVPSRNRYGIIGPIY  286 (755)
T ss_dssp             HHHHHHHHTCS----EEEEESSHHHHHHHHHHHHHCCTTCEEEEESSCCHHHHHHHHHHCCEEEEECCCBCTTSCBCCCC
T ss_pred             HHHHHHHHCCC----CEEEECCHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC
T ss_conf             99999982999----17998787899999999973899898997773399999999987997999478445555637777


Q ss_pred             CCCCCHHHHHHHHCCC----------CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC-CCCCCCCCCC
Q ss_conf             6677889999985025----------4034215666432334437899999999863787578417502-3556888765
Q T0591           163 RAGLDLTGLEEAFKAG----------ARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYS-RLRYAGASYT  231 (406)
Q Consensus       163 ~~~~d~~~l~~~~~~~----------~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~-~l~~~~~~~~  231 (406)
                      ...++.+.+++.+...          ++++++++|+= .|.+++   +++|+++|++++..|++||+++ ++.|.+.-..
T Consensus       287 ~~~~~~e~i~~~I~~~p~~k~~~~~~~~~vvit~~TY-dG~~~d---l~~I~~l~~~~~~~LlvDEAhga~~~f~p~~~~  362 (755)
T 2vyc_A          287 PQEMQPETLQKKISESPLTKDKAGQKPSYCVVTNCTY-DGVCYN---AKEAQDLLEKTSDRLHFDEAWYGYARFNPIYAD  362 (755)
T ss_dssp             GGGGSHHHHHHHHHHCTTTGGGTTCCCSCEEEESSCT-TSEEEC---HHHHHHHHTTTCSEEEEECTTCTTGGGCGGGTT
T ss_pred             CCCCCHHHHHHHHHHCCHHHHHCCCCCEEEEEECCCC-CCCCCC---HHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC
T ss_conf             2438999999999858033444147872999957865-874169---999999998629959983332133434788730


Q ss_pred             CHH---HHHCCCCCCEEEEEECCHHCCC
Q ss_conf             223---3210267868998504001046
Q T0591           232 HLR---AEAAVDAENVVTIMGPSKTESL  256 (406)
Q Consensus       232 ~~~---~~~~~~~~~~i~~~S~SK~~~~  256 (406)
                      +..   .....+....+++.|++|.++.
T Consensus       363 ~~~~~g~~~~~~~~~~ivtqS~HK~L~a  390 (755)
T 2vyc_A          363 HYAMRGEPGDHNGPTVFATHSTHKLLNA  390 (755)
T ss_dssp             SSSSCSCCCCCSSBEEEEEEETTTSSSC
T ss_pred             HHHCCCCCCCCCCCEEEEEEECCCCCCC
T ss_conf             1102588531347704999856656656


No 154
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3
Probab=99.65  E-value=9.1e-13  Score=104.22  Aligned_cols=219  Identities=14%  Similarity=0.163  Sum_probs=140.9

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHH----
Q ss_conf             8888788889889999999999864886788670788248727899999999720010101310551389999982----
Q T0591            70 VQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFF----  145 (406)
Q Consensus        70 ~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~~~~----  145 (406)
                      .+.|+-. |.|. .+++.+.+....|.    ++ .++++++..++.. +..++.+||+|++....|......+...    
T Consensus        46 ~~~YsR~-~nPT-~~~lE~~la~LEg~----~~-a~~~sSGmAAi~~-~l~~l~~gd~iv~~~~~Yg~t~~~~~~~l~~~  117 (393)
T 1n8p_A           46 TYEYSRS-QNPN-RENLERAVAALENA----QY-GLAFSSGSATTAT-ILQSLPQGSHAVSIGDVYGGTHRYFTKVANAH  117 (393)
T ss_dssp             SCCBTTT-CCHH-HHHHHHHHHHHTTC----SE-EEEESCHHHHHHH-HHHTSCSSCEEEEESSCCHHHHHHHHHTSTTT
T ss_pred             CEEEECC-CCHH-HHHHHHHHHHHHCC----CE-EEECCCHHHHHHH-HHHCCCCCCEEEEEECCCCCCHHHHHHHHHCC
T ss_conf             7356489-9878-99999999998399----62-7753776789999-97325899979997045565213444444117


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHH----CCCEEEECCCCC
Q ss_conf             9969998604466677666778899999850254034215666432334437899999999863----787578417502
Q T0591           146 EGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAAR----YGATVIADQLYS  221 (406)
Q Consensus       146 g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~----~~~~ii~De~Y~  221 (406)
                      |.++..+            -.+.++++++++++||+|++-+|.||+..+..   +++|+++|++    +++++|+|+.+.
T Consensus       118 gi~~~~~------------~~~~~~~~~~i~~~tkli~~EspsNP~l~v~D---i~~ia~~a~~~~~~~~i~lvVDNT~a  182 (393)
T 1n8p_A          118 GVETSFT------------NDLLNDLPQLIKENTKLVWIETPTNPTLKVTD---IQKVADLIKKHAAGQDVILVVDNTFL  182 (393)
T ss_dssp             CSCCEEE------------SSHHHHHHHHSCSSEEEEEECSSCTTTCCCCC---HHHHHHHHHHHTTTTTCEEEEECTTT
T ss_pred             CEEEEEE------------ECCHHHHHHHHCCCCEEEEECCCCCCCCEECC---HHHHHHHHHHCCCCCCCEEEEECCCC
T ss_conf             4499998------------35868999873778608992168995444233---46656554311235784699956544


Q ss_pred             CCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCC-CCCHHHH-HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC
Q ss_conf             3556888765223321026786899850400104631-1211433-2589999999875203676124579999999856
Q T0591           222 RLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSG-YRLGVAF-GSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDE  299 (406)
Q Consensus       222 ~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G-lRiG~~~-~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l~~  299 (406)
                      --.+    ..++ ..+ .|    |+++|++|.++-.| .=.|.++ .++++.+.++..+.......++.....+..-+  
T Consensus       183 tP~~----~~Pl-~~G-aD----iVvhS~TKyi~GhsDvl~G~vv~~~~~~~~~l~~~~~~~G~~~~p~~a~ll~rgl--  250 (393)
T 1n8p_A          183 SPYI----SNPL-NFG-AD----IVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIGAIPSPFDAWLTHRGL--  250 (393)
T ss_dssp             HHHH----CCGG-GGT-CS----EEEEETTTTTTCSSCCCCEEEEESCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH--
T ss_pred             CCCC----CCCC-CCC-CC----EEEEECCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHCCCCCCHHHHHHHHCCC--
T ss_conf             6145----8742-128-98----9997155101688864264220564779999999987437879979999997368--


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             52589999999999999999999727
Q T0591           300 APGWMEDRIARHQAIRDELLHVLRGC  325 (406)
Q Consensus       300 ~~~~~~~~~~~~~~~r~~l~~~L~~~  325 (406)
                        +-+..+.++..++...+.+.|...
T Consensus       251 --~Tl~lR~~~~~~nA~~lA~~L~~~  274 (393)
T 1n8p_A          251 --KTLHLRVRQAALSANKIAEFLAAD  274 (393)
T ss_dssp             --TTHHHHHHHHHHHHHHHHHHHTSC
T ss_pred             --CHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             --705689999999999999999856


No 155
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster}
Probab=99.63  E-value=9.9e-12  Score=97.18  Aligned_cols=322  Identities=10%  Similarity=0.070  Sum_probs=181.0

Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCC------CCCEEEEECCCCHHHHHHHHHHHH----------C-----
Q ss_conf             8087888878888988999999999986488678------867078824872789999999972----------0-----
Q T0591            66 QSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVD------ARDGLIITPGTQGALFLAVAATVA----------R-----  124 (406)
Q Consensus        66 ~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~------~~~~I~it~G~~~~l~~~~~~l~~----------p-----  124 (406)
                      .+.....|..+.....+-+.+.+|+.+..|.+.+      +...-++|+|++++...++.+--+          +     
T Consensus        98 ~n~n~~~~~~sp~~t~~E~~v~~wl~~l~g~p~~~~~~~~~~~~g~~t~Ggs~anl~al~~AR~~~~~~~~~~~~~~~~~  177 (475)
T 3k40_A           98 IACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEH  177 (475)
T ss_dssp             HCCCSSSCCCCHHHHHHHHHHHHHHHHHTTCCGGGCGGGTSSCEEEEESCHHHHHHHHHHHHHHHHHHHHHHHCTTSCHH
T ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             36764242447632899999999999985697676356888777731678999999999999999878865318663222


Q ss_pred             ---CH-HHHHHHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCC----C--CEEEECCCCCCCCCCC
Q ss_conf             ---01-010131055138999998299699986044666776667788999998502----5--4034215666432334
Q T0591           125 ---GD-KVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKA----G--ARVFLFSNPNNPAGVV  194 (406)
Q Consensus       125 ---Gd-~Vl~~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~----~--~k~i~l~~P~NPTG~~  194 (406)
                         +. .|++.+-++++....+...|.....++.       .++.+|++.|++.+.+    +  +-+++.+-..-.||.+
T Consensus       178 ~~~~~~vv~~S~~aH~Sv~Kaa~~lGi~~~~~~~-------~~~~md~~~L~~~i~~~~~~g~~p~~vvataGTT~tGai  250 (475)
T 3k40_A          178 TILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQS-------ENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAF  250 (475)
T ss_dssp             HHHHHEEEEEETTSCHHHHHHHHHHTCEEEEECC-------BTTBCCHHHHHHHHHHHHHTTCEEEEEEEEBSCTTTCCB
T ss_pred             CCCCCEEEEECHHHHHHHHHHHHHCCCCEEECCC-------CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCC
T ss_conf             4667669997333389999999867971450458-------887567899999999877469975377731587667543


Q ss_pred             CCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHH-HHHH-HH
Q ss_conf             437899999999863787578417502355688876522332102678689985040010463112114332-5899-99
Q T0591           195 YSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFG-SRAI-IA  272 (406)
Q Consensus       195 ~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~-~~~~-i~  272 (406)
                         +.+.+|.++|++|++|+-+|-+|+.+..--.....+.  .....-..| ...++|.+++| .=+|++.. ++.. ..
T Consensus       251 ---D~l~~I~~i~~~~~~wlHVDaA~Gg~~~~~~~~r~~~--~gi~~aDSi-t~d~HK~l~~P-~~~~~~l~rd~~~~~~  323 (475)
T 3k40_A          251 ---DYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLM--KGIESADSF-NFNPHKWMLVN-FDCSAMWLKDPSWVVN  323 (475)
T ss_dssp             ---CCHHHHHHHHHHTTCEEEEECTTGGGGGGSGGGGGGG--TTGGGCSEE-EECHHHHSSCC-SSCEEEEESSGGGC--
T ss_pred             ---CCHHHHHHHHHHCCCEEEEEHHHHHHHHHCCCCHHHH--CCCCHHEEE-EECCCCCCCCC-CCCEEEEECCHHHHHH
T ss_conf             ---7599999999874864997023157776401014654--388611055-55630113567-6641567437888767


Q ss_pred             HHHH----HH----------HHCCCCHHHHHHH--HHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECC-CC
Q ss_conf             9998----75----------2036761245799--999998565258999999999999999999972799455358-87
Q T0591           273 RMEK----LQ----------AIVSLRAAGYSQA--VLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTP-QA  335 (406)
Q Consensus       273 ~l~~----~~----------~~~~~~~~~~~q~--a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p-~g  335 (406)
                      .+..    +.          ...++..+.....  ....+..-+..-.++...+..+..+.+.+.|.+.+++++..| +-
T Consensus       324 ~~~~~~~Yl~~~~~~~~~~~~~~~~~~sR~~~al~lw~~l~~~G~~g~~~~i~~~~~~A~~l~~~l~~~~~fel~~~~~~  403 (475)
T 3k40_A          324 AFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINM  403 (475)
T ss_dssp             -------------------------CCCGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTEEESSCCBT
T ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCE
T ss_conf             62267121065533566673334642365236899998874307688999999999999999999835999799679855


Q ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC---CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             3078776688788989999999986891896161026799985899850---997999999999999999856
Q T0591           336 GSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS---QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       336 g~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~---~~~e~l~~al~rl~~~~~~~r  405 (406)
                      +.-+ .++........++.++|.++-.+.+.+...   .+..++|++++   +++++++..++.|.+..+++.
T Consensus       404 ~iV~-Fr~~~~~~~n~~l~~~l~~~G~~~~s~t~~---~g~~~lR~~i~n~~t~~~did~~~~~i~~~a~~l~  472 (475)
T 3k40_A          404 GLVC-FRLKGSNERNEALLKRINGRGHIHLVPAKI---KDVYFLRMAICSRFTQSEDMEYSWKEVSAAADEME  472 (475)
T ss_dssp             TEEE-EEESSCHHHHHHHHHHHHHHTSCBCEEEEE---TTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEE-EEECCCCHHHHHHHHHHHHCCCEEEEEEEE---CCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             7999-982698588999999998459899830259---99989999968999999999999999999999998


No 156
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix K1} PDB: 2zsl_A* 2zsm_A*
Probab=99.63  E-value=2.8e-13  Score=107.68  Aligned_cols=340  Identities=14%  Similarity=0.111  Sum_probs=184.7

Q ss_pred             CEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHH
Q ss_conf             3341567--86788788899999999998087888878888988999999999986488678867078824872789999
Q T0591            40 PVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLA  117 (406)
Q Consensus        40 ~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~  117 (406)
                      .+|+..|  ...+.+-.|.+.+++.+++.....+.  ...  ..- ...........    .+.+.+..+++++++...+
T Consensus        58 ylD~~sg~~~~~lGh~~p~v~~Ai~~ql~~~~~~~--~~~--~~~-~~~~~~~~~~~----~~~~~v~f~~sGseAve~A  128 (434)
T 2epj_A           58 IVDLVLAYGPLILGHKHPRVLEAVEEALARGWLYG--APG--EAE-VLLAEKILGYV----KRGGMIRFVNSGTEATMTA  128 (434)
T ss_dssp             EEESSGGGTTCTTCBTCHHHHHHHHHHHHTCSCCS--SCC--HHH-HHHHHHHHHHH----CTTCEEEEESSHHHHHHHH
T ss_pred             EEECCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCC--CCC--HHH-HHHHHHHHHHC----CCCCEEEECCCCHHHHHHH
T ss_conf             99867418866417896999999999985456767--863--689-99999754036----8644377427643899999


Q ss_pred             HHHH-HHC-CHHHHHHHCCCHHHHHHHHHH-CCEE--EEEEECCCCC------CCCCCCCCHHHHHHHHCC---CCEEEE
Q ss_conf             9999-720-010101310551389999982-9969--9986044666------776667788999998502---540342
Q T0591           118 VAAT-VAR-GDKVAIVQPDYFANRKLVEFF-EGEM--VPVQLDYVSA------DETRAGLDLTGLEEAFKA---GARVFL  183 (406)
Q Consensus       118 ~~~l-~~p-Gd~Vl~~~P~y~~~~~~~~~~-g~~~--v~v~~~~~~~------~~~~~~~d~~~l~~~~~~---~~k~i~  183 (406)
                      +..- .-. ...|+...-+|++........ +-..  ...|......      ......-|+++|++.+++   ++.+++
T Consensus       129 iklAr~~tgr~~ii~~~~~yHG~t~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~d~~~le~~i~~~~~~iAavI  208 (434)
T 2epj_A          129 IRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAAAHYGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVI  208 (434)
T ss_dssp             HHHHHHHHCCCEEEEEETCCCCSSGGGSEECC------CEESSTTCCHHHHTTEEEEETTCHHHHHHHHHHHGGGEEEEE
T ss_pred             HHHHHHCCCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             99998630897799995777874144653157543346899877877666676405673419999999986799868999


Q ss_pred             CCCCCCC-CCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCC
Q ss_conf             1566643-233-44378999999998637875784175023556888765223321026786899850400104631121
Q T0591           184 FSNPNNP-AGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRL  261 (406)
Q Consensus       184 l~~P~NP-TG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRi  261 (406)
                      + -|=-= .|. ..+++.+++|.++|++||+++|.||++..+. .|.... .. .....||  |+  +++|.++ .|.-+
T Consensus       209 ~-EPi~g~~G~~~p~~~yl~~l~~lc~~~gillI~DEV~tG~r-~G~~~~-~~-~~gv~PD--iv--~~gK~l~-gG~p~  279 (434)
T 2epj_A          209 V-EPVIANAGVIPPRREFLAALQRLSRESGALLILDEVVTGFR-LGLEGA-QG-YFNIEGD--II--VLGKIIG-GGFPV  279 (434)
T ss_dssp             E-CSSBCSSSCBCCCHHHHHHHHHHHHHHTCEEEEEETTTTTT-SSTTHH-HH-HHTCCCS--EE--EEEGGGG-TTSSC
T ss_pred             E-EECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCE-ECCCCC-HH-HHCCCCC--HH--HHHHHCC-CCCCC
T ss_conf             9-50303689526898999999999998698899865545740-036876-24-3098864--75--6535326-99751


Q ss_pred             HHHHHHHHHHHHHHHHH---HHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEECCCC
Q ss_conf             14332589999999875---2036761245799999998565--258999999999999999999972799-45535887
Q T0591           262 GVAFGSRAIIARMEKLQ---AIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCEG-VFARTPQA  335 (406)
Q Consensus       262 G~~~~~~~~i~~l~~~~---~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g-~~~~~p~g  335 (406)
                      |.+++.+++.+.+..-.   ...+++.++++..++.+.|+-.  +..+++.++.-+..++.+.+.+.+... ..+....+
T Consensus       280 ~a~~~~~~i~~~~~~~~~~~~~~T~~g~p~~~aaa~a~L~~i~~~~~~~~~~~~g~~l~~~L~~l~~~~~~~~~v~~~~~  359 (434)
T 2epj_A          280 GAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVES  359 (434)
T ss_dssp             EEEEECHHHHTTBTTTSSBCCCCTTTTCHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHTCCEEEEEETT
T ss_pred             EEEEECHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             21455199998618788764235789984114778999999867189999999999999999999977699975702477


Q ss_pred             --CEEEEEECCCC-----CCC---HHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             --30787766887-----889---8999999998689189616102679998589985099799999999999999985
Q T0591           336 --GSYLFPRLPKL-----AVA---PAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       336 --g~~~w~~~~~~-----~~~---~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~  404 (406)
                        |+++-+++...     ..+   ..+++..++ ++||.+.|+.      ...++.++..+++++++++++|++.+++.
T Consensus       360 ~~gl~~~~e~v~~~~~~~~~d~~~~~~~~~~~~-~~Gv~l~p~~------~~~~~p~l~~t~~~id~~~~~~~~~l~~v  431 (434)
T 2epj_A          360 MMQLFIGVEEVSNAAQARKADKKFYVKLHEEML-RRGVFIAPSN------LEAVFTGLPHQGEALEIAVEGLRSSLKTV  431 (434)
T ss_dssp             EEEEEETCSCCSSHHHHTTSCHHHHHHHHHHHH-HTTEECCSST------TSCEECCTTCSHHHHHHHHHHHHHHHHHH
T ss_pred             CEEEEEEEEECCCHHHHCCCCHHHHHHHHHHHH-HCCEEECCCC------CEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             257999766237867713577999999999999-7996887899------87897468888999999999999999998


No 157
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} PDB: 3bs8_A*
Probab=99.62  E-value=2.1e-13  Score=108.59  Aligned_cols=342  Identities=14%  Similarity=0.088  Sum_probs=192.7

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.||+..|  ...+.+-.|.+.+++.+.+.....+.+     ....+..+++.+....+ .   -+.++.+++++++...
T Consensus        54 ~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~~~~~~~-----~~~~~~~la~~l~~~~~-~---~~~v~f~~sGseAvE~  124 (429)
T 3k28_A           54 EYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGA-----PTEIENKLAKLVIERVP-S---IEIVRMVNSGTEATMS  124 (429)
T ss_dssp             EEEESCGGGTTCTTCBSCHHHHHHHHHHHHHCSCCSS-----CCHHHHHHHHHHHHHST-T---CSEEEEESSHHHHHHH
T ss_pred             EEEEECCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCC-----CHHHHHHHHHHHHHHCC-C---CCEEEECCCCHHHHHH
T ss_conf             9998440787506787979999999999974676667-----60478999999986488-7---7669861884389999


Q ss_pred             HHHHHH-HCC-HHHHHHHCCCHHHHHHH-HHHCC--EEEEEEECCCC------CCCCCCCCCHHHHHHHH---CCCCEEE
Q ss_conf             999997-200-10101310551389999-98299--69998604466------67766677889999985---0254034
Q T0591           117 AVAATV-ARG-DKVAIVQPDYFANRKLV-EFFEG--EMVPVQLDYVS------ADETRAGLDLTGLEEAF---KAGARVF  182 (406)
Q Consensus       117 ~~~~l~-~pG-d~Vl~~~P~y~~~~~~~-~~~g~--~~v~v~~~~~~------~~~~~~~~d~~~l~~~~---~~~~k~i  182 (406)
                      ++..-- -.| ..|+....+|++..... ...+-  ...+.|.....      .......-+++.+++..   .+++.++
T Consensus       125 AlKlAr~~tgr~~il~~~~~yHG~t~~~~~~t~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iaav  204 (429)
T 3k28_A          125 ALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIACV  204 (429)
T ss_dssp             HHHHHHHHHTCCEEEEEETCCCCSCGGGCSSCCTTC-----CCCTTCCHHHHTTEEEEETTCHHHHHHHHHHHGGGEEEE
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEE
T ss_conf             99999870389859999798179868899844576434699999999887577764301224877678998548864389


Q ss_pred             ECCCC-CCCCC-CCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCC
Q ss_conf             21566-64323-34437899999999863787578417502355688876522332102678689985040010463112
Q T0591           183 LFSNP-NNPAG-VVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYR  260 (406)
Q Consensus       183 ~l~~P-~NPTG-~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlR  260 (406)
                      ++. | ..-.| ...+++.+++|.++|++||+++|.||++..+... .-+  ........||  |+  .++|.++ .|+-
T Consensus       205 i~E-Pi~g~~G~~~~~~~yl~~lr~lc~~~gillI~DEV~tG~gr~-~~~--a~~~~~v~PD--iv--~~gK~lg-gG~p  275 (429)
T 3k28_A          205 IVE-PVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVA-YNC--GQGYYGVTPD--LT--CLGKVIG-GGLP  275 (429)
T ss_dssp             EEC-SSBCTTSCBCCCTTHHHHHHHHHHHHTCEEEEECTTTTTTSS-TTH--HHHHHTCCCS--EE--EECGGGG-TTSC
T ss_pred             EEC-CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCC-CCC--CCCCCCCCCC--EE--EEEEECC-CCCC
T ss_conf             977-313788865789899999999999829899981465445643-335--5101598986--68--8834515-8774


Q ss_pred             CHHHHHHHHHHHHHHHH---HHHCCCCHHHHHHHHHHHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCC
Q ss_conf             11433258999999987---5203676124579999999856525-8999999999999999999972799455358873
Q T0591           261 LGVAFGSRAIIARMEKL---QAIVSLRAAGYSQAVLRGWFDEAPG-WMEDRIARHQAIRDELLHVLRGCEGVFARTPQAG  336 (406)
Q Consensus       261 iG~~~~~~~~i~~l~~~---~~~~~~~~~~~~q~a~~~~l~~~~~-~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~gg  336 (406)
                      ++.+++.+++.+.+..-   ....+++.+.+...++.+.|+..++ .+.+....-...++.+.+.+.+.+-+...... |
T Consensus       276 ~~av~~~~ei~~~~~~~~~~~~~~T~~gnpl~~aaa~a~L~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~i~~VrG~-G  354 (429)
T 3k28_A          276 VGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRA-G  354 (429)
T ss_dssp             CEEEEECHHHHTTBTTTSSBCCCCTTTTCHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCCEEEEE-T
T ss_pred             CEEEEEHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE-C
T ss_conf             401445799999743247775357888786999999999999743426889999999999999999758997699624-6


Q ss_pred             EEEEEECCCCCC---------CH---HHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             078776688788---------98---999999998689189616102679998589985099799999999999999985
Q T0591           337 SYLFPRLPKLAV---------AP---AEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       337 ~~~w~~~~~~~~---------~~---~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      +++-+.+.+...         +.   ..++..++ ++||.+.|+. +     ..+.++++.+++++++++++|.++++++
T Consensus       355 l~~~ie~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~Gv~l~p~~-~-----~~~~~~l~it~~~id~~~~~l~~al~~l  427 (429)
T 3k28_A          355 SMIGIFFTDEPVINYDAAKSSNLQFFAAYYREMV-EQGVFLPPSQ-F-----EGLFLSTVHSDADIEATIAAAEIAMSKL  427 (429)
T ss_dssp             TEEEEESSSSCCCSHHHHTTSCHHHHHHHHHHHH-HTTEECCSST-T-----SCBCCCTTCCHHHHHHHHHHHHHHHHTC
T ss_pred             CEEEEEEECCCCCCHHHHHCCCHHHHHHHHHHHH-HCCEEECCCC-C-----EEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             2899998368777867760254999999999999-7998977888-7-----1076677787999999999999999985


Q ss_pred             CC
Q ss_conf             69
Q T0591           405 RA  406 (406)
Q Consensus       405 ra  406 (406)
                      ||
T Consensus       428 kA  429 (429)
T 3k28_A          428 KA  429 (429)
T ss_dssp             C-
T ss_pred             CC
T ss_conf             59


No 158
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.30A {Pseudomonas stutzeri}
Probab=99.62  E-value=5.8e-12  Score=98.76  Aligned_cols=338  Identities=17%  Similarity=0.162  Sum_probs=184.3

Q ss_pred             CEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHH
Q ss_conf             3341567--86788788899999999998087888878888988999999999986488678867078824872789999
Q T0591            40 PVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLA  117 (406)
Q Consensus        40 ~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~  117 (406)
                      .|||..|  ...+.+-.|.+.+++.+++......  ...  . ......++.+.....    ..+.++.+++++++...+
T Consensus        59 ylD~~~g~~~~~lGh~~p~v~~A~~~ql~~~~~~--~~~--~-~~~~~~~~~~~~~~~----~~~~~~~~~sg~eA~~~A  129 (453)
T 2cy8_A           59 YLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQY--AAS--H-PLEVRWAERIVAAFP----SIRKLRFTGSGTETTLLA  129 (453)
T ss_dssp             EEESCTTTTSCTTCBTCHHHHHHHHHHHTTTCSS--CSS--C-HHHHHHHHHHHHHCT----TCSEEEEESCHHHHHHHH
T ss_pred             EEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCC--CCC--C-CHHHHHHHHHHHHCC----CCHHHCCCCCCCCHHHHH
T ss_conf             9983632887855689899999999999745674--545--3-202444555542001----110100133333111111


Q ss_pred             HHHH-HHCC-HHHHHHHCCCHHHHHHHHH-HCCEEE------EEEECCCCCCCCCCCCCHHHHHHHHCC---CCEEEECC
Q ss_conf             9999-7200-1010131055138999998-299699------986044666776667788999998502---54034215
Q T0591           118 VAAT-VARG-DKVAIVQPDYFANRKLVEF-FEGEMV------PVQLDYVSADETRAGLDLTGLEEAFKA---GARVFLFS  185 (406)
Q Consensus       118 ~~~l-~~pG-d~Vl~~~P~y~~~~~~~~~-~g~~~v------~v~~~~~~~~~~~~~~d~~~l~~~~~~---~~k~i~l~  185 (406)
                      +... ...| ..|+...-.|+++...... .+....      ..+.... ....-..-|++.+++.+..   ++.++++ 
T Consensus       130 ~~~ar~~t~r~~i~~~~~~yHG~t~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~d~~~l~~~l~~~~~~iaavi~-  207 (453)
T 2cy8_A          130 LRVARAFTGRRMILRFEGHYHGWHDFSASGYNSHFDGQPAPGVLPETTA-NTLLIRPDDIEGMREVFANHGSDIAAFIA-  207 (453)
T ss_dssp             HHHHHHHHCCCEEEEECC----------------------------CGG-GEEEECTTCHHHHHHHHHHHGGGEEEEEE-
T ss_pred             CCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCHHHHHHHHHHHHCCCCEEEEEE-
T ss_conf             0101245431038743113467432100145776455777666674344-45455612179999999847898689999-


Q ss_pred             CCCCC-CC-CCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHH
Q ss_conf             66643-23-34437899999999863787578417502355688876522332102678689985040010463112114
Q T0591           186 NPNNP-AG-VVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGV  263 (406)
Q Consensus       186 ~P~NP-TG-~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~  263 (406)
                      -|-.. .| ...+++.+++|.++|++||+++|.||++..+...+ .+.  .......||  |  -+++|.++ .|+-+|.
T Consensus       208 Epi~g~~G~~~p~~~~l~~lr~lc~~~~illI~DEV~tG~r~~~-~fa--~~~~~v~PD--i--vt~gK~lg-G~~P~~a  279 (453)
T 2cy8_A          208 EPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGFRVGN-HGM--QALLDVQPD--L--TCLAKASA-GGLPGGI  279 (453)
T ss_dssp             CSSEHHHHTEECCHHHHHHHHHHHHHTTCEEEEECTTTTTTTCT-THH--HHHHTCCCS--E--EEEEGGGG-TTSSCEE
T ss_pred             ECCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEECCCCCCEEEE-CCC--CCCEEEEEC--C--CCCCCCCC-CCCCCCC
T ss_conf             60344468522563100223323321152034200044303420-366--521047421--2--01334566-6432311


Q ss_pred             HHHHHHHHHHHHH-----HHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEECCCC
Q ss_conf             3325899999998-----752036761245799999998565--25899999999999999999997279-945535887
Q T0591           264 AFGSRAIIARMEK-----LQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDELLHVLRGCE-GVFARTPQA  335 (406)
Q Consensus       264 ~~~~~~~i~~l~~-----~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~-g~~~~~p~g  335 (406)
                      +++.+++++.+..     +....+++.++++..++.+.|+.-  +...++..+.-+..++.|.+...+.+ -+.+...-.
T Consensus       280 v~~~~~i~~~~~~~~~~~~~h~~T~~g~p~~~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~i~~~~~g~~~  359 (453)
T 2cy8_A          280 LGGREDVMGVLSRGSDRKVLHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFS  359 (453)
T ss_dssp             EEECHHHHTTSSSCC---------CCCCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHTTCCEEEECCTT
T ss_pred             CCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEE
T ss_conf             13330244454330243443334543211120334444312101015677887548999999999987499706998778


Q ss_pred             CEEEEEECCCC------------CCCHH----HHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHH
Q ss_conf             30787766887------------88989----999999986891896161026799985899850997999999999999
Q T0591           336 GSYLFPRLPKL------------AVAPA----EFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVT  399 (406)
Q Consensus       336 g~~~w~~~~~~------------~~~~~----~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~  399 (406)
                      |+.++..++..            ...+.    .+...++ +.||.+.|.        +.+.+++..++++++++++++.+
T Consensus       360 G~gl~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll-~~Gv~~~~~--------~~~~~s~~~teedId~~~~al~~  430 (453)
T 2cy8_A          360 GFHLMPGLPPNTTDTGSITRAEVARPDVKMIAAMRMALI-LEGVDIGGR--------GSVFLSAQHEREHVEHLVTTFDR  430 (453)
T ss_dssp             EEEEEETSCTTCCCCHHHHTTCSCCCCHHHHHHHHHHHH-HTTEECBTT--------TEEECCTTCCHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCCCCCCCCHHHHHCCHHHHHHHHHHHHH-HCCCEECCC--------CCEEEECCCCHHHHHHHHHHHHH
T ss_conf             777885365345654433368773220999999999999-779288777--------88575089989999999999999


Q ss_pred             HHHHHC
Q ss_conf             999856
Q T0591           400 LVERYR  405 (406)
Q Consensus       400 ~~~~~r  405 (406)
                      ++++++
T Consensus       431 al~~l~  436 (453)
T 2cy8_A          431 VLDRLA  436 (453)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
T ss_conf             999999


No 159
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* 2vmr_A* 2vms_A* 2vmt_A* 2vmu_A* 2vmq_A* ...
Probab=99.62  E-value=3.4e-13  Score=107.11  Aligned_cols=335  Identities=15%  Similarity=0.105  Sum_probs=204.4

Q ss_pred             CEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC---CCCH--HHHHHHH-HHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             3341567867887888999999999980878888788---8898--8999999-99998648867886707882487278
Q T0591            40 PVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEY---RGDL--GIRDLLA-PRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        40 ~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~---~G~~--~Lr~aia-~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      -|+|-..+   ...+|.+.+++...+...-.-+|+..   .|..  +-.|.+| +..++.+|...   -+|=..+| +.+
T Consensus        25 ~l~LiaSE---N~~S~~v~~a~~S~l~nkYaeG~pg~ryy~G~~~id~iE~la~~ra~~lF~a~~---anvqp~SG-s~A   97 (405)
T 2vi8_A           25 KIELIASE---NFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEH---ANVQPHSG-AQA   97 (405)
T ss_dssp             SEECCTTC---CCCCHHHHHHHTSGGGGCCCCEETTEESSSCCHHHHHHHHHHHHHHHHHHTCSE---EECCCSSH-HHH
T ss_pred             CCEEECCC---CCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC---CCCCCCCC-HHH
T ss_conf             93587278---757899999855742476768899834337762499999999999999818985---55446763-788


Q ss_pred             HHHHHHHHHHCCHHHHHHHCCCHHHHH-----HHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CCCEEEECCCC
Q ss_conf             999999997200101013105513899-----999829969998604466677666778899999850-25403421566
Q T0591           114 LFLAVAATVARGDKVAIVQPDYFANRK-----LVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AGARVFLFSNP  187 (406)
Q Consensus       114 l~~~~~~l~~pGd~Vl~~~P~y~~~~~-----~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~~P  187 (406)
                      ...++.++++|||+|+..++...+|..     .......+.++++++     ...+.+|.+++++..+ .++|+|++..-
T Consensus        98 n~av~~all~pGD~im~l~l~~GGHlshg~~~~~~g~~~~~~~y~~d-----~~~~~iD~d~~~~~a~~~kPklIi~G~S  172 (405)
T 2vi8_A           98 NMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVD-----PETHVIDYDDVREKARLHRPKLIVAAAA  172 (405)
T ss_dssp             HHHHHHHHCCTTCEEEEECGGGTCCTTTTCTTSHHHHHSEEEEECBC-----TTTCSBCHHHHHHHHHHHCCSEEEECCS
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEEECCCC-----CCCCEECHHHHHHHHHHCCCCEEEECCC
T ss_conf             99999986079987998415778733455545555457886765555-----4558362899999998439845763134


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC-CCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHH
Q ss_conf             6432334437899999999863787578417502-355688876522332102678689985040010463112114332
Q T0591           188 NNPAGVVYSAEEIGQIAALAARYGATVIADQLYS-RLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFG  266 (406)
Q Consensus       188 ~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~-~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~  266 (406)
                      ..|-     .-+++++.++|++.|.+++.|-++- .|+-.|.-+.++..  + |    |+..|..|+|  +|-|-|.+..
T Consensus       173 ~y~~-----~~d~~~~~eiad~vga~l~~D~sHi~GLIa~g~~~~Pl~~--a-d----vvt~sTHKTl--~GPrgGiI~~  238 (405)
T 2vi8_A          173 AYPR-----IIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPY--A-H----FVTTTTHKTL--RGPRGGMILC  238 (405)
T ss_dssp             SCCS-----CCCHHHHHHHHHHHTCEEEEECTTTHHHHHTTSSCCSTTT--C-S----EEEEESSSTT--CCCSCEEEEE
T ss_pred             CCCC-----CCCHHHHHHHHHHHCCEEEEEHHHHHHHHHHHHCCCHHHH--H-C----CEECCCCCCC--CCCCCCEEEE
T ss_conf             6888-----7789999999877296987103456665356643997876--1-5----2312125656--6888736885


Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHH-HHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECC-CCCEEEEEEC
Q ss_conf             5899999998752036761245799999-99856-5258999999999999999999972799455358-8730787766
Q T0591           267 SRAIIARMEKLQAIVSLRAAGYSQAVLR-GWFDE-APGWMEDRIARHQAIRDELLHVLRGCEGVFARTP-QAGSYLFPRL  343 (406)
Q Consensus       267 ~~~~i~~l~~~~~~~~~~~~~~~q~a~~-~~l~~-~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p-~gg~~~w~~~  343 (406)
                      .+++.+.+.+.......+.+...+.++. ..+.+ .....++..++..++.+.|.+.|.+. |+.+... .-.-.+|+++
T Consensus       239 ~~~~~~~i~~avfPg~qg~~h~~~iaa~aval~ea~~~~~~~Ya~qvv~NA~aLa~~L~~~-G~~v~~ggTd~H~vlvdl  317 (405)
T 2vi8_A          239 QEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNE-GFTLVSGGTDNHLLLVDL  317 (405)
T ss_dssp             CHHHHHHHHHHHTTTTCSSCCHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHT-TCEEGGGSCSSSEEEEEC
T ss_pred             CCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHC-CCEEECCCCCCCEEEEEC
T ss_conf             5346788886508776677415778999999999718689999999999999999999738-977971898774652002


Q ss_pred             CCCCCCHHHHHHHHHHHCCEEEE----ECCCCCCCCCCEEEEEEC------CCHHHHHHHHHHHHHHHH
Q ss_conf             88788989999999986891896----161026799985899850------997999999999999999
Q T0591           344 PKLAVAPAEFVKILRLQAGVVVT----PGTEFSPHTADSVRLNFS------QDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       344 ~~~~~~~~~~~~~Ll~~~gV~v~----pG~~Fg~~~~~~iRis~~------~~~e~l~~al~rl~~~~~  402 (406)
                      ...+.+..+. +++|++.||.+.    |++.-.+..+.-+||...      ..++++++-.+-|.++++
T Consensus       318 ~~~~~~g~~a-~~~Le~agI~vNkn~iP~d~~~~~~~sGiRiGT~~~T~rG~~e~dm~~iA~~I~~~l~  385 (405)
T 2vi8_A          318 RPQQLTGKTA-EKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLK  385 (405)
T ss_dssp             GGGTCCHHHH-HHHHHHHTEECEEECCTTCSSCTTTCSEEEEECHHHHHTTCCHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCHHHH-HHHHHHCCEEECCCCCCCCCCCCCCCCCEEECCHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             3456739999-9999983928777858899999998872165688998489988999999999999995


No 160
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics, NPPSFA; HET: PLP; 1.15A {Thermus thermophilus HB8}
Probab=99.62  E-value=7.6e-13  Score=104.72  Aligned_cols=337  Identities=16%  Similarity=0.067  Sum_probs=202.1

Q ss_pred             CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCC---CCCCHH--HHHHHH-HHHHHHCCCCCCCCCEEEEECCCCH
Q ss_conf             8334156786788788899999999998087888878---888988--999999-9999864886788670788248727
Q T0591            39 RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTE---YRGDLG--IRDLLA-PRLAAFTGAPVDARDGLIITPGTQG  112 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~---~~G~~~--Lr~aia-~~~~~~~g~~~~~~~~I~it~G~~~  112 (406)
                      .-|+|-..+   ...+|.+.+++...+...-..+|+-   ..|...  -.|.+| +..++.+|...   -+|-..+| +.
T Consensus        24 ~~l~LiaSE---N~~S~~v~~al~S~l~nkYaeG~pg~ryy~G~~~id~iE~la~~ra~~lF~a~~---anVqp~SG-s~   96 (407)
T 2dkj_A           24 EGLELIASE---NFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAW---ANVQPHSG-SQ   96 (407)
T ss_dssp             TSEECCTTC---CCCCHHHHHHHTSGGGGCCCCEETTEESSSCCHHHHHHHHHHHHHHHHHHTCSE---EECCCSSH-HH
T ss_pred             CCCEEECCC---CCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCE---ECCCCCCC-HH
T ss_conf             791587066---658999999861700153768899855556662699999999999999719973---33463233-17


Q ss_pred             HHHHHHHHHHHCCHHHHHHHCCCHHHH-----HHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CCCEEEECCC
Q ss_conf             899999999720010101310551389-----9999829969998604466677666778899999850-2540342156
Q T0591           113 ALFLAVAATVARGDKVAIVQPDYFANR-----KLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AGARVFLFSN  186 (406)
Q Consensus       113 ~l~~~~~~l~~pGd~Vl~~~P~y~~~~-----~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~~  186 (406)
                      +...++.++++|||+|+..++...+|.     ..+.....+.+.++++     .+...+|.+++++..+ .++|+|++-.
T Consensus        97 An~av~~all~pgd~il~~~l~~GGHlshg~~~~~~g~~~~~~~y~~~-----~~~~~IDyd~~~~~a~~~kPklIi~G~  171 (407)
T 2dkj_A           97 ANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVR-----PDTELIDLEEVRRLALEHRPKVIVAGA  171 (407)
T ss_dssp             HHHHHHHHHCCTTCEEEEECGGGTCCGGGTCTTSHHHHHSEEEEECCC-----TTTSSCCHHHHHHHHHHHCCSEEEECC
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEEECCCC-----CCCCCCCHHHHHHHHHHCCCCEEEECC
T ss_conf             999999997389987874156677764446666655415421243666-----667744899999999863999898255


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC-CCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHH
Q ss_conf             66432334437899999999863787578417502-35568887652233210267868998504001046311211433
Q T0591           187 PNNPAGVVYSAEEIGQIAALAARYGATVIADQLYS-RLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAF  265 (406)
Q Consensus       187 P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~-~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~  265 (406)
                      -++|  ..+   +.+++.++|++.|.+++.|-++- .|+-.|.-+.++.  . .|    |+.+|..|+|  +|-|-|.+.
T Consensus       172 S~y~--~~~---d~~~~reiad~vga~l~~D~sH~~GLIa~g~~~~Pl~--~-aD----vvt~sTHKTl--rGPrggiI~  237 (407)
T 2dkj_A          172 SAYP--RFW---DFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLP--Y-AH----VVTSTTHKTL--RGPRGGLIL  237 (407)
T ss_dssp             SSCC--SCC---CHHHHHHHHHHHTCEEEEECTTTHHHHHTTCSCCCTT--T-CS----EEEEESSGGG--CCCSCEEEE
T ss_pred             CCCC--CCC---CHHHHHHHHHHCCCEEECCHHHHHHHHHCCCCCCCCC--C-CC----EEEEECCCCC--CCCCCCCEE
T ss_conf             4565--555---7899998763118578712232444420453688555--5-52----4885334335--688765013


Q ss_pred             HH-HHHHHHHHHHHHHCCCCHHHHHHHHHH-HHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECC-CCCEEEEE
Q ss_conf             25-899999998752036761245799999-998565-258999999999999999999972799455358-87307877
Q T0591           266 GS-RAIIARMEKLQAIVSLRAAGYSQAVLR-GWFDEA-PGWMEDRIARHQAIRDELLHVLRGCEGVFARTP-QAGSYLFP  341 (406)
Q Consensus       266 ~~-~~~i~~l~~~~~~~~~~~~~~~q~a~~-~~l~~~-~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p-~gg~~~w~  341 (406)
                      .. +++.+++.+..-....+.+...+.++. .++.+. ....++..+..-++.+.|.+.|.+. |+.+... .-+-.+|+
T Consensus       238 ~~~~~~~~kI~~avfPg~qggp~~~~iAa~aval~Ea~~~~fk~Ya~qVv~NA~~La~~L~~~-G~~vv~ggTdnH~vlv  316 (407)
T 2dkj_A          238 SNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARR-GYRIVTGGTDNHLFLV  316 (407)
T ss_dssp             ESCHHHHHHHHHHHTTTTCSSCCHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHT-TCEEGGGSCSSSEEEE
T ss_pred             ECCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHC-CCCCCCCCCCCCEEEE
T ss_conf             154789999998618634678527788999987888528789999999999998271278628-9741358887763652


Q ss_pred             ECCCCCCCHHHHHHHHHHHCCEEEE----ECCCCCCCCCCEEEEEEC------CCHHHHHHHHHHHHHHHHH
Q ss_conf             6688788989999999986891896----161026799985899850------9979999999999999998
Q T0591           342 RLPKLAVAPAEFVKILRLQAGVVVT----PGTEFSPHTADSVRLNFS------QDHEAAVAAARRIVTLVER  403 (406)
Q Consensus       342 ~~~~~~~~~~~~~~~Ll~~~gV~v~----pG~~Fg~~~~~~iRis~~------~~~e~l~~al~rl~~~~~~  403 (406)
                      ++...+.++.++. ..|++.||.+.    |++.-.+-.+.-+||...      ..++++++-.+-|.+++.+
T Consensus       317 dl~~~g~~g~~a~-~~Le~agI~vNkn~iP~d~~~~~~~sGiRiGT~a~TtrG~~e~dm~~ia~~i~~~l~~  387 (407)
T 2dkj_A          317 DLRPKGLTGKEAE-ERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLE  387 (407)
T ss_dssp             ECGGGTCCHHHHH-HHHHHTTEECEECCCTTCSSCTTTCSEEEEECHHHHHTTCCGGGHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHH-HHHHHCCEEECCCCCCCCCCCCCCCCCCEECCHHHHHCCCCHHHHHHHHHHHHHHHHC
T ss_conf             1445675199999-9999809387357488999999889740647789985799889999999999999964


No 161
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal- kingston bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori 26695} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A*
Probab=99.61  E-value=7.2e-13  Score=104.91  Aligned_cols=311  Identities=10%  Similarity=0.086  Sum_probs=188.2

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH-HHCCH--HHHH
Q ss_conf             88999999999980878888788889889999999999864886788670788248727899999999-72001--0101
Q T0591            54 TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAAT-VARGD--KVAI  130 (406)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l-~~pGd--~Vl~  130 (406)
                      +....+++.+.+.++... .++  -..+|-+.+|++    +|.     ..++.++.+|.|+.++++++ ..+||  +|++
T Consensus        12 ~~~~~~~v~~~l~~~~~~-~G~--~v~~fE~~~a~~----~g~-----~~ai~~~Sgt~Al~~al~~l~~~~~~~~eVi~   79 (375)
T 2fnu_A           12 DKEDKKAVLEVLNSKQLT-QGK--RSLLFEEALCEF----LGV-----KHALVFNSATSALLTLYRNFSEFSADRNEIIT   79 (375)
T ss_dssp             CHHHHHHHHHHHTSSCCS-SSH--HHHHHHHHHHHH----HTC-----SEEEEESCHHHHHHHHHHHSSCCCTTSCEEEE
T ss_pred             CHHHHHHHHHHHHCCCCC-CCH--HHHHHHHHHHHH----HCC-----CEEEEECCHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             999999999998089867-897--799999999999----780-----95999737899999999984787899886982


Q ss_pred             HHCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             31055138999998299699986044666776667788999998502540342156664323344378999999998637
Q T0591           131 VQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY  210 (406)
Q Consensus       131 ~~P~y~~~~~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~  210 (406)
                      |.-+|......+...|++++.+.++..      ...+.+.+++.++++|+++++++   .-|....   +.+|.++|+++
T Consensus        80 p~~t~~a~~~ai~~~G~~pvfvDid~~------~~~~~~~~~~~~~~~tkaii~vh---~~G~~~d---~~~i~~~~~~~  147 (375)
T 2fnu_A           80 TPISFVATANMLLESGYTPVFAGIKND------GNIDELALEKLINERTKAIVSVD---YAGKSVE---VESVQKLCKKH  147 (375)
T ss_dssp             CSSSCTHHHHHHHHTTCEEEECCBCTT------SSBCGGGSGGGCCTTEEEEEEEC---GGGCCCC---HHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHCCCEEEEEECCCC------CCCCHHHHHHHCCCCCEEEEEEC---CCCCCCC---HHHHHHHHHHC
T ss_conf             597337527999857998999652333------55898999986488873999935---7555556---78999998751


Q ss_pred             CCEEEECCCCCCCC-CCCCCCCCHHHHHCCCCCCEEEEEEC--CHHCCCCCCCCHHHH-HHHHHHHHHHHHHHHCC----
Q ss_conf             87578417502355-68887652233210267868998504--001046311211433-25899999998752036----
Q T0591           211 GATVIADQLYSRLR-YAGASYTHLRAEAAVDAENVVTIMGP--SKTESLSGYRLGVAF-GSRAIIARMEKLQAIVS----  282 (406)
Q Consensus       211 ~~~ii~De~Y~~l~-~~~~~~~~~~~~~~~~~~~~i~~~S~--SK~~~~~GlRiG~~~-~~~~~i~~l~~~~~~~~----  282 (406)
                      ++.||+|.+.+... +.+...       ....+  +.++||  +|.++. |- -|.++ -++++.+.++.++....    
T Consensus       148 ~i~vIEDaa~a~Ga~~~~~~~-------G~~gd--~~~fSf~~~K~l~~-ge-GG~i~t~~~~~~~~~~~~~~~g~~~~~  216 (375)
T 2fnu_A          148 SLSFLSDSSHALGSEYQNKKV-------GGFAL--ASVFSFHAIKPITT-AE-GGAVVTNDSELHEKMKLFRSHGMLKKD  216 (375)
T ss_dssp             TCEEEEECTTCTTCEETTEET-------TSSSS--EEEEECCTTSSSCC-SS-CEEEEESCHHHHHHHHHHTBTTEEESS
T ss_pred             CCCCCCCHHHCCCCEECCCCC-------CCCCC--CCEECCCCCCEECC-CC-CCEEEECCHHHHHHHHHHHHHCCCCCC
T ss_conf             531202534436963313007-------66644--42212466600024-55-513771899999877688773557776


Q ss_pred             ------------CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCC----CCE--E-EEEEC
Q ss_conf             ------------7612457999999985652589999999999999999999727994553588----730--7-87766
Q T0591           283 ------------LRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQ----AGS--Y-LFPRL  343 (406)
Q Consensus       283 ------------~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~~p~----gg~--~-~w~~~  343 (406)
                                  +..+.+....+..-|+    .+.+..+..++..+...+.|.+.+++....|.    ..+  | ++++ 
T Consensus       217 ~~~~~~~~~G~n~r~~el~Aai~~~qL~----~l~~~~~~R~~~~~~y~~~L~~~~~i~~~~~~~~~~~~~~~~~i~~~-  291 (375)
T 2fnu_A          217 FFEGEVKSIGHNFRLNEIQSALGLSQLK----KAPFLMQKREEAALTYDRIFKDNPYFTPLHPLLKDKSSNHLYPILMH-  291 (375)
T ss_dssp             SSCEEESSCCCBCCCCHHHHHHHHHHHT----THHHHHHHHHHHHHHHHHHHTTCSSEEESGGGCSSCCCCSCEEEEEC-
T ss_pred             CCCCCCCCCCCEECCCHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEE-
T ss_conf             6544533356410142467889999987----64799999999999999875128871346654333444405899993-


Q ss_pred             CCCCCCHHHHHHHHHHHCCEEEEECCC-------C---CCCCC---------CEEEEEEC--CCHHHHHHHHHHHHHHHH
Q ss_conf             887889899999999868918961610-------2---67999---------85899850--997999999999999999
Q T0591           344 PKLAVAPAEFVKILRLQAGVVVTPGTE-------F---SPHTA---------DSVRLNFS--QDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       344 ~~~~~~~~~~~~~Ll~~~gV~v~pG~~-------F---g~~~~---------~~iRis~~--~~~e~l~~al~rl~~~~~  402 (406)
                      ........++...| .+.||-+.....       |   ...++         ..+.|.+.  .++++++.-++.|.++++
T Consensus       292 ~~~~~~r~~l~~~L-~~~gI~~~~~y~pl~~~~~~~~~~~~~~~p~ae~l~~~~l~LP~~~~lt~~di~~I~~~I~~~~~  370 (375)
T 2fnu_A          292 QKFFTCKKLILESL-HKRGILAQVHYKPIYQYQLYQQLFNTAPLKSAEDFYHAEISLPCHANLNLESVQNIAHSVLKTFE  370 (375)
T ss_dssp             GGGGGGHHHHHHHH-HHTTEECBCCCCCGGGSHHHHHHHCCCCCHHHHHHHHHEEEECCCTTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHH-HHCCCCCCEECCCCCCCHHHHHCCCCCCCHHHHHHHHCEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             24304489999999-98799851446662118988841666899899999849498978999899999999999999999


Q ss_pred             HHC
Q ss_conf             856
Q T0591           403 RYR  405 (406)
Q Consensus       403 ~~r  405 (406)
                      +||
T Consensus       371 ~~~  373 (375)
T 2fnu_A          371 SFK  373 (375)
T ss_dssp             HHC
T ss_pred             HHC
T ss_conf             857


No 162
>3gju_A Putative aminotransferase; NP_107505.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti MAFF303099} PDB: 3fcr_A*
Probab=99.61  E-value=3.4e-11  Score=93.60  Aligned_cols=344  Identities=12%  Similarity=0.042  Sum_probs=188.3

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.||+..|  ...+-+-.|.+.+++.+++......+....... +....+++.+.......   .+.+.++++++++...
T Consensus        52 ~ylD~~~g~g~~~lGh~~p~v~~Ai~~q~~~~~~~~~~~~~~~-~~~~~~a~~l~~~~p~~---~~~v~f~~SGseA~e~  127 (460)
T 3gju_A           52 KSIDAFAGLYCVNVGYGRQKIADAIATQAKNLAYYHAYVGHGT-EASITLAKMIIDRAPKG---MSRVYFGLSGSDANET  127 (460)
T ss_dssp             EEEETTHHHHTCTTCBCCHHHHHHHHHHHHHHSCCCCCTTCCC-HHHHHHHHHHHHHSCTT---EEEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC-HHHHHHHHHHHHCCCCH---HCEEEECCCHHHHHHH
T ss_conf             9998573888545678988999999999964786015666567-99999999865308630---0537852660789999


Q ss_pred             HHHHHH----H---CC-HHHHHHHCCCHHHH-HHHHHHC--------------CEEEEEEECCCCCCCCCCCCC------
Q ss_conf             999997----2---00-10101310551389-9999829--------------969998604466677666778------
Q T0591           117 AVAATV----A---RG-DKVAIVQPDYFANR-KLVEFFE--------------GEMVPVQLDYVSADETRAGLD------  167 (406)
Q Consensus       117 ~~~~l~----~---pG-d~Vl~~~P~y~~~~-~~~~~~g--------------~~~v~v~~~~~~~~~~~~~~d------  167 (406)
                      ++...-    .   ++ ..|+...-+|++.. ......+              ....+.|......+   ...+      
T Consensus       128 Aik~Ar~~~~~~g~~~r~~ii~~~~~yHG~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~---~~~~~~~~~~  204 (460)
T 3gju_A          128 NIKLIWYYNNVLGRPEKKKIISRWRGYHGSGVMTGSLTGLDLFHNAFDLPRAPVLHTEAPYYFRRTD---RSMSEEQFSQ  204 (460)
T ss_dssp             HHHHHHHHHHHTTCTTCCEEEEETTCCCCSSHHHHHHCCCGGGTTTTTCSCTTEEEECCCCGGGCSC---TTCCHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCHHHHHH
T ss_conf             9999999888509998628999808723885200121566223456565554455567885445676---6668889999


Q ss_pred             --HHHHHHHHC----CCCEEEECCCCCCC-CCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCC
Q ss_conf             --899999850----25403421566643-233-4437899999999863787578417502355688876522332102
Q T0591           168 --LTGLEEAFK----AGARVFLFSNPNNP-AGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAV  239 (406)
Q Consensus       168 --~~~l~~~~~----~~~k~i~l~~P~NP-TG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~  239 (406)
                        ++.+++.+.    +++.++++ -|--- .|. ..+++.+++|.++|++||+++|.||+...|.-.|.-+.. .. ...
T Consensus       205 ~~~~~l~~~i~~~~~~~iAavi~-EPi~g~~G~~~p~~~fl~~lr~lc~~~gillI~DEV~tGfgRtG~~~a~-~~-~gv  281 (460)
T 3gju_A          205 HCADKLEEMILAEGPETIAAFIG-EPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTMFGS-DH-YGI  281 (460)
T ss_dssp             HHHHHHHHHHHHHCGGGEEEEEE-CSSBSTTTSBCCCTTHHHHHHHHHHHTTCEEEEECTTTTTTTTSSSCHH-HH-HTC
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEE-CCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCEEECCCCCCCCCCH-HH-CCC
T ss_conf             99999999999709997799998-5766888984599999999999999809888741106455414685553-22-498


Q ss_pred             CCCCEEEEEECCHHCCCCCCCC-HHHHHHHHHHHHHHHHH-------HHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHH
Q ss_conf             6786899850400104631121-14332589999999875-------2036761245799999998565--258999999
Q T0591           240 DAENVVTIMGPSKTESLSGYRL-GVAFGSRAIIARMEKLQ-------AIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIA  309 (406)
Q Consensus       240 ~~~~~i~~~S~SK~~~~~GlRi-G~~~~~~~~i~~l~~~~-------~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~  309 (406)
                      .||    +.+++|.++ .|+-. +.++..+++.+.+..-.       ...+++.++++..++.+.|+..  +...++..+
T Consensus       282 ~PD----i~~~gK~l~-gG~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~T~~gnpl~~aaa~a~L~~i~~~~~~~~~~~  356 (460)
T 3gju_A          282 KPD----LITIAKGLT-SAYAPLSGVIVADRVWQVLVQGSDKLGSLGHGWTYSAHPICVAAGVANLELIDEMDLVTNAGE  356 (460)
T ss_dssp             CCS----EEEECGGGT-TTSSCCEEEEEEHHHHHHHHHHHHHHCSCSCCCTTTTCHHHHHHHHHHHHHHHHTTHHHHHHH
T ss_pred             CCC----CEEECCCCC-CCCCCCCCCHHHHHHHHHHCCCCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             754----133046455-356763210206999975347875456650234789972424457888664100129999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCC----------CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEE
Q ss_conf             9999999999999727994553588730787766887----------889899999999868918961610267999858
Q T0591           310 RHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL----------AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSV  379 (406)
Q Consensus       310 ~~~~~r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~----------~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~i  379 (406)
                      .-++.++.+.+.+.+.+.+......|.+ .=+.+...          ......+...+ .++||++.++.    . .+.+
T Consensus       357 ~g~~l~~~L~~l~~~~~~v~~vrG~Gl~-~~ie~~~~~~~~~~~~~~~~~~~~~~~~~-~~~Gll~~~~~----~-gn~i  429 (460)
T 3gju_A          357 TGAYFRAELAKAVGGHKNVGEVRGDGML-AAVEFVADKDDRVFFDASQKIGPQVATAL-AASGVIGRAMP----Q-GDIL  429 (460)
T ss_dssp             HHHHHHHHHHHHHTTSTTEEEEEEETTE-EEEEECSBTTTTBCCCGGGCHHHHHHHHH-HHTTEECEECS----S-SCEE
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCEE-EEEEEECCCCCCCCCCHHHHHHHHHHHHH-HHCCCEEECCC----C-CCEE
T ss_conf             9999999999998549985787411379-99999427654444434589999999999-97898894268----9-9889


Q ss_pred             EEE--ECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             998--5099799999999999999985
Q T0591           380 RLN--FSQDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       380 Ris--~~~~~e~l~~al~rl~~~~~~~  404 (406)
                      |++  +..++++++++++++.+.+++.
T Consensus       430 ~~~PpL~it~~~id~~i~~l~~al~~v  456 (460)
T 3gju_A          430 GFAPPLCLTREQADIVVSKTADAVKSV  456 (460)
T ss_dssp             EECCCTTCCHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             997995898999999999999999999


No 163
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis}
Probab=99.60  E-value=2.3e-12  Score=101.43  Aligned_cols=337  Identities=15%  Similarity=0.083  Sum_probs=200.0

Q ss_pred             CCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCC---CCCCH--HHHHHH-HHHHHHHCCCCCCCCCEEEEECCCCH
Q ss_conf             8334156786788788899999999998087888878---88898--899999-99999864886788670788248727
Q T0591            39 RPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTE---YRGDL--GIRDLL-APRLAAFTGAPVDARDGLIITPGTQG  112 (406)
Q Consensus        39 ~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~---~~G~~--~Lr~ai-a~~~~~~~g~~~~~~~~I~it~G~~~  112 (406)
                      .-|+|-..+   ...+|.+.+++...+...-.-|||-   ..|..  +-.|.+ .+..++.+|...   -+|=..+| +.
T Consensus        46 ~~l~LIaSE---N~~S~~v~~a~~S~l~nkYaEG~pg~Ryy~G~~~iD~iE~la~~rak~lF~a~~---anVqp~SG-s~  118 (447)
T 3h7f_A           46 DTLEMIASE---NFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVENLARDRAKALFGAEF---ANVQPHSG-AQ  118 (447)
T ss_dssp             HSEECCTTC---CCCCHHHHHHHTSGGGGCCCCEETTEESSSCCHHHHHHHHHHHHHHHHHHTCSE---EECCCSSH-HH
T ss_pred             CCCEEECCC---CCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC---CCCCCCCC-HH
T ss_conf             795487577---768999999846732364668899854426755799999999999999838875---34345753-67


Q ss_pred             HHHHHHHHHHHCCHHHHHHHCCCHHHH-----HHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CCCEEEECCC
Q ss_conf             899999999720010101310551389-----9999829969998604466677666778899999850-2540342156
Q T0591           113 ALFLAVAATVARGDKVAIVQPDYFANR-----KLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AGARVFLFSN  186 (406)
Q Consensus       113 ~l~~~~~~l~~pGd~Vl~~~P~y~~~~-----~~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~~  186 (406)
                      +...++.++++|||+|+..++...+|.     ..+....++.++++++     .....+|.|++++..+ .++|+|++-.
T Consensus       119 AN~av~~all~PGD~il~~~l~~GGHlshg~~~~~~~~~~~~~~y~~d-----~~~~~ID~d~~~~~a~~~kPklIi~G~  193 (447)
T 3h7f_A          119 ANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYENGFYGVD-----PATHLIDMDAVRATALEFRPKVIIAGW  193 (447)
T ss_dssp             HHHHHHHHHCCTTCEEEEECGGGTCCGGGTCTTSHHHHSSEEEEECCC-----TTTCSCCHHHHHHHHHHHCCSEEEEEC
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CHHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             899999986288970123304667744555544555553213445666-----034331046899997633675698656


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC-CCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHH
Q ss_conf             66432334437899999999863787578417502-35568887652233210267868998504001046311211433
Q T0591           187 PNNPAGVVYSAEEIGQIAALAARYGATVIADQLYS-RLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAF  265 (406)
Q Consensus       187 P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~-~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~  265 (406)
                      -.+|-  .+   +.+++.++|.+.|.+++.|-++- .|+-.|.-+.++..  + |    |+..|..|+|  +|-|-|.+.
T Consensus       194 S~y~r--~~---d~~~~reIad~vga~l~~D~aHi~GLIAgg~~~~Pl~~--a-D----vvT~sTHKTl--~GPrgGiI~  259 (447)
T 3h7f_A          194 SAYPR--VL---DFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPH--A-D----VVSTTVHKTL--GGGRSGLIV  259 (447)
T ss_dssp             SSCCS--CC---CHHHHHHHHHHHTCEEEEECTTTHHHHHTTSSCCSTTT--C-S----EEEEESSGGG--CCCSCEEEE
T ss_pred             CCCEE--CC---CHHHHHHHHHHCCCEEECCCCCCHHHEECCCCCCCCCC--C-C----EEEEEECCHH--CCCCCEEEE
T ss_conf             45320--25---68999998763041586234230231113212564011--0-4----4764302100--367751576


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHH-HHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHH----CCCCEEECC-CCCEE
Q ss_conf             2589999999875203676124579999-999856-5258999999999999999999972----799455358-87307
Q T0591           266 GSRAIIARMEKLQAIVSLRAAGYSQAVL-RGWFDE-APGWMEDRIARHQAIRDELLHVLRG----CEGVFARTP-QAGSY  338 (406)
Q Consensus       266 ~~~~~i~~l~~~~~~~~~~~~~~~q~a~-~~~l~~-~~~~~~~~~~~~~~~r~~l~~~L~~----~~g~~~~~p-~gg~~  338 (406)
                      ..+++.+++.+.......+.+...+.++ +.++.+ ......+..++..++.+.|.+.|..    ..|+++... .-.-.
T Consensus       260 ~~~~~~~~i~~avfPg~qg~~h~~~iAa~Aval~Ea~~~~fk~Ya~qvv~NAk~La~~L~~~~~~~~G~~vv~GgTdnH~  339 (447)
T 3h7f_A          260 GKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKAGVSVVSGGTDVHL  339 (447)
T ss_dssp             ECGGGHHHHHHHHTTTTCSSCCHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHHHHHHHHTSHHHHHTTCEEGGGSCSSSE
T ss_pred             ECCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCE
T ss_conf             25177888877518664565256678887777643377318889999999999999987545787559146318887663


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHCCEEE----EECCCCCCCCCCEEEEEE------CCCHHHHHHHHHHHHHHHH
Q ss_conf             877668878898999999998689189----616102679998589985------0997999999999999999
Q T0591           339 LFPRLPKLAVAPAEFVKILRLQAGVVV----TPGTEFSPHTADSVRLNF------SQDHEAAVAAARRIVTLVE  402 (406)
Q Consensus       339 ~w~~~~~~~~~~~~~~~~Ll~~~gV~v----~pG~~Fg~~~~~~iRis~------~~~~e~l~~al~rl~~~~~  402 (406)
                      +|+++...+.+..+. +.+|++.||.+    +|++.=.+-.+.-+||..      +..++++++..+-|.+++.
T Consensus       340 vlvdl~~~g~~g~~a-~~~Le~agI~vNkn~iP~D~~~~~~~SGIRlGT~alT~rG~~e~em~~IA~lI~~aL~  412 (447)
T 3h7f_A          340 VLVDLRDSPLDGQAA-EDLLHEVGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIATALA  412 (447)
T ss_dssp             EEEECTTSSCCHHHH-HHHHHHTTEECBC-------------CEEEEECHHHHHHTCCHHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCCCCHHHH-HHHHHHCCEEECCCCCCCCCCCCCCCCCCEECCHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             501112367878999-9999983918788889999999988985066888998589988999999999999985


No 164
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; biotin biosynthesis, pyridoxal phosphate, S-adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} PDB: 3drd_A 3du4_A*
Probab=99.60  E-value=3.7e-12  Score=100.08  Aligned_cols=345  Identities=12%  Similarity=0.065  Sum_probs=184.0

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC-HHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             83341567--867887888999999999980878888788889-889999999999864886788670788248727899
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGD-LGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~-~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      +.|||..|  ...+-+-.|.+.+++.+.+....   |....+. .+.+..+++.+......   +.+.+..+++++++..
T Consensus        45 ~ylD~~~g~~~~~lGh~~p~v~~ai~~q~~~~~---~~~~~~~~~~~~~~~a~~l~~~~~~---~~~~~~~~~sGsea~e  118 (448)
T 3dod_A           45 EYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIA---HSTLLGMTNVPATQLAETLIDISPK---KLTRVFYSDSGAEAME  118 (448)
T ss_dssp             EEEETTHHHHTCSSCBSCHHHHHHHHHHHTTCS---CCCCSSSEEHHHHHHHHHHHHHSCT---TEEEEEEESSHHHHHH
T ss_pred             EEEECHHHHHHHHCCCCCHHHHHHHHHHHHHCC---CCCCCCCCCHHHHHHHHHHHHCCCC---CCCEEEEECCCCHHHH
T ss_conf             999820158754447896999999999986637---7567655778999999987640786---6686885158741899


Q ss_pred             HHHHHHH---H----CC-HHHHHHHCCCHHHHHHH-HHHCCEE------------EEEEECCCC-CCCCC----CCCCHH
Q ss_conf             9999997---2----00-10101310551389999-9829969------------998604466-67766----677889
Q T0591           116 LAVAATV---A----RG-DKVAIVQPDYFANRKLV-EFFEGEM------------VPVQLDYVS-ADETR----AGLDLT  169 (406)
Q Consensus       116 ~~~~~l~---~----pG-d~Vl~~~P~y~~~~~~~-~~~g~~~------------v~v~~~~~~-~~~~~----~~~d~~  169 (406)
                      .++....   .    ++ ..|+...-+|+...... ...+-..            ...+..... .+..+    ..-+++
T Consensus       119 ~Aik~ar~~~~~~g~~~r~~ii~~~~~yHG~t~~a~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  198 (448)
T 3dod_A          119 IALKMAFQYWKNIGKPEKQKFIAMKNGYHGDTIGAVSVGSIELFHHVYGPLMFESYKAPIPYVYRSESGDPDECRDQCLR  198 (448)
T ss_dssp             HHHHHHHHHHHHTTCTTCCEEEEEC-----------------------------CEEECCCCCTTSSSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999887538988647999807858986775424567443357777543332345311125677983778999999


Q ss_pred             HHHHHHC---CCCEEEECCCC-C-CCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCE
Q ss_conf             9999850---25403421566-6-43233443789999999986378757841750235568887652233210267868
Q T0591           170 GLEEAFK---AGARVFLFSNP-N-NPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENV  244 (406)
Q Consensus       170 ~l~~~~~---~~~k~i~l~~P-~-NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~  244 (406)
                      .+++.+.   +++-++++..| . +.--...+++.+++|.++|++||+++|.||++..|...|.-+..-.  ....||  
T Consensus       199 ~l~~~~~~~~~~iaAviie~~i~g~~G~~~~~~~fl~~lr~lc~~~gillI~DEV~tG~GRtG~~~a~~~--~gv~PD--  274 (448)
T 3dod_A          199 ELAQLLEEHHEEIAALSIESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEH--ENVQPD--  274 (448)
T ss_dssp             HHHHHHHHHGGGEEEEEEESSEESTTTCEECCTTHHHHHHHHHHHTTCEEEEECTTTTTTTTSSSSGGGG--GTCCCS--
T ss_pred             HHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCEECCCCCCHHC--CCCCCC--
T ss_conf             9999998548983279998666348897579989999999997555821772032006401367740420--899999--


Q ss_pred             EEEEECCHHCCCCCCCCHH-HHHHHHHHHHHHH-------HHHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHH
Q ss_conf             9985040010463112114-3325899999998-------752036761245799999998565--25899999999999
Q T0591           245 VTIMGPSKTESLSGYRLGV-AFGSRAIIARMEK-------LQAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAI  314 (406)
Q Consensus       245 i~~~S~SK~~~~~GlRiG~-~~~~~~~i~~l~~-------~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~  314 (406)
                        +-+++|.++ .|+-.+. ++..+++......       .....+++.+.++..++.+.|+..  +...+ ..+...++
T Consensus       275 --iv~~gK~l~-~G~~~~a~v~~~~~~~~~~~~~~~~~~~~~~~~T~~g~pl~~aaa~atl~~i~~~~~~~-~~~~~g~~  350 (448)
T 3dod_A          275 --LMAAGKGIT-GGYLPIAVTFATEDIYKAFYDDYENLKTFFHGHSYTGNQLGCAVALENLALFESENIVE-QVAEKSKK  350 (448)
T ss_dssp             --EEEECGGGG-TTSSCCEEEEEEHHHHHTTCSCGGGCCCCCCCCTTTTCHHHHHHHHHHHHHHHHTTHHH-HHHHHHHH
T ss_pred             --EEEECCHHH-CCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHH-HHHHHHHH
T ss_conf             --898675121-79875368974388876502676323456677676877299999998776664035577-88889999


Q ss_pred             HHHHHHHHHHCCCCEEECCCCCEEEEEECCCC----------CCCHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--
Q ss_conf             99999999727994553588730787766887----------889899999999868918961610267999858998--
Q T0591           315 RDELLHVLRGCEGVFARTPQAGSYLFPRLPKL----------AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--  382 (406)
Q Consensus       315 r~~l~~~L~~~~g~~~~~p~gg~~~w~~~~~~----------~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--  382 (406)
                      .....+.|.+.+.+.-....| ++.=+.+...          ......+...+ .++||++.|.       .+.+|++  
T Consensus       351 l~~~l~~l~~~~~v~~vrG~G-l~~~~el~~~~~~~~~~~~~~~~~~~i~~~~-~~~Gll~~~~-------~~~l~~~Pp  421 (448)
T 3dod_A          351 LHFLLQDLHALPHVGDIRQLG-FMCGAELVRSKETKEPYPADRRIGYKVSLKM-RELGMLTRPL-------GDVIAFLPP  421 (448)
T ss_dssp             HHHHHHHHTTSTTEEEEEEET-TEEEEEECSBTTTTBCCCGGGCHHHHHHHHH-HHTTEECCEE-------TTEEEECCC
T ss_pred             HHHHHHHHHCCCCEEEEECCC-EEEEEEEECCCCCCCCCCHHHHHHHHHHHHH-HHCCCEEEEC-------CCEEEEECC
T ss_conf             999999986299878984142-5999998237654666630389999999999-9689389514-------999999799


Q ss_pred             ECCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             509979999999999999998569
Q T0591           383 FSQDHEAAVAAARRIVTLVERYRA  406 (406)
Q Consensus       383 ~~~~~e~l~~al~rl~~~~~~~ra  406 (406)
                      ++.+++++++++++|.+++++..+
T Consensus       422 L~~t~~did~~~~~l~~al~~v~~  445 (448)
T 3dod_A          422 LASTAEELSEMVAIMKQAIHEVTS  445 (448)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             488899999999999999999862


No 165
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2}
Probab=99.59  E-value=8.2e-12  Score=97.75  Aligned_cols=344  Identities=14%  Similarity=0.103  Sum_probs=185.3

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.|||..|  ...+-+-.|.+.+++.+.+......  ....-..+.+..+|+.+....+..   .+.++.+++++++...
T Consensus        55 ~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~~~~~--~~~~~~~~~~~~lae~L~~~~p~~---~~~v~f~~sGseA~e~  129 (476)
T 3i5t_A           55 RLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYA--SPWYMATSPAARLAEKIATLTPGD---LNRIFFTTGGSTAVDS  129 (476)
T ss_dssp             EEEETTHHHHTCTTCBCCHHHHHHHHHHHHHCCCC--CTTTCBCHHHHHHHHHHHTTSSTT---CCEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCC--CCCCCCCHHHHHHHHHHHHHCCCC---CCEEEEECCHHHHHHH
T ss_conf             99987630876662699599999999999755873--678668889999999999857988---5869850876889999


Q ss_pred             HHHHHH-------HCC-HHHHHHHCCCHHHHHHHHHH-CC------------EEEEEEECCCCCCCCCC-----CCCHHH
Q ss_conf             999997-------200-10101310551389999982-99------------69998604466677666-----778899
Q T0591           117 AVAATV-------ARG-DKVAIVQPDYFANRKLVEFF-EG------------EMVPVQLDYVSADETRA-----GLDLTG  170 (406)
Q Consensus       117 ~~~~l~-------~pG-d~Vl~~~P~y~~~~~~~~~~-g~------------~~v~v~~~~~~~~~~~~-----~~d~~~  170 (406)
                      +++.-.       .++ ..++...-+|+......... +.            ....++...........     .-+.++
T Consensus       130 Alklar~~~~~~g~~~~~~i~~~~~g~hG~t~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  209 (476)
T 3i5t_A          130 ALRFSEFYNNVLGRPQKKRIIVRYDGYHGSTALTAACTGRTGNWPNFDIAQDRISFLSSPNPRHAGNRSQEAFLDDLVQE  209 (476)
T ss_dssp             HHHHHHHHHHHTTCTTCCEEEEETTCCCCSSHHHHHTCCCGGGCTTSCCCCTTEEEECCCCGGGCTTSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             99997667886299750699999579878753000103665443453222223334457752235777614678889999


Q ss_pred             HHHHHC---C-CCEEEECCCC-CCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCE
Q ss_conf             999850---2-5403421566-643233-443789999999986378757841750235568887652233210267868
Q T0591           171 LEEAFK---A-GARVFLFSNP-NNPAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENV  244 (406)
Q Consensus       171 l~~~~~---~-~~k~i~l~~P-~NPTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~  244 (406)
                      +++.+.   + .+.++++ -| ..-.|. ..+++.++++.++|++||+++|.||++..+...|....... .....||  
T Consensus       210 l~~~i~~~~~~~iAavi~-Epi~g~gG~~~~~~~fl~~lr~lc~~~gillI~DEV~tG~GRtG~~~~~~~-~~gv~PD--  285 (476)
T 3i5t_A          210 FEDRIESLGPDTIAAFLA-EPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEK-VFGVVPD--  285 (476)
T ss_dssp             HHHHHHHHCGGGEEEEEE-CSSBTTTTSBCCCTTHHHHHHHHHHHTTCEEEEECTTTTTTTTSSSCHHHH-TTCCCCS--
T ss_pred             HHHHHHHCCCCCEEEEEE-CCCCCCCCCEECCHHHHHHHHHHHHHHCCEEEECCCEECCCCCCCCCCHHH-HCCCCCC--
T ss_conf             999998549997699997-762167854568899999999999997978885143112665778740343-1598988--


Q ss_pred             EEEEECCHHCCCCC-CCCHHHHHHHHHHHHHHHHH-------HHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             99850400104631-12114332589999999875-------20367612457999999985652589999999999999
Q T0591           245 VTIMGPSKTESLSG-YRLGVAFGSRAIIARMEKLQ-------AIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRD  316 (406)
Q Consensus       245 i~~~S~SK~~~~~G-lRiG~~~~~~~~i~~l~~~~-------~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~  316 (406)
                      |  -.++|.++ .| .=++.++..+++.+.+..-.       ...+++.++++..++.+.|+..++  .+..+..+++-+
T Consensus       286 i--v~~gK~L~-~G~~p~~~~~~~~~v~~~~~~~~~~~~~~~~g~T~~gnpla~aaa~a~L~~i~~--~~~~~~~~~~g~  360 (476)
T 3i5t_A          286 I--ITFAKGVT-SGYVPLGGLAISEAVLARISGENAKGSWFTNGYTYSNQPVACAAALANIELMER--EGIVDQAREMAD  360 (476)
T ss_dssp             E--EEECGGGG-TTSSCCEEEEECHHHHHTTSGGGCTTCEECCCCTTTTCHHHHHHHHHHHHHHHH--TTHHHHHHHHHH
T ss_pred             E--EEECCCCC-CCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH--HHHHHHHHHHHH
T ss_conf             8--85211146-885630010113999965358775544355556889886999999999999997--137999999999


Q ss_pred             HHHHHHHHC---CCCEEECCCCCEEEEEECCCC-----CC-C----HHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE-
Q ss_conf             999999727---994553588730787766887-----88-9----899999999868918961610267999858998-
Q T0591           317 ELLHVLRGC---EGVFARTPQAGSYLFPRLPKL-----AV-A----PAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN-  382 (406)
Q Consensus       317 ~l~~~L~~~---~g~~~~~p~gg~~~w~~~~~~-----~~-~----~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis-  382 (406)
                      ++.+.|+++   +.+.-.... |+++-+.+-..     .. .    ...+...+ .+.||++.|.      + +.+|++ 
T Consensus       361 ~l~~~L~~L~~~~~i~~vrg~-Gl~~~ie~~~~~~~~~~~~~~~~~~~~l~~~~-~~~Glli~~~------G-n~l~~~P  431 (476)
T 3i5t_A          361 YFAAALASLRDLPGVAETRSV-GLVGCVQCLLDPTRADGTAEDKAFTLKIDERC-FELGLIVRPL------G-DLCVISP  431 (476)
T ss_dssp             HHHHHHHTTTTSTTEEEEEEE-TTEEEEEECCC-----CCHHHHHHHHHHHHHH-HHTTEECEEE------T-TEEEECC
T ss_pred             HHHHHHHHHHCCCCEEEEECC-CEEEEEEEEECCCCCCCCCCCHHHHHHHHHHH-HHCCCEEEEC------C-CEEEEEC
T ss_conf             999999987159974677426-64899998414555555521079999999999-9789289754------9-8899989


Q ss_pred             -ECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             -50997999999999999999856
Q T0591           383 -FSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       383 -~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                       +..+++++++++++|.+.+++..
T Consensus       432 pl~it~~eid~~~~~l~~al~ev~  455 (476)
T 3i5t_A          432 PLIISRAQIDEMVAIMRQAITEVS  455 (476)
T ss_dssp             CTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             957899999999999999999998


No 166
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} SCOP: c.67.1.4
Probab=99.59  E-value=1.2e-11  Score=96.60  Aligned_cols=341  Identities=11%  Similarity=0.032  Sum_probs=195.7

Q ss_pred             CEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC---CC---CHHHHHHHHHHHHHHCCCCCCCCC--EEEEECCCC
Q ss_conf             3341567867887888999999999980878888788---88---988999999999986488678867--078824872
Q T0591            40 PVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEY---RG---DLGIRDLLAPRLAAFTGAPVDARD--GLIITPGTQ  111 (406)
Q Consensus        40 ~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~---~G---~~~Lr~aia~~~~~~~g~~~~~~~--~I~it~G~~  111 (406)
                      -|+|-..+   ...+|.+.+++...+...-.-+||-.   .|   ..++-....++..+.++.+.. +.  ||=.-+| +
T Consensus        56 ~l~LIaSE---N~~S~~v~~a~gS~ltnkYaEG~Pg~RyY~G~~~iD~iE~la~~ra~~lF~~~~a-~~~vNVqp~SG-s  130 (490)
T 2a7v_A           56 GLELIASE---NFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPA-QWGVNVQPYSG-S  130 (490)
T ss_dssp             SEECCTTC---CCCCHHHHHHHTSGGGTCCCCC------------CTHHHHHHHHHHHHHTTCCTT-TEEEECCCSSH-H
T ss_pred             CCEEECCC---CCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCH-HCCCCCCCCCC-H
T ss_conf             83587676---6479999998568211544478998543577668999999999999998488500-12668786872-8


Q ss_pred             HHHHHHHHHHHHCCHHHHHHHCCCHHHHHHH-----HHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CCCEEEECC
Q ss_conf             7899999999720010101310551389999-----9829969998604466677666778899999850-254034215
Q T0591           112 GALFLAVAATVARGDKVAIVQPDYFANRKLV-----EFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AGARVFLFS  185 (406)
Q Consensus       112 ~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~~~-----~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~~k~i~l~  185 (406)
                      .+-..++.+++.|||+|+..+....+|..--     ...++....+.......+.....+|.+++++..+ .++|+|++-
T Consensus       131 ~AN~av~~all~pGD~im~l~l~~GGHlsHg~~~~~~~~~~~~~~~~~~~Y~~d~~~~~IDyd~l~~~a~~~kPklIi~G  210 (490)
T 2a7v_A          131 PANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAG  210 (490)
T ss_dssp             HHHHHHHHHHCCSCEECCC-------------------------------CCBCTTTCSBCHHHHHHHHHHHCCSEEEEC
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEC
T ss_conf             99999999761778659863366677654553356666521456766677753278885848999999864077658843


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC-CCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHH
Q ss_conf             666432334437899999999863787578417502-3556888765223321026786899850400104631121143
Q T0591           186 NPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYS-RLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVA  264 (406)
Q Consensus       186 ~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~-~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~  264 (406)
                      .-..|-  .+   +.+++.++|.+.|.+++.|-++- .|+-.|.-+.++..     .+  |+.+|..|+|  +|-|-|.+
T Consensus       211 ~Say~r--~~---d~~~~reIad~vgA~l~~D~aHiaGLIA~g~~~sPl~~-----aD--vVtttTHKTl--rGPrgGiI  276 (490)
T 2a7v_A          211 TSAYAR--LI---DYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKH-----AD--IVTTTTHKTL--RGARSGLI  276 (490)
T ss_dssp             CSSCCS--CC---CHHHHHHHHHHTTCEEEEECGGGHHHHHTTSSCCGGGT-----CS--EEEEESSGGG--CSCSCEEE
T ss_pred             CCCCCC--CC---CHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHCCHHHH-----HC--EEEEEECCCC--CCCCCEEE
T ss_conf             200334--46---68999988740476188210111221116541686664-----11--1222203211--58876389


Q ss_pred             HHHH---------------HHHHHHHHHHHHCCCCHHHHHHHHH-HHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             3258---------------9999999875203676124579999-999856-5258999999999999999999972799
Q T0591           265 FGSR---------------AIIARMEKLQAIVSLRAAGYSQAVL-RGWFDE-APGWMEDRIARHQAIRDELLHVLRGCEG  327 (406)
Q Consensus       265 ~~~~---------------~~i~~l~~~~~~~~~~~~~~~q~a~-~~~l~~-~~~~~~~~~~~~~~~r~~l~~~L~~~~g  327 (406)
                      ...+               ++.+++.+.--....+.+...+.++ +..+.+ .....++..++.-++.+.|.+.|.+. |
T Consensus       277 ~~~~~~~~~~~~~~~~~~~~~~~kId~avFPg~qggph~h~iAa~Ava~~Ea~~~~fk~Ya~qVv~NAkaLA~~L~~~-G  355 (490)
T 2a7v_A          277 FYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLER-G  355 (490)
T ss_dssp             EEECSEEEEETTTEEEEECCCHHHHHHHHTTTTCCSCCHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHT-T
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHC-C
T ss_conf             971542224554575302568998875658530234321368899999987458068899999999999999999857-9


Q ss_pred             CEEECC-CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEE----ECCCCCCCCCCEEEEEE------CCCHHHHHHHHHH
Q ss_conf             455358-873078776688788989999999986891896----16102679998589985------0997999999999
Q T0591           328 VFARTP-QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVT----PGTEFSPHTADSVRLNF------SQDHEAAVAAARR  396 (406)
Q Consensus       328 ~~~~~p-~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~----pG~~Fg~~~~~~iRis~------~~~~e~l~~al~r  396 (406)
                      +.+... .....+|+++...+.+..+.. .+|++.||.+.    |++. .+-.+.-+||..      +..++++++-.+-
T Consensus       356 ~~vv~ggTdnHlvlvdl~~~g~~G~~ae-~~Le~~gI~vNkn~iP~D~-s~~~~sGiRiGT~alTtrG~~e~dm~~IA~~  433 (490)
T 2a7v_A          356 YSLVSGGTDNHLVLVDLRPKGLDGARAE-RVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDF  433 (490)
T ss_dssp             CEEGGGSCSSSEEEEECTTTTCCHHHHH-HHHHHTTEECEEECCTTCC-CSSSCSEEEEESHHHHHTTCCHHHHHHHHHH
T ss_pred             CEEECCCCCCEEEEEECCCCCCCHHHHH-HHHHHCCCEECCCCCCCCC-CCCCCCCEEECCHHHHHCCCCHHHHHHHHHH
T ss_conf             7232488886269986355688668999-9999869177877478999-8899984476688998589988999999999


Q ss_pred             HHHHHH
Q ss_conf             999999
Q T0591           397 IVTLVE  402 (406)
Q Consensus       397 l~~~~~  402 (406)
                      |.+++.
T Consensus       434 I~~al~  439 (490)
T 2a7v_A          434 IDEGVN  439 (490)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
T ss_conf             999998


No 167
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus HB8}
Probab=99.59  E-value=2.6e-13  Score=107.94  Aligned_cols=336  Identities=15%  Similarity=0.131  Sum_probs=189.0

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHH
Q ss_conf             83341567--8678878889999999999808788887888898899999999998648867886707882487278999
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFL  116 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~  116 (406)
                      +.+|+..|  ...+-+-+|.+.+++.+.+.......+.     ......+++.+.+..+.    .+.++.++++++|...
T Consensus        53 ~ylD~~sg~~~~~lGh~~p~i~~ai~~ql~~~~~~~~~-----~~~~~~lae~l~~~~~~----~~~v~f~~SGseAvE~  123 (424)
T 2e7u_A           53 RYLDYVMSWGPLILGHAHPKVLARVRETLERGLTFGAP-----SPLEVALAKKVKRAYPF----VDLVRFVNSGTEATMS  123 (424)
T ss_dssp             EEEESSGGGTTCTTCBTCHHHHHHHHHHHHTCSCCSSC-----CHHHHHHHHHHHHHCTT----CCEEEEESSHHHHHHH
T ss_pred             EEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCC-----CHHHHHHHHHHHHHCCC----CCEEEECCCHHHHHHH
T ss_conf             99985708897710789699999999998632656664-----02789999999975899----8979863963999999


Q ss_pred             HHHHHH--HCCHHHHHHHCCCHHHHHHH-HHHCCEE--EEEEEC------CCCCCCCCCCCCHHHHHHHHCC---CCEEE
Q ss_conf             999997--20010101310551389999-9829969--998604------4666776667788999998502---54034
Q T0591           117 AVAATV--ARGDKVAIVQPDYFANRKLV-EFFEGEM--VPVQLD------YVSADETRAGLDLTGLEEAFKA---GARVF  182 (406)
Q Consensus       117 ~~~~l~--~pGd~Vl~~~P~y~~~~~~~-~~~g~~~--v~v~~~------~~~~~~~~~~~d~~~l~~~~~~---~~k~i  182 (406)
                      ++..-.  .....|+...-+|++..... ...|...  ..+|..      ..........-|+++|++.++.   ++.++
T Consensus       124 AiKlAr~~t~r~~ii~~~~~yHG~t~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~le~~l~~~~~~iaai  203 (424)
T 2e7u_A          124 ALRLARGYTGRPYIVKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAI  203 (424)
T ss_dssp             HHHHHHHHHCCCEEEEETTCCCCCCGGGSEECCSSSCCBCEESSTTCCHHHHTTEEEECTTCHHHHHHHHHHHGGGEEEE
T ss_pred             HHHHHHHCCCCCEEEEEECCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             99999755477979999687178864677737886444689987899865456565657689999999997379967999


Q ss_pred             ECCCC--CCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCC
Q ss_conf             21566--6432334437899999999863787578417502355688876522332102678689985040010463112
Q T0591           183 LFSNP--NNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYR  260 (406)
Q Consensus       183 ~l~~P--~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlR  260 (406)
                      ++ -|  .+ .|...+.+.+.++.++|++||+++|.||++..+... .-+. . ......||    +-+++|.++ .|+=
T Consensus       204 i~-Epv~g~-gg~~~~~~~~~~~~~~c~~~gillI~DEv~tG~gr~-~~~a-~-e~~gv~PD----iv~~gK~l~-gG~~  273 (424)
T 2e7u_A          204 IF-EPVVGN-AGVLVPTEDFLKALHEAKAYGVLLIADEVMTGFRLA-FGGA-T-ELLGLKPD----LVTLGKILG-GGLP  273 (424)
T ss_dssp             EE-CSSBCT-TSCBCCCHHHHHHHHHGGGGTCEEEEECTTTTTTSS-TTHH-H-HHHTCCCS----EEEECGGGG-TTSS
T ss_pred             EE-ECCCCC-CCCCCCCHHHHHHHHHHHHCCEEEEEECCCCCCCCC-CCCH-H-HHHCCCCC----EEEEEHHHH-CCCC
T ss_conf             99-747888-896368778988888764068699996586554301-5653-4-65399985----999703774-9831


Q ss_pred             CHHHHHHHHHHHHHHHHHH---HCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHH-HHHHHHHHHHHHCCCCEEECCC
Q ss_conf             1143325899999998752---036761245799999998565--258999999999-9999999999727994553588
Q T0591           261 LGVAFGSRAIIARMEKLQA---IVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQ-AIRDELLHVLRGCEGVFARTPQ  334 (406)
Q Consensus       261 iG~~~~~~~~i~~l~~~~~---~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~-~~r~~l~~~L~~~~g~~~~~p~  334 (406)
                      +|.+++.+++++.+.....   ..+++.+.++..++.+.|+-.  ...+.+...... ..++.+.+.+.+.+-+.-....
T Consensus       274 ~~av~~~~ei~~~~~~~~~~~~~~T~~gnp~~~aaa~a~L~~~~e~~~l~~~~~~~g~~~~~~l~~~~~~~~~v~~VrG~  353 (424)
T 2e7u_A          274 AAAYAGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLATLELLEENPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRV  353 (424)
T ss_dssp             CEEEEECHHHHTTBTTTSSBCCCCTTCSCHHHHHHHHHHHHHHHHCTHHHHHHHHHHHHHHHHHHHHHHHTTCCCEEEEE
T ss_pred             CEEEEEHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             08988969999876226987645788878413689999999999574378999999999999999999768998799606


Q ss_pred             CCEEEEEECCCCC---------CCH---HHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             7307877668878---------898---999999998689189616102679998589985099799999999999999
Q T0591           335 AGSYLFPRLPKLA---------VAP---AEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLV  401 (406)
Q Consensus       335 gg~~~w~~~~~~~---------~~~---~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~~~~e~l~~al~rl~~~~  401 (406)
                       |+++-+.+.+..         .+.   ..+...|+ +.||.+.|+      +...+++++..++++++++++.|.+++
T Consensus       354 -Glm~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~~Gv~~~p~------~~~~~~~~l~it~~eid~~~~~l~~al  424 (424)
T 2e7u_A          354 -GSMITVFFTEGPVVTFQDARRTDTELFKRFFHGLL-DRGIYWPPS------NFEAAFLSVAHREEDVEKTLEALRKAL  424 (424)
T ss_dssp             -TTEEEEESSSSCCCSHHHHTTSCHHHHHHHHHHHH-TTTEECCSS------SSSCEECCTTCCHHHHHHHHHHHHHHC
T ss_pred             -CCEEEEEEECCCCCCHHHHHCCHHHHHHHHHHHHH-HCCEEECCC------CCEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             -73899998268777878772141999999999999-789286788------973597478781999999999999769


No 168
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomics, joint center for structural genomics, JCSG; HET: LLP; 2.20A {Psychrobacter arcticus 273-4}
Probab=99.57  E-value=2.7e-12  Score=100.97  Aligned_cols=285  Identities=14%  Similarity=0.156  Sum_probs=169.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCHHHHHHHCCCHHH--HHHHHH--HCCEEEEEEECCCCCC---CCCCCCCHHHHHHH
Q ss_conf             7078824872789999999972001010131055138--999998--2996999860446667---76667788999998
Q T0591           102 DGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFAN--RKLVEF--FEGEMVPVQLDYVSAD---ETRAGLDLTGLEEA  174 (406)
Q Consensus       102 ~~I~it~G~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~--~~~~~~--~g~~~v~v~~~~~~~~---~~~~~~d~~~l~~~  174 (406)
                      +.++++.|+|.++..++..+. +||.+++..-+.++.  ...+..  .+.++..++.+.....   +..--.|++++.+.
T Consensus        52 ~~v~~~gsgT~a~ea~~~~l~-~~d~~lv~~~G~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~  130 (379)
T 3ke3_A           52 AAVIIPGSGTYGMEAVARQLT-IDEDCLIIRNGWFSYRWTQILEKGKFAKSSTVLTAERTEDTEAPKPFAPVDIETAVAK  130 (379)
T ss_dssp             EEEEEESCHHHHHHHHHHHHC-TTCEEEEEECSHHHHHHHHHHHHHCCSSEEEEEECEESSCCSSCCCEECCCHHHHHHH
T ss_pred             CEEEEECCHHHHHHHHHHHCC-CCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             779996877999999999718-8985799667718899999999718886169970244322455677885538999986


Q ss_pred             H-CCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHH
Q ss_conf             5-025403421566643233443789999999986378757841750235568887652233210267868998504001
Q T0591           175 F-KAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKT  253 (406)
Q Consensus       175 ~-~~~~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~  253 (406)
                      + ++++++++++.-+|-||...+.+.+.++++.++.+++++++|.+-.     |..+..+...   ..+  +++.|-.|.
T Consensus       131 ~~~~~~~~v~~~h~etstG~~~~~~~i~~~~~~~~~~~~~~v~~~~s~-----g~~~~~~d~~---~iD--~~~~ssqK~  200 (379)
T 3ke3_A          131 IKEDKSAIVYAPHVETSSGIILSEEYIKALSEAVHSVGGLLVIDCIAS-----GCVWLDMKEL---GID--VLISAPQKG  200 (379)
T ss_dssp             HHHHTCSEEEEESEETTTTEECCHHHHHHHHHHHHHTTCEEEEECTTC-----TTCCCCHHHH---TCS--EEEECTTTT
T ss_pred             HHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC-----CCCCCCHHHC---CCE--EEEEECCCC
T ss_conf             232586089983210255400124443210011245563478731145-----5333231004---864--999826786


Q ss_pred             C-CCCCCCCHHHHHHHHHHHHHHHHHHH-------------------C--CCCHHH-HHHHHHHHHHHCC-CHHHHHHHH
Q ss_conf             0-46311211433258999999987520-------------------3--676124-5799999998565-258999999
Q T0591           254 E-SLSGYRLGVAFGSRAIIARMEKLQAI-------------------V--SLRAAG-YSQAVLRGWFDEA-PGWMEDRIA  309 (406)
Q Consensus       254 ~-~~~GlRiG~~~~~~~~i~~l~~~~~~-------------------~--~~~~~~-~~q~a~~~~l~~~-~~~~~~~~~  309 (406)
                      + +.||  +|+++.+++.++++......                   .  ...++. ....+....++.. ..-..+.++
T Consensus       201 l~gp~G--lg~~~~s~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~tp~~~~~~al~~~l~~~~~~g~~~~~~  278 (379)
T 3ke3_A          201 WSSTPC--AGLVMLSAAAIKKVESTESNCFSLDLKQWLTIMRAYENGGHAYHATMPTDSLRQFRDAILEAKEIGFDILRD  278 (379)
T ss_dssp             TCSCCC--EEEEEECHHHHHHHHTCCCSCSTTCHHHHHHHHHHHHTTSCCCSSCCCHHHHHHHHHHHHHHHHHCHHHHHH
T ss_pred             CCCCCC--EEEECCCHHHHHHHCCCCCCCCEEEECCHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             438998--501004499996222569996402202013333310366533553056899999999898765434566689


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEECCC----CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC---CCCEEEEE
Q ss_conf             9999999999999727994553588----7307877668878898999999998689189616102679---99858998
Q T0591           310 RHQAIRDELLHVLRGCEGVFARTPQ----AGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH---TADSVRLN  382 (406)
Q Consensus       310 ~~~~~r~~l~~~L~~~~g~~~~~p~----gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~---~~~~iRis  382 (406)
                      +.++..+.+.+.+... ++....+.    .+. +....|+    +.+....++.++||.+..|-.....   ..+.+||+
T Consensus       279 ~~~~~~~~~~~~l~~~-~~~~~~~~~~~s~~v-~~~~~~~----~~~~~~~~l~~~gi~i~~G~~~~~g~~~~~~~~RI~  352 (379)
T 3ke3_A          279 AQWELGNRVRKVLTDK-GIESVAAEGFEAPGV-VVSYTER----DDMHKGSAFAEAGLQIAAGVPLKVGEPDNFKTFRLG  352 (379)
T ss_dssp             HHHHHHHHHHHHHHHT-TCCBSBCTTCBCSSE-EEEECSC----HHHHSSHHHHHTTCCCEECCCCSSCCCTTCCEEEEE
T ss_pred             HHHHHHHHHHHHHHCC-CCCCCCCCHHCCCEE-EEEECCC----CHHHHHHHHHHCCCEEEECCCCCCCCCCCCCEEEEE
T ss_conf             9999876654211013-443034815409759-9980898----879999999977979970765357866789999996


Q ss_pred             EC--CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             50--997999999999999999856
Q T0591           383 FS--QDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       383 ~~--~~~e~l~~al~rl~~~~~~~r  405 (406)
                      ..  ++.++++..++.|++++++.-
T Consensus       353 ~~g~~t~~di~~~l~al~~~L~e~~  377 (379)
T 3ke3_A          353 LFGLDKLTDIDGTVERFEKALDEVL  377 (379)
T ss_dssp             CCSHHHHTCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             7677999999999999999999985


No 169
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A*
Probab=99.55  E-value=1.9e-11  Score=95.23  Aligned_cols=340  Identities=13%  Similarity=0.065  Sum_probs=197.9

Q ss_pred             CCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCC---CCCCH--HHHHHHH-HHHHHHCCCCCCCC-CEEEEECC
Q ss_conf             898334156786788788899999999998087888878---88898--8999999-99998648867886-70788248
Q T0591            37 EGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTE---YRGDL--GIRDLLA-PRLAAFTGAPVDAR-DGLIITPG  109 (406)
Q Consensus        37 ~~~~i~ls~G~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~---~~G~~--~Lr~aia-~~~~~~~g~~~~~~-~~I~it~G  109 (406)
                      +..-|+|...+   ...+|.+.+++...+...-.-+|+.   ..|..  +-.|.+| ++..+.+|.+.+.. -+|=. ..
T Consensus        43 q~~~l~LiaSE---N~~S~~v~~al~S~l~nkYaeG~pg~Ryy~G~~~iD~iE~la~~ra~~lF~~~~~~~~anVqp-~S  118 (483)
T 1rv3_A           43 QRVGLELIASE---NFASRAVLEALGSCLNNKYSLGYPGQRYYGGTEHIDELETLCQKRALQAYGLDPQCWGVNVQP-YS  118 (483)
T ss_dssp             HHSSEECCTTC---CCCCHHHHHHHTSGGGTCCCCEETTEESSSCCHHHHHHHHHHHHHHHHHTTCCTTTEEEECCC-SS
T ss_pred             HHCCCEEECCC---CCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECC-CC
T ss_conf             97596686467---767999999856721275557899974657760699999999999999848873347125368-86


Q ss_pred             CCHHHHHHHHHHHHCCHHHHHHHCCCHHHHH----------HHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHC-CC
Q ss_conf             7278999999997200101013105513899----------999829969998604466677666778899999850-25
Q T0591           110 TQGALFLAVAATVARGDKVAIVQPDYFANRK----------LVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK-AG  178 (406)
Q Consensus       110 ~~~~l~~~~~~l~~pGd~Vl~~~P~y~~~~~----------~~~~~g~~~v~v~~~~~~~~~~~~~~d~~~l~~~~~-~~  178 (406)
                      ++.+-..++.++++|||+|+..+..-.+|..          .+....++.+.++++     .+...+|.+++++..+ .+
T Consensus       119 Gs~An~av~~all~pgD~im~l~l~~GGHlshg~~~~~~~~~~~~~~~~~~~y~~d-----~~~~~IDyd~l~~~a~~~k  193 (483)
T 1rv3_A          119 GSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMAYKVN-----PDTGYIDYDRLEENARLFH  193 (483)
T ss_dssp             HHHHHHHHHHHHTCTTCEEEEECGGGTCCGGGCCBCSSCBCSHHHHHSEEEEECBC-----TTTCSBCHHHHHHHHHHHC
T ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEE-----CCCCCCCHHHHHHHHHHHC
T ss_conf             28888998886048998775315233555445654567776412425776689875-----1257644999999987406


Q ss_pred             CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCC-CCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCC
Q ss_conf             4034215666432334437899999999863787578417502-355688876522332102678689985040010463
Q T0591           179 ARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYS-RLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLS  257 (406)
Q Consensus       179 ~k~i~l~~P~NPTG~~~s~~~l~~i~~~a~~~~~~ii~De~Y~-~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~  257 (406)
                      +|+|++-.-++|  ..+   +.+++.++|++.|.+++.|-++- .|+-.|.-+.++.  .+ |    |+..|..|+|  +
T Consensus       194 PklIi~G~S~y~--r~~---d~~~~reIad~vga~l~~D~sHiaGLIagg~~~sPl~--~a-D----vvt~sTHKTl--r  259 (483)
T 1rv3_A          194 PKLIIAGTSCYS--RNL---DYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFE--HC-H----VVTTTTHKTL--R  259 (483)
T ss_dssp             CSEEEECCSSCC--SCC---CHHHHHHHHHHTTCEEEEECTTTHHHHHHTSSCCGGG--TC-S----EEEEESSGGG--C
T ss_pred             CCEEEECHHHCC--CCC---CHHHHHHHHHHCCCEEEECCCCHHHHHCCCCCCCHHH--HE-E----EEEEECCCCC--C
T ss_conf             654883134412--546---7799988786449759702200133210455698566--21-1----3431204212--5


Q ss_pred             CCCCHHHHHHH---------------HHHHHHHHHHHHCCCCHHHHHHHHHH-HHHHC-CCHHHHHHHHHHHHHHHHHHH
Q ss_conf             11211433258---------------99999998752036761245799999-99856-525899999999999999999
Q T0591           258 GYRLGVAFGSR---------------AIIARMEKLQAIVSLRAAGYSQAVLR-GWFDE-APGWMEDRIARHQAIRDELLH  320 (406)
Q Consensus       258 GlRiG~~~~~~---------------~~i~~l~~~~~~~~~~~~~~~q~a~~-~~l~~-~~~~~~~~~~~~~~~r~~l~~  320 (406)
                      |-|-|.+...+               ++.+.+....-....+.+...+.++. .++.+ ......+..++.-++.+.|.+
T Consensus       260 GPrgGiI~~~~~~~~~~~~~~~~~~~~~~~~i~~avFPg~qggph~~~iaa~Aval~ea~~~efk~Ya~qvv~NAk~LA~  339 (483)
T 1rv3_A          260 GCRAGMIFYRRGVRSVDPKTGKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSA  339 (483)
T ss_dssp             CCSCEEEEEECSBCC-------CCBCCHHHHHHHHHTTTTCCSCCHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             77733899704423355011004679999998644386643220056789999999997086889999999999999999


Q ss_pred             HHHHCCCCEEECC-CCCEEEEEECCCCCCCHHHHHHHHHHHCCEEE----EECCCCCCCCCCEEEEEEC------CCHHH
Q ss_conf             9972799455358-87307877668878898999999998689189----6161026799985899850------99799
Q T0591           321 VLRGCEGVFARTP-QAGSYLFPRLPKLAVAPAEFVKILRLQAGVVV----TPGTEFSPHTADSVRLNFS------QDHEA  389 (406)
Q Consensus       321 ~L~~~~g~~~~~p-~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v----~pG~~Fg~~~~~~iRis~~------~~~e~  389 (406)
                      .|.+. |+.+... .....+++++...+.+..+. +.+|++.||.+    +||+.. +-.+.-+||...      ..+++
T Consensus       340 ~L~~~-G~~v~~GgTdnHlvlvdl~~~g~~g~~a-~~~Le~~gI~~Nkn~iP~D~~-~~~~sGiRiGT~alTtrG~~e~d  416 (483)
T 1rv3_A          340 ALVEL-GYKIVTGGSDNHLILVDLRSKGTDGGRA-EKVLEACSIACNKNTCPGDKS-ALRPSGLRLGTPALTSRGLLEKD  416 (483)
T ss_dssp             HHHHT-TCEEGGGSCSSSEEEEEGGGGTCCHHHH-HHHHHHTTEECEEECCSSCSC-TTSCCEEEEECHHHHHTTCCHHH
T ss_pred             HHHHC-CCEEECCCCCCCEEEEEEHHCCCCHHHH-HHHHHHCCCEECCCCCCCCCC-CCCCCEEEECCHHHHHCCCCHHH
T ss_conf             99968-9675269887663787522118879999-999998295778785789999-99998048667899858998899


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999999
Q T0591           390 AVAAARRIVTLVE  402 (406)
Q Consensus       390 l~~al~rl~~~~~  402 (406)
                      +++-.+-|.++++
T Consensus       417 m~~iA~~I~~~l~  429 (483)
T 1rv3_A          417 FQKVAHFIHRGIE  429 (483)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 170
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- aminobutyric acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A*
Probab=99.55  E-value=2.6e-12  Score=101.12  Aligned_cols=343  Identities=11%  Similarity=0.089  Sum_probs=177.8

Q ss_pred             CCEEECC--CCCCCCCCCHHHHHHHHHHHHCCCCC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHH
Q ss_conf             8334156--78678878889999999999808788---887888898899999999998648867886707882487278
Q T0591            39 RPVDFSH--GDVDAHEPTPGAFDLFSAGVQSGGVQ---AYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGA  113 (406)
Q Consensus        39 ~~i~ls~--G~pd~~~p~~~~~~~~~~~~~~~~~~---~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~  113 (406)
                      +.|||..  |...+-+-+|.+.+++.+.+......   .+. ......+.+.+++.+......   ..+.++.++.++++
T Consensus        64 ~ylD~~~g~~~~~lGH~~p~v~~ai~~q~~~~~~~~~~~~~-~~~~~~~~~~l~~~l~~~~~~---~~~~v~f~~sGsEA  139 (472)
T 1ohv_A           64 RMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALG-ILPPENFVEKLRESLLSVAPK---GMSQLITMACGSCS  139 (472)
T ss_dssp             EEEESSHHHHTCSSCBTCHHHHHHHHCGGGHHHHHCCCCTT-TSCBTTHHHHHHHTGGGGCCT---TCCEEEEESSHHHH
T ss_pred             EEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCC-CCCHHHHHHHHHHHHHHHCCC---CCCEEEEECCCCHH
T ss_conf             99986338997766289399999999997351521143225-554699999999999864776---70248870575057


Q ss_pred             HHHHHHHHH----------------------------HCCHHHHHHHCCCHHHH-HHHHHHCC-----------EEEEEE
Q ss_conf             999999997----------------------------20010101310551389-99998299-----------699986
Q T0591           114 LFLAVAATV----------------------------ARGDKVAIVQPDYFANR-KLVEFFEG-----------EMVPVQ  153 (406)
Q Consensus       114 l~~~~~~l~----------------------------~pGd~Vl~~~P~y~~~~-~~~~~~g~-----------~~v~v~  153 (406)
                      ...++....                            .+...|+...-+|++.. ......+-           .....+
T Consensus       140 ~e~AlklAr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ii~~~~~yHG~T~gals~t~~~~~~~~~~~~~~~~~~~  219 (472)
T 1ohv_A          140 NENAFKTIFMWYRSKERGQSAFSKEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAP  219 (472)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHTTCTTTSCCCEEEEETTCCCCSSHHHHHHCCSCHHHHTTSCCCCCCEEC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             78999999999875046754211000122110024578885599967861799876433568744444554566777667


Q ss_pred             ECCCCCCCCCC--------CCCHHHHHHHHC------CCCEEEECCCC-CCCCC-CCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             04466677666--------778899999850------25403421566-64323-3443789999999986378757841
Q T0591           154 LDYVSADETRA--------GLDLTGLEEAFK------AGARVFLFSNP-NNPAG-VVYSAEEIGQIAALAARYGATVIAD  217 (406)
Q Consensus       154 ~~~~~~~~~~~--------~~d~~~l~~~~~------~~~k~i~l~~P-~NPTG-~~~s~~~l~~i~~~a~~~~~~ii~D  217 (406)
                      ..........+        ..+++++++.+.      .++.++++ -| ..-.| ...+++.+++|.++|++||+++|.|
T Consensus       220 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iAaviv-EPiqg~gG~~~~~~~fl~~lr~lc~~~gillI~D  298 (472)
T 1ohv_A          220 FPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIV-EPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVD  298 (472)
T ss_dssp             CCCCCSSGGGCHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEEEE-CSSBCTTTCBCCCHHHHHHHHHHHHHTTCEEEEE
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEE-CCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEE
T ss_conf             776445532235553046789999999999997517885689997-4542568867764577899999999738815762


Q ss_pred             CCCCCCCCCCCCCCCHHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             75023556888765223321026786899850400104631121143325899999998752036761245799999998
Q T0591           218 QLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWF  297 (406)
Q Consensus       218 e~Y~~l~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~~~~~~~~~~~~~q~a~~~~l  297 (406)
                      |++..|...|.-+..- ... ..++  ..+-+++|.++..|+=.+-++.+      ........+++.+.++..++.+.|
T Consensus       299 EV~tG~GRtG~~~a~e-~~g-v~pd--pdi~~~gkgl~~g~~~~~~~~~~------~~~~~~~~T~~gnpl~~aaa~a~L  368 (472)
T 1ohv_A          299 EVQTGGGSTGKFWAHE-HWG-LDDP--ADVMTFSKKMMTGGFFHKEEFRP------NAPYRIFNTWLGDPSKNLLLAEVI  368 (472)
T ss_dssp             CTTTTTTTTSSSSGGG-GGC-CSSC--CSEEEECGGGSSEEEEECGGGSC------SSSSSSCCSSSSCHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCHHH-HCC-CCCC--CCCCCCCCCCCCCCEEEEEEECC------CCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             4645787665732233-238-6514--66401013554232245541035------555433345788779987553377


Q ss_pred             HCC--CHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCC
Q ss_conf             565--258999999999999999999972799-45535887307877668878898999999998689189616102679
Q T0591           298 DEA--PGWMEDRIARHQAIRDELLHVLRGCEG-VFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH  374 (406)
Q Consensus       298 ~~~--~~~~~~~~~~~~~~r~~l~~~L~~~~g-~~~~~p~gg~~~w~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~  374 (406)
                      +..  +..++...+.-+..++.+.+...+.+. +.-... -|+++=+.+++. ....+++..++ ++||++.+.      
T Consensus       369 ~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~i~~VRG-~Gl~~~ie~~~~-~~~~~~~~~~~-~~Gll~~~~------  439 (472)
T 1ohv_A          369 NIIKREDLLSNAAHAGKVLLTGLLDLQARYPQFISRVRG-RGTFCSFDTPDE-SIRNKLISIAR-NKGVMLGGC------  439 (472)
T ss_dssp             HHHHHTTHHHHHHHHHHHHHHHHHHHHHHCTTTCEEEEE-ETTEEEEECSSH-HHHHHHHHHHH-HTTEECEEE------
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE-EEEEEEEECCCH-HHHHHHHHHHH-HCCEEEEEC------
T ss_conf             787052699999999999999999998568883677762-238999982887-99999999999-699599517------


Q ss_pred             CCCEEEEE--ECCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             99858998--50997999999999999999856
Q T0591           375 TADSVRLN--FSQDHEAAVAAARRIVTLVERYR  405 (406)
Q Consensus       375 ~~~~iRis--~~~~~e~l~~al~rl~~~~~~~r  405 (406)
                      +++.||+.  +..+++++++++++|.+++.++|
T Consensus       440 g~~~lr~~PpL~it~~ei~~~l~~l~~~l~el~  472 (472)
T 1ohv_A          440 GDKSIRFRPTLVFRDHHAHLFLNIFSDILADFK  472 (472)
T ss_dssp             TTTEEEECCCTTCCHHHHHHHHHHHHHHHHTC-
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             999899949977899999999999999999609


No 171
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A*
Probab=99.54  E-value=1.8e-10  Score=88.68  Aligned_cols=325  Identities=11%  Similarity=0.112  Sum_probs=185.7

Q ss_pred             HHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHH---C-----C------H
Q ss_conf             999998087888878888988999999999986488678867078824872789999999972---0-----0------1
Q T0591            61 FSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVA---R-----G------D  126 (406)
Q Consensus        61 ~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~~~~~~l~~---p-----G------d  126 (406)
                      +...+.......|--+....++-+.+.+|+.+..|.+.... .=++|+|++++...++.+.-+   |     |      =
T Consensus       112 ~l~~~~n~n~~~~~~sP~~t~lE~~vi~wl~~l~g~~~~~~-~G~~tsGgT~anl~al~~AR~~~~~~~~~~~~~~~~~~  190 (504)
T 2okj_A          112 WLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSKDG-DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKL  190 (504)
T ss_dssp             HHHHHHCCBSSCTTTCHHHHHHHHHHHHHHHHHHTCCSSSC-EEEEESSHHHHHHHHHHHHHHHHCTTHHHHCGGGSCCE
T ss_pred             HHHHHHCCCCCCHHHCHHHHHHHHHHHHHHHHHCCCCCCCC-CEEEECCHHHHHHHHHHHHHHHHCHHHHHCCCCCCCCE
T ss_conf             99998465776631080469999999999999839998888-88980864899999999999985735553175778873


Q ss_pred             HHHHHHCCCHHHHHHHHHHCC---EEEEEEECCCCCCCCCCCCCHHHHHHHHCCC------CEEEECCCCCCCCCCCCCH
Q ss_conf             010131055138999998299---6999860446667766677889999985025------4034215666432334437
Q T0591           127 KVAIVQPDYFANRKLVEFFEG---EMVPVQLDYVSADETRAGLDLTGLEEAFKAG------ARVFLFSNPNNPAGVVYSA  197 (406)
Q Consensus       127 ~Vl~~~P~y~~~~~~~~~~g~---~~v~v~~~~~~~~~~~~~~d~~~l~~~~~~~------~k~i~l~~P~NPTG~~~s~  197 (406)
                      .|++++=++++....+...|.   .++.||++      .++.+|+++|++++.+.      +-+|+.+-....||++=+ 
T Consensus       191 ~v~~S~~aH~Sv~Kaa~~lGlg~~~v~~v~~d------~~~~md~~~L~~~i~~~~~~g~~p~~VvataGTT~~GaiDp-  263 (504)
T 2okj_A          191 VLFTSEQSHYSIKKAGAALGFGTDNVILIKCN------ERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDP-  263 (504)
T ss_dssp             EEEEETTSCTHHHHHHHHTTSCGGGEEEECBC------TTSCBCHHHHHHHHHHHHHTTCEEEEEEECBSCSSSCCBCC-
T ss_pred             EEEECCCCHHHHHHHHHHCCCCCEEEEEECCC------CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCEEECC-
T ss_conf             89933622289999999749985247873458------76672899999999998856997559983278866321044-


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCC-HHHHHCCCCCCEEEEEECCHHCCCCCCCCHHHHH-HHHHHHHHH
Q ss_conf             89999999986378757841750235568887652-2332102678689985040010463112114332-589999999
Q T0591           198 EEIGQIAALAARYGATVIADQLYSRLRYAGASYTH-LRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFG-SRAIIARME  275 (406)
Q Consensus       198 ~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~-~~~~~~~~~~~~i~~~S~SK~~~~~GlRiG~~~~-~~~~i~~l~  275 (406)
                        +++|.++|++|++|+-+|-+|+.+..--..... +...   ..-..| ..++.|.+..| +=+|++.. ++.......
T Consensus       264 --l~~I~~i~~~~~~wlHVDaA~gg~~~~~~~~~~~~~gi---~~aDSi-t~d~HK~l~~p-~~~g~~l~r~~~~~~~~~  336 (504)
T 2okj_A          264 --IQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGI---ERANSV-TWNPHKMMGVL-LQCSAILVKEKGILQGCN  336 (504)
T ss_dssp             --HHHHHHHHHHHTCEEEEEETTGGGGGGCTTTGGGGTTG---GGCSEE-EECTTSTTCCC-SCCEEEEESSTTHHHHHH
T ss_pred             --HHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHCCC---CCCCEE-EECCCCCCCCC-CCCEEEECCCHHHHHHHH
T ss_conf             --99999999981986997241224200374433644796---400255-46665446757-776100137899988764


Q ss_pred             HHH-HHC----------------CCCHH----HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEE---
Q ss_conf             875-203----------------67612----457999999985652589999999999999999999727994553---
Q T0591           276 KLQ-AIV----------------SLRAA----GYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFAR---  331 (406)
Q Consensus       276 ~~~-~~~----------------~~~~~----~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~l~~~L~~~~g~~~~---  331 (406)
                      ... .+.                ++..+    .+...+....  -+.+-+++...+.-+..+.+.+.|.+.+++++.   
T Consensus       337 ~~~~~YL~~~~~~~~~~~~~~~~~~~~sR~~~alklw~~l~~--~G~~g~~~~i~~~~~lA~~l~~~l~~~~~felv~~~  414 (504)
T 2okj_A          337 QMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKA--KGTVGFENQINKCLELAEYLYAKIKNREEFEMVFNG  414 (504)
T ss_dssp             CCCCSSSCCSCCSSCGGGCCGGGSSCSSCBCCHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHTTCTTEEESSSS
T ss_pred             CCCCHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH--CCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             147201166654567777756566666731569999998731--488679999999999999999998508984897569


Q ss_pred             CCCCCEEEEEECCCCC--C-C-----------HHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEEEC---CCHHHHHHHH
Q ss_conf             5887307877668878--8-9-----------89999999986891896161026799985899850---9979999999
Q T0591           332 TPQAGSYLFPRLPKLA--V-A-----------PAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFS---QDHEAAVAAA  394 (406)
Q Consensus       332 ~p~gg~~~w~~~~~~~--~-~-----------~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis~~---~~~e~l~~al  394 (406)
                      .|+-+.-+|--.|+..  . +           ..++..+|.++ |..+...+.. ..+..++|++++   +++++++..+
T Consensus       415 ~p~~~~V~Fr~~p~~l~~~~~~~~~~~~~~~~n~~l~~~l~~~-G~~~~~~~~~-~~~~~~lR~~~~n~~tt~~did~l~  492 (504)
T 2okj_A          415 EPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAPKIKALMMES-GTTMVGYQPQ-GDKANFFRMVISNPAATQSDIDFLI  492 (504)
T ss_dssp             CCSSSCEEEEECCGGGSSCCCCHHHHHHHTTHHHHHHHHHHHH-TSCEEEEEEE-TTEEEEEEECCCCTTCCHHHHHHHH
T ss_pred             CCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC-CCEEEEEEEE-CCCCEEEEEEECCCCCCHHHHHHHH
T ss_conf             9855799997127100456653345999999999999999945-9899974170-6992899999699999999999999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999985
Q T0591           395 RRIVTLVERY  404 (406)
Q Consensus       395 ~rl~~~~~~~  404 (406)
                      +.|.++-+++
T Consensus       493 ~~i~~~a~el  502 (504)
T 2okj_A          493 EEIERLGQDL  502 (504)
T ss_dssp             HHHHHHHTC-
T ss_pred             HHHHHHHHHH
T ss_conf             9999999884


No 172
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi}
Probab=99.53  E-value=1.5e-11  Score=95.96  Aligned_cols=343  Identities=12%  Similarity=0.032  Sum_probs=185.6

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCH-HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             83341567--8678878889999999999808788887888898-89999999999864886788670788248727899
Q T0591            39 RPVDFSHG--DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDL-GIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALF  115 (406)
Q Consensus        39 ~~i~ls~G--~pd~~~p~~~~~~~~~~~~~~~~~~~Y~~~~G~~-~Lr~aia~~~~~~~g~~~~~~~~I~it~G~~~~l~  115 (406)
                      +.|||..|  ...+.+-.|.+.+++.+.+......  +...+.+ .....+++.+......   +.+.+..+++++++..
T Consensus        56 ~ylD~~~g~g~~~lGH~~p~i~~ai~~q~~~~~~~--~~~~~~~~~~~~~l~~~l~~~~~~---~~~~v~~~~SGseA~e  130 (472)
T 3hmu_A           56 EILDAMAGLWCVNIGYGRDELAEVAARQMRELPYY--NTFFKTTHVPAIALAQKLAELAPG---DLNHVFFAGGGSEAND  130 (472)
T ss_dssp             EEECTTHHHHTCTTCBCCHHHHHHHHHHHHHCSCC--CSSSSEECHHHHHHHHHHHHHSCT---TEEEEEEESSHHHHHH
T ss_pred             EEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCC--CCCCCCCCHHHHHHHHHHHHHCCC---CCCEEEECCCCCHHHH
T ss_conf             99986549997760799899999999998555773--576456679999999997764787---7587997188627999


Q ss_pred             HHHHHHH----H---CC-HHHHHHHCCCHHHH-HHHHHHCC-----------EEEEEEECCCCCCCCCCCC--------C
Q ss_conf             9999997----2---00-10101310551389-99998299-----------6999860446667766677--------8
Q T0591           116 LAVAATV----A---RG-DKVAIVQPDYFANR-KLVEFFEG-----------EMVPVQLDYVSADETRAGL--------D  167 (406)
Q Consensus       116 ~~~~~l~----~---pG-d~Vl~~~P~y~~~~-~~~~~~g~-----------~~v~v~~~~~~~~~~~~~~--------d  167 (406)
                      .++...-    .   ++ ..|+....+|++.. ......|.           .....+.....  ......        +
T Consensus       131 ~AlklAr~~~~~~g~~~r~~ii~~~~~yHG~t~~~~s~~g~~~~~~~~~~~~~~~~~~~p~~~--~~~~~~~~~~~~~~~  208 (472)
T 3hmu_A          131 TNIRMVRTYWQNKGQPEKTVIISRKNAYHGSTVASSALGGMAGMHAQSGLIPDVHHINQPNWW--AEGGDMDPEEFGLAR  208 (472)
T ss_dssp             HHHHHHHHHHHHTTCTTCCEEEEETTCCCCSSHHHHHHSCCHHHHHTTCCCSSEEEECCCCHH--HHCTTCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCHHHHHHHH
T ss_conf             999999986775499886499998368788865454457875344677888877667888754--566788837788999


Q ss_pred             HHHHHHHHC----CCCEEEECCCCCC-CCCC-CCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCC
Q ss_conf             899999850----2540342156664-3233-443789999999986378757841750235568887652233210267
Q T0591           168 LTGLEEAFK----AGARVFLFSNPNN-PAGV-VYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDA  241 (406)
Q Consensus       168 ~~~l~~~~~----~~~k~i~l~~P~N-PTG~-~~s~~~l~~i~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~  241 (406)
                      ++++++.+.    +++.+|++ -|=. =.|. ..+++.++.|.++|+++|+++|.||++..|.-.|.-+..- . ....|
T Consensus       209 ~~~l~~~i~~~~~~~vAAvi~-EPi~g~gG~~~~~~~fl~~lr~lc~~~gillI~DEV~tGfGRtG~~~a~~-~-~~v~P  285 (472)
T 3hmu_A          209 ARELEEAILELGENRVAAFIA-EPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQ-T-MGIRP  285 (472)
T ss_dssp             HHHHHHHHHHHCGGGEEEEEE-CSSBSTTTCBCCCTTHHHHHHHHHHHTTCEEEEECTTTTTTTTSSSCHHH-H-HTCCC
T ss_pred             HHHHHHHHHHHCCCCEEEEEE-CCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCC-C-CCCCC
T ss_conf             999999999738998799998-27778889835998999999999998298999603332577577787100-2-79979


Q ss_pred             CCEEEEEECCHHCCCCCCCCHHHHHHHHHHHHHHHH--HHHCCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHH
Q ss_conf             868998504001046311211433258999999987--52036761245799999998565--25899999999999999
Q T0591           242 ENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKL--QAIVSLRAAGYSQAVLRGWFDEA--PGWMEDRIARHQAIRDE  317 (406)
Q Consensus       242 ~~~i~~~S~SK~~~~~GlRiG~~~~~~~~i~~l~~~--~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~  317 (406)
                      |    +-+++|.++....-+|.++..+.+.+....-  ....+++.+.++..++.+.|+.-  +......+..-++..+.
T Consensus       286 D----iv~~gK~l~gG~~p~a~~~~~~~~~~~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~  361 (472)
T 3hmu_A          286 H----IMTIAKGLSSGYAPIGGSIVCDEVAHVIGKDEFNHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKE  361 (472)
T ss_dssp             S----EEEECGGGTTTSSCCEEEEEEHHHHHHHTTSCBCCCCTTTTCHHHHHHHHHHHHHHHHTTHHHHHHHTHHHHHHH
T ss_pred             C----EEEECCCHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             9----898898265598652115658999985167877625588999689999999999874234999999999999999


Q ss_pred             HHHHHHHCCCCEEECCCCCEEEEEECCCCC-------CC----HHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE--EC
Q ss_conf             999997279945535887307877668878-------89----899999999868918961610267999858998--50
Q T0591           318 LLHVLRGCEGVFARTPQAGSYLFPRLPKLA-------VA----PAEFVKILRLQAGVVVTPGTEFSPHTADSVRLN--FS  384 (406)
Q Consensus       318 l~~~L~~~~g~~~~~p~gg~~~w~~~~~~~-------~~----~~~~~~~Ll~~~gV~v~pG~~Fg~~~~~~iRis--~~  384 (406)
                      +.+.+.+.+.+.-.... |++.=+.+....       ..    ...+...+ .+.|+++.|+       .+.+|++  +.
T Consensus       362 l~~~~~~~~~i~~vrG~-Glm~gi~l~~~~~~~~~~~~~~~~~~~~~~~~~-~~~Gl~~~~~-------g~~l~~~PpL~  432 (472)
T 3hmu_A          362 KWEALTDHPLVGEAKIV-GMMASIALTPNKASRAKFASEPGTIGYICRERC-FANNLIMRHV-------GDRMIISPPLV  432 (472)
T ss_dssp             HHHGGGGSTTEEEEEEE-TTEEEEEECSCGGGTCCBSSCTTHHHHHHHHHH-HHTTBCCEEE-------TTEEEECCCTT
T ss_pred             HHHHHHHCCCEEEEEEC-CCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHH-HHCCEEEEEC-------CCEEEEECCCC
T ss_conf             99999628983479720-638999971574201233332238999999999-9789189525-------98899969988


Q ss_pred             CCHHHHHHHHHHHHHHHHHH
Q ss_conf             99799999999999999985
Q T0591           385 QDHEAAVAAARRIVTLVERY  404 (406)
Q Consensus       385 ~~~e~l~~al~rl~~~~~~~  404 (406)
                      .+++++++++++|.+++++.
T Consensus       433 it~~eid~~l~~l~~aL~ev  452 (472)
T 3hmu_A          433 ITPAEIDEMFVRIRKSLDEA  452 (472)
T ss_dssp             CCHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999999999999


No 173
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridoxal phosphate; HET: PLP; 1.40A {Pseudomonas putida}
Probab=99.53  E-value=1.1e-11  Score=96.97  Aligned_cols=341  Identities=13%  Similarity=0.089  Sum_probs=189.2

Q ss_pred             CCEEECCC--CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHH
Q ss_conf             83341567--86788788899999999998087888878888-9889999999999864886788670