Query         T0595 HR4403E, , 123 residues
Match_columns 123
No_of_seqs    138 out of 17387
Neff          9.3 
Searched_HMMs 11830
Date          Mon Jul  5 09:09:12 2010
Command       /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/seq/T0595.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/T0595.hhr 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09295 ChAPs:  ChAPs (Chs5p-A  99.4   1E-13 8.8E-18   87.9   8.2  105    7-111   201-305 (395)
  2 PF09295 ChAPs:  ChAPs (Chs5p-A  99.2 3.2E-11 2.7E-15   74.8  10.2  105   15-122   178-282 (395)
  3 PF04733 Coatomer_E:  Coatomer   99.2   2E-10 1.7E-14   70.7  11.3  111    2-112   161-274 (290)
  4 PF04733 Coatomer_E:  Coatomer   99.0 5.2E-09 4.4E-13   63.3  11.7  107   14-120   139-247 (290)
  5 PF06552 TOM20_plant:  Plant sp  98.9 1.9E-09 1.6E-13   65.6   7.8   99   22-120     7-126 (186)
  6 PF10300 IML2:  Putative mitoch  98.4 3.6E-07   3E-11   53.6   8.2  103    3-106   259-375 (466)
  7 PF03704 BTAD:  Bacterial trans  98.3 2.1E-06 1.7E-10   49.7   8.4   97    7-103     7-125 (146)
  8 PF10300 IML2:  Putative mitoch  98.1 8.1E-06 6.8E-10   46.6   9.6   99   18-116   240-343 (466)
  9 PF06552 TOM20_plant:  Plant sp  98.1 8.8E-07 7.5E-11   51.6   4.5   83    1-83     20-123 (186)
 10 PF05843 Suf:  Suppressor of fo  98.1 1.7E-05 1.4E-09   44.9  10.1  102    7-108     2-104 (284)
 11 PF00515 TPR_1:  Tetratricopept  97.8 5.2E-06 4.4E-10   47.5   3.8   32   75-106     2-33  (34)
 12 PF07719 TPR_2:  Tetratricopept  97.8 7.2E-06 6.1E-10   46.8   4.3   32    7-38      2-33  (34)
 13 PF00515 TPR_1:  Tetratricopept  97.8 6.8E-06 5.8E-10   46.9   4.1   34    6-39      1-34  (34)
 14 PF07719 TPR_2:  Tetratricopept  97.8 6.1E-06 5.2E-10   47.2   3.4   34   74-107     1-34  (34)
 15 PF02259 FAT:  FAT domain;  Int  97.7 0.00027 2.3E-08   38.5  11.2  119    2-120   142-304 (351)
 16 PF05843 Suf:  Suppressor of fo  97.6 0.00041 3.5E-08   37.6  10.4  106    6-111    35-144 (284)
 17 PF03704 BTAD:  Bacterial trans  97.5 4.1E-05 3.5E-09   42.8   4.8   66    4-69     60-125 (146)
 18 PF10579 Rapsyn_N:  Rapsyn N-te  97.5 8.3E-05   7E-09   41.3   6.2   68    3-70      3-73  (80)
 19 PF09986 DUF2225:  Uncharacteri  97.4 0.00027 2.2E-08   38.6   7.9   95   14-108    85-199 (214)
 20 PF04184 ST7:  ST7 protein;  In  97.4 0.00053 4.5E-08   37.0   8.9  104   14-119   176-306 (539)
 21 PF10602 RPN7:  26S proteasome   97.3 0.00066 5.5E-08   36.5   8.7  100    6-105    36-144 (177)
 22 PF04184 ST7:  ST7 protein;  In  97.3 0.00082 6.9E-08   36.0   8.9  100    1-102   197-323 (539)
 23 PF02259 FAT:  FAT domain;  Int  97.1 0.00088 7.4E-08   35.9   7.5  102    5-106   183-340 (351)
 24 PF09613 HrpB1_HrpK:  Bacterial  97.1   0.005 4.2E-07   31.9  11.4  107    3-111     7-113 (160)
 25 PF04781 DUF627:  Protein of un  96.7  0.0019 1.6E-07   34.2   6.6   93   12-104     2-108 (111)
 26 PF08424 DUF1740:  Protein of u  96.2   0.018 1.5E-06   29.1   9.0  102    3-104    69-191 (236)
 27 PF10579 Rapsyn_N:  Rapsyn N-te  95.8  0.0052 4.4E-07   31.8   4.7   64   40-103     6-72  (80)
 28 PF09613 HrpB1_HrpK:  Bacterial  95.8   0.011 9.3E-07   30.1   6.4   79   42-120    12-90  (160)
 29 PF07720 TPR_3:  Tetratricopept  95.4  0.0062 5.2E-07   31.4   4.0   31   76-106     3-35  (36)
 30 PF07720 TPR_3:  Tetratricopept  95.3   0.008 6.7E-07   30.9   4.3   33    7-39      2-36  (36)
 31 PF08631 SPO22:  Meiosis protei  95.3    0.05 4.2E-06   26.7  10.8   99    6-105    35-153 (280)
 32 PF09986 DUF2225:  Uncharacteri  95.3  0.0092 7.8E-07   30.5   4.6   67    6-72    118-197 (214)
 33 PF10602 RPN7:  26S proteasome   95.0   0.052 4.4E-06   26.6   7.7   86   21-106    11-105 (177)
 34 PF04910 DUF654:  Protein of un  94.1   0.098 8.3E-06   25.1   7.3   97    2-98     36-163 (358)
 35 PF10345 Cohesin_load:  Cohesin  93.8    0.12   1E-05   24.7   9.4   98    6-104    59-169 (608)
 36 PF10858 DUF2659:  Protein of u  93.8    0.12   1E-05   24.7   9.5  111    8-119    95-215 (220)
 37 PF10255 Paf67:  RNA polymerase  93.6   0.026 2.2E-06   28.2   3.6   59   44-103   126-193 (404)
 38 PF04781 DUF627:  Protein of un  91.6   0.096 8.1E-06   25.2   4.3   69   46-114     2-84  (111)
 39 PF04053 Coatomer_WDAD:  Coatom  91.4    0.23 1.9E-05   23.2   6.2   30   74-103   348-377 (444)
 40 PF10516 SHNi-TPR:  SHNi-TPR     90.9    0.09 7.6E-06   25.3   3.7   26   77-102     4-29  (38)
 41 PF10516 SHNi-TPR:  SHNi-TPR     90.5   0.093 7.9E-06   25.3   3.4   28    8-35      3-30  (38)
 42 PF07079 DUF1347:  Protein of u  89.5    0.18 1.5E-05   23.8   4.2   54   46-100   468-521 (549)
 43 PF11817 Foie-gras_1:  Foie gra  89.5     0.2 1.7E-05   23.6   4.4   47   58-104   169-221 (260)
 44 PF06957 COPI_C:  Coatomer (COP  89.0    0.43 3.7E-05   21.8  11.5  105    7-111   205-337 (422)
 45 PF10952 DUF2753:  Protein of u  87.0    0.29 2.5E-05   22.7   4.0   88    8-97      3-109 (140)
 46 PF04212 MIT:  MIT (microtubule  86.8    0.36   3E-05   22.2   4.3   31    5-35      4-34  (69)
 47 PF09670 Cas_Cas02710:  CRISPR-  85.9    0.67 5.7E-05   20.8   9.5  102    2-103   125-270 (379)
 48 PF11207 DUF2989:  Protein of u  83.6    0.56 4.7E-05   21.2   4.1   50   73-123   140-193 (203)
 49 PF07721 TPR_4:  Tetratricopept  82.2    0.33 2.8E-05   22.4   2.5   22   76-97      3-24  (26)
 50 PF07219 HemY_N:  HemY protein   67.0     2.6 0.00022   17.7   5.5   30   74-103    85-114 (134)
 51 PF09797 NatB_MDM20:  N-acetylt  62.8     3.2 0.00027   17.2   6.2   45   54-98    197-241 (365)
 52 PF00637 Clathrin:  Region in C  59.1     3.7 0.00032   16.9   6.3  105   14-119    15-137 (144)
 53 PF04348 LppC:  LppC putative l  56.1    0.96 8.1E-05   20.0   0.0   95   10-105    28-129 (536)
 54 PF11846 DUF3366:  Domain of un  50.4     5.3 0.00045   16.1   4.4   50   57-107   128-177 (192)
 55 PF01239 PPTA:  Protein prenylt  40.9     7.6 0.00064   15.3   2.9   26   26-51      3-28  (31)
 56 PF04190 DUF410:  Protein of un  37.6     8.6 0.00073   15.0   9.2  114    6-119    90-239 (260)
 57 PF04010 DUF357:  Protein of un  36.0     9.1 0.00077   14.8   3.8   26   74-99     35-60  (75)
 58 PF09205 DUF1955:  Domain of un  30.5      11 0.00096   14.3   4.5   61   43-103    88-149 (161)
 59 PF08311 Mad3_BUB1_I:  Mad3/BUB  26.9      13  0.0011   14.0   4.7   59   37-101    66-126 (126)
 60 PF05131 Pep3_Vps18:  Pep3/Vps1  26.3     7.9 0.00067   15.2   0.8   18   82-99    111-128 (147)
 61 PF05053 Menin:  Menin;  InterP  23.4      16  0.0013   13.6   2.9   65   39-103   276-347 (618)
 62 PF02064 MAS20:  MAS20 protein   21.2     8.1 0.00069   15.1   0.0   40   78-117    97-137 (183)

No 1  
>PF09295 ChAPs:  ChAPs (Chs5p-Arf1p-binding proteins);  InterPro: IPR015374   ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi. They physically interact with Chs3, Chs5 and the small GTPase Arf1, and they form also interactions with each other . 
Probab=99.45  E-value=1e-13  Score=87.87  Aligned_cols=105  Identities=17%  Similarity=0.163  Sum_probs=92.0

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999998707888999999988531665302334445565332111100001110000000000113346899987
Q T0595             7 LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEA   86 (123)
Q Consensus         7 ~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~   86 (123)
                      .....++..++.+++..+|+..++++|+.+|++.+++...|.+++..|++++|+..+++++.+.|.+..+|+.+|.+|..
T Consensus       201 ev~~lLArvyl~~~~e~kAi~~l~kaL~~~p~d~~LL~lqA~~Ll~k~~~~~Al~~ak~Av~l~P~~f~~W~~LA~~Yi~  280 (395)
T PF09295_consen  201 EVSSLLARVYLLMNQEQKAIELLNKALKENPNDADLLNLQAEFLLSKGKYDEALEIAKRAVELAPSDFEAWYLLAKCYIQ  280 (395)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             19999999999679999999999999984898899999999999967998999999999998298278999999999998


Q ss_pred             HCCHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             2688899999999997489968889
Q T0595            87 MKDYTKAMDVYQKALDLDSSCKEAA  111 (123)
Q Consensus        87 ~~~~~~A~~~~~~al~l~p~~~~a~  111 (123)
                      +|++++|+..++.+--..++...+.
T Consensus       281 l~d~e~AL~aLNs~P~~~~~~~~~~  305 (395)
T PF09295_consen  281 LGDFEEALLALNSCPMNTPNDKYAL  305 (395)
T ss_pred             CCCHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             6799999999984738887601376


No 2  
>PF09295 ChAPs:  ChAPs (Chs5p-Arf1p-binding proteins);  InterPro: IPR015374   ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi. They physically interact with Chs3, Chs5 and the small GTPase Arf1, and they form also interactions with each other . 
Probab=99.23  E-value=3.2e-11  Score=74.82  Aligned_cols=105  Identities=17%  Similarity=0.168  Sum_probs=95.8

Q ss_pred             HHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             99870788899999998853166530233444556533211110000111000000000011334689998726888999
Q T0595            15 ECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAM   94 (123)
Q Consensus        15 ~~~~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~   94 (123)
                      .....+++++|+..+++....+|+   +...++.+|+.+++..+|+..+.++++.+|.+...+...|..+...|++++|+
T Consensus       178 ~l~~t~~~~~A~~llekL~~~~Pe---v~~lLArvyl~~~~e~kAi~~l~kaL~~~p~d~~LL~lqA~~Ll~k~~~~~Al  254 (395)
T PF09295_consen  178 LLQLTKRLDEAIELLEKLMEQDPE---VSSLLARVYLLMNQEQKAIELLNKALKENPNDADLLNLQAEFLLSKGKYDEAL  254 (395)
T ss_pred             HHHHCCCHHHHHHHHHHHHHCCCH---HHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHH
T ss_conf             998635499999999998725971---99999999996799999999999999848988999999999999679989999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHC
Q ss_conf             9999999748996888999999997542
Q T0595            95 DVYQKALDLDSSCKEAADGYQRCMMAQY  122 (123)
Q Consensus        95 ~~~~~al~l~p~~~~a~~~l~~~~~~q~  122 (123)
                      +.+++++++.|++.+.|..+++++..+.
T Consensus       255 ~~ak~Av~l~P~~f~~W~~LA~~Yi~l~  282 (395)
T PF09295_consen  255 EIAKRAVELAPSDFEAWYLLAKCYIQLG  282 (395)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHCC
T ss_conf             9999999829827899999999999867


No 3  
>PF04733 Coatomer_E:  Coatomer epsilon subunit;  InterPro: IPR006822   Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer . While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins . For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi . Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes . Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerize, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.    This entry represents the epsilon subunit of the coatomer complex, which is involved in the regulation of intracellular protein trafficking between the endoplasmic reticulum and the Golgi complex .   More information about these proteins can be found at Protein of the Month: Clathrin .; GO: 0005198 structural molecule activity, 0005515 protein binding, 0008565 protein transporter activity, 0006461 protein complex assembly, 0006890 retrograde vesicle-mediated transport, Golgi to ER, 0030126 COPI vesicle coat
Probab=99.16  E-value=2e-10  Score=70.70  Aligned_cols=111  Identities=15%  Similarity=0.156  Sum_probs=88.1

Q ss_pred             CCHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7112899999999998707--88899999998853166530233444556533211110000111000000000011334
Q T0595             2 NPDLALEEKNKGNECFQKG--DYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTR   79 (123)
Q Consensus         2 nP~~a~~~~~~g~~~~~~~--~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~   79 (123)
                      +++........+.+.+..|  ++++|...|+...+..|.++.++.++|.|++.+|++++|+..++++++.+|++++++.+
T Consensus       161 ~~D~~l~qla~a~v~l~~g~~~~~~A~~if~el~~~~~~~~~~l~g~A~~~l~~~~~~eAe~~L~eaL~~d~~~~~~l~N  240 (290)
T PF04733_consen  161 DEDSTLTQLAEAWVNLAVGGEKYQEAFYIFEELSQKFPSTPLLLNGLAVCHLQLGRYEEAEELLEEALDKDPNDPDTLAN  240 (290)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             97459999999999998651229999999999987578978999999999988189999999999998649999899999


Q ss_pred             HHHHHHHHCCHHHH-HHHHHHHHHHCCCCHHHHH
Q ss_conf             68999872688899-9999999974899688899
Q T0595            80 KAAALEAMKDYTKA-MDVYQKALDLDSSCKEAAD  112 (123)
Q Consensus        80 lg~~~~~~~~~~~A-~~~~~~al~l~p~~~~a~~  112 (123)
                      ++.+...+|+..++ .+.+.+....+|+++-...
T Consensus       241 liv~~~~~gk~~e~~~~~l~ql~~~~p~h~~~~~  274 (290)
T PF04733_consen  241 LIVCSQHLGKPDEAAERYLSQLKQSHPEHPLLKD  274 (290)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             9999999399657899999999864888679999


No 4  
>PF04733 Coatomer_E:  Coatomer epsilon subunit;  InterPro: IPR006822   Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer . While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins . For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi . Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes . Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerize, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.    This entry represents the epsilon subunit of the coatomer complex, which is involved in the regulation of intracellular protein trafficking between the endoplasmic reticulum and the Golgi complex .   More information about these proteins can be found at Protein of the Month: Clathrin .; GO: 0005198 structural molecule activity, 0005515 protein binding, 0008565 protein transporter activity, 0006461 protein complex assembly, 0006890 retrograde vesicle-mediated transport, Golgi to ER, 0030126 COPI vesicle coat
Probab=98.96  E-value=5.2e-09  Score=63.26  Aligned_cols=107  Identities=16%  Similarity=0.060  Sum_probs=79.5

Q ss_pred             HHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH
Q ss_conf             99987078889999999885316653023344455653321--1110000111000000000011334689998726888
Q T0595            14 NECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLL--EFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYT   91 (123)
Q Consensus        14 ~~~~~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~--~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~   91 (123)
                      .++...++.+.|...+..+.+.+++........+.+.+..|  ++++|...|+...+..|.++..+..+|.+++.+|+|+
T Consensus       139 qi~l~~~r~d~A~~~l~~~~~~~~D~~l~qla~a~v~l~~g~~~~~~A~~if~el~~~~~~~~~~l~g~A~~~l~~~~~~  218 (290)
T PF04733_consen  139 QILLKMNRPDLAEKELKNMQQWDEDSTLTQLAEAWVNLAVGGEKYQEAFYIFEELSQKFPSTPLLLNGLAVCHLQLGRYE  218 (290)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHH
T ss_conf             99998386999999999977369745999999999999865122999999999998757897899999999998818999


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             99999999997489968889999999975
Q T0595            92 KAMDVYQKALDLDSSCKEAADGYQRCMMA  120 (123)
Q Consensus        92 ~A~~~~~~al~l~p~~~~a~~~l~~~~~~  120 (123)
                      +|...++++++.+|++++++-++.-+...
T Consensus       219 eAe~~L~eaL~~d~~~~~~l~Nliv~~~~  247 (290)
T PF04733_consen  219 EAEELLEEALDKDPNDPDTLANLIVCSQH  247 (290)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             99999999986499998999999999999


No 5  
>PF06552 TOM20_plant:  Plant specific mitochondrial import receptor subunit TOM20;  InterPro: IPR010547   This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins. Most mitochondrial proteins are encoded by the nuclear genome, and are synthesised in the cytosol. TOM20 is a general import receptor that binds to mitochondrial pre-sequences in the early step of protein import into the mitochondria .; GO: 0005515 protein binding, 0045040 protein import into mitochondrial outer membrane, 0005742 mitochondrial outer membrane translocase complex; PDB: 1zu2_A.
Probab=98.91  E-value=1.9e-09  Score=65.57  Aligned_cols=99  Identities=23%  Similarity=0.264  Sum_probs=83.8

Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---
Q ss_conf             88999999988531665302334445565332----------11110000111000000000011334689998726---
Q T0595            22 YPQAMKHYTEAIKRNPKDAKLYSNRAACYTKL----------LEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMK---   88 (123)
Q Consensus        22 ~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~----------~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~---   88 (123)
                      |+.|.+.++.+...+|.+++.+.+=|.+++.+          ..+++|+.-++.||.++|+.+++++++|.++...+   
T Consensus         7 FE~Ar~~ae~~y~~nP~DadnL~rWGgALlELsqf~~~~e~~~mi~dAisKlEeAL~I~P~khdAlw~lGnA~ts~afl~   86 (186)
T PF06552_consen    7 FEQARKNAEAAYARNPLDADNLTRWGGALLELSQFQQGPESKKMIEDAISKLEEALKINPDKHDALWCLGNALTSLAFLT   86 (186)
T ss_dssp             HHHHHHHHHHHHHH-TT-HHHHHH----HHHHHHHS-HHHHHHHHHHHHHHHHHHHHH-TT-HHHHHH---HHHHHHHH-
T ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999999872973489999999999999852474357999999999999998159842889999999999998864


Q ss_pred             --------CHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             --------88899999999997489968889999999975
Q T0595            89 --------DYTKAMDVYQKALDLDSSCKEAADGYQRCMMA  120 (123)
Q Consensus        89 --------~~~~A~~~~~~al~l~p~~~~a~~~l~~~~~~  120 (123)
                              .|++|..+|++++..+|+|.-.+..+..+..+
T Consensus        87 ~d~~~A~~~F~kA~~~fq~Av~~~P~Ne~YrksLe~~~ka  126 (186)
T PF06552_consen   87 PDTDEAEEYFEKAAKYFQQAVDEDPNNELYRKSLEMTAKA  126 (186)
T ss_dssp             --HHHHHHHHHHHHHHHHHHHHH-TT-HHHHHHHHHHHTH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             7677899899999999999985599708999999998766


No 6  
>PF10300 IML2:  Putative mitochondrial outer membrane protein
Probab=98.45  E-value=3.6e-07  Score=53.64  Aligned_cols=103  Identities=21%  Similarity=0.238  Sum_probs=82.5

Q ss_pred             CHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH-HCCCC----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1128999999999987078889999999885-31665----302334445565332111100001110000000000113
Q T0595             3 PDLALEEKNKGNECFQKGDYPQAMKHYTEAI-KRNPK----DAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGY   77 (123)
Q Consensus         3 P~~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai-~~~p~----~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~   77 (123)
                      |+.+.-+...|.....+|+.++|+..|+.++ .....    ...+++.+|.|+..+++|++|..++.+.++.++ ++.++
T Consensus       259 P~s~l~l~~~gr~~~~~g~~~~Ai~~~~~al~~~~~~~kQ~~~l~~fEla~~~~~~~~w~~A~~~f~~L~~~s~-WSka~  337 (466)
T PF10300_consen  259 PNSALWLFFEGRMERLKGNLEEAIELLESALDESQSEMKQLHHLCYFELAWCYMFLHDWEEAADYFERLSDESS-WSKAF  337 (466)
T ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-HHHHH
T ss_conf             99476999987999982899999999999987351106889999999999999998139999999999998184-07999


Q ss_pred             --HHHHHHHHHHCCH-------HHHHHHHHHHHHHCCC
Q ss_conf             --3468999872688-------8999999999974899
Q T0595            78 --TRKAAALEAMKDY-------TKAMDVYQKALDLDSS  106 (123)
Q Consensus        78 --~~lg~~~~~~~~~-------~~A~~~~~~al~l~p~  106 (123)
                        |..|.|+..+++.       ++|.+.+.++-.+-.+
T Consensus       338 Y~Y~~a~c~~~~~~~~~~~~~~~~a~~~~~~vp~l~~k  375 (466)
T PF10300_consen  338 YAYLAACCLLELYREEEAKEYKEKAEELFKKVPSLKQK  375 (466)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999998732320234699999999865887613


No 7  
>PF03704 BTAD:  Bacterial transcriptional activator domain;  InterPro: IPR005158   Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production.; PDB: 2fez_A 2ff4_B.
Probab=98.25  E-value=2.1e-06  Score=49.66  Aligned_cols=97  Identities=20%  Similarity=0.211  Sum_probs=82.9

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCC----------------------HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999987078889999999885316653----------------------0233444556533211110000111
Q T0595             7 LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKD----------------------AKLYSNRAACYTKLLEFQLALKDCE   64 (123)
Q Consensus         7 ~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~----------------------~~~~~~~a~~~~~~~~~~~A~~~~~   64 (123)
                      ......|......++...++..+.+++.+....                      ..++..++..+...|++++|+..++
T Consensus         7 ~~~~~~a~~~~~~~~~~~~~~~~~~al~ly~G~~L~~~~~~~W~~~~r~~l~~~~~~~~~~la~~~~~~g~~~~a~~~~~   86 (146)
T PF03704_consen    7 EALIAEARAAARAGDPEQAIELLEEALALYRGDFLPDFDDEDWVEEERERLRELYLEALERLAEALLELGDYEEALELLE   86 (146)
T ss_dssp             HHHHH---HHHH---HHHHHHHHHHHHTT----TTGGGTTSTTHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             99999999987789989999999999987089888988742899999999999999999999999988799999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             000000000011334689998726888999999999974
Q T0595            65 ECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDL  103 (123)
Q Consensus        65 ~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l  103 (123)
                      +++.++|.+..+|..+..++...|+..+|+..|+++...
T Consensus        87 ~~l~~dP~~E~~~~~lm~a~~~~G~~~~Al~~Y~~~~~~  125 (146)
T PF03704_consen   87 RALELDPYDEEAYRLLMRALARLGRRAEALRAYERLRRA  125 (146)
T ss_dssp             HHHHHSTT-HHHHHHHHHHHHHTT-HHHH---HHHHHHH
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             999878998999999999999887999999999999999


No 8  
>PF10300 IML2:  Putative mitochondrial outer membrane protein
Probab=98.15  E-value=8.1e-06  Score=46.55  Aligned_cols=99  Identities=14%  Similarity=0.052  Sum_probs=83.3

Q ss_pred             HHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHH----HHHHHHHHHHHHHHCCHHH
Q ss_conf             70788899999998853166530233444556533211110000111000-000000----0113346899987268889
Q T0595            18 QKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECI-QLEPTF----IKGYTRKAAALEAMKDYTK   92 (123)
Q Consensus        18 ~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al-~~~p~~----~~~~~~lg~~~~~~~~~~~   92 (123)
                      ...+..+|...+++.....|+++..+...|.++...|+.++|++.++.++ ......    .-.++.+|.++..+++|++
T Consensus       240 ~~~~~~~a~~lL~~~~~~yP~s~l~l~~~gr~~~~~g~~~~Ai~~~~~al~~~~~~~kQ~~~l~~fEla~~~~~~~~w~~  319 (466)
T PF10300_consen  240 LEYPLEEAEQLLDKMRERYPNSALWLFFEGRMERLKGNLEEAIELLESALDESQSEMKQLHHLCYFELAWCYMFLHDWEE  319 (466)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             66669999999999986599947699998799998289999999999998735110688999999999999999813999


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             999999999748996888999999
Q T0595            93 AMDVYQKALDLDSSCKEAADGYQR  116 (123)
Q Consensus        93 A~~~~~~al~l~p~~~~a~~~l~~  116 (123)
                      |..+|.+.++..+-+...+....-
T Consensus       320 A~~~f~~L~~~s~WSka~Y~Y~~a  343 (466)
T PF10300_consen  320 AADYFERLSDESSWSKAFYAYLAA  343 (466)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             999999999818407999999999


No 9  
>PF06552 TOM20_plant:  Plant specific mitochondrial import receptor subunit TOM20;  InterPro: IPR010547   This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins. Most mitochondrial proteins are encoded by the nuclear genome, and are synthesised in the cytosol. TOM20 is a general import receptor that binds to mitochondrial pre-sequences in the early step of protein import into the mitochondria .; GO: 0005515 protein binding, 0045040 protein import into mitochondrial outer membrane, 0005742 mitochondrial outer membrane translocase complex; PDB: 1zu2_A.
Probab=98.14  E-value=8.8e-07  Score=51.58  Aligned_cols=83  Identities=19%  Similarity=0.117  Sum_probs=64.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHC----------CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH-----------HHHHH
Q ss_conf             97112899999999998707----------8889999999885316653023344455653321-----------11100
Q T0595             1 MNPDLALEEKNKGNECFQKG----------DYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLL-----------EFQLA   59 (123)
Q Consensus         1 lnP~~a~~~~~~g~~~~~~~----------~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~-----------~~~~A   59 (123)
                      +||++++.+.+=|..+.+.-          -+++||..|++||.++|+..+++.++|.++...+           .|++|
T Consensus        20 ~nP~DadnL~rWGgALlELsqf~~~~e~~~mi~dAisKlEeAL~I~P~khdAlw~lGnA~ts~afl~~d~~~A~~~F~kA   99 (186)
T PF06552_consen   20 RNPLDADNLTRWGGALLELSQFQQGPESKKMIEDAISKLEEALKINPDKHDALWCLGNALTSLAFLTPDTDEAEEYFEKA   99 (186)
T ss_dssp             H-TT-HHHHHH----HHHHHHHS-HHHHHHHHHHHHHHHHHHHHH-TT-HHHHHH---HHHHHHHH---HHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             29734899999999999998524743579999999999999981598428899999999999988647677899899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             001110000000000113346899
Q T0595            60 LKDCEECIQLEPTFIKGYTRKAAA   83 (123)
Q Consensus        60 ~~~~~~al~~~p~~~~~~~~lg~~   83 (123)
                      ..+|++|+..+|++.-....+-.+
T Consensus       100 ~~~fq~Av~~~P~Ne~YrksLe~~  123 (186)
T PF06552_consen  100 AKYFQQAVDEDPNNELYRKSLEMT  123 (186)
T ss_dssp             HHHHHHHHHH-TT-HHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             999999985599708999999998


No 10 
>PF05843 Suf:  Suppressor of forked protein (Suf);  InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins. The Drosophila melanogaster suppressor of forked [Su(f)] protein shares homology with the Saccharomyces cerevisiae RNA14 protein and the 77 kDa subunit of Homo sapiens cleavage stimulation factor, which are proteins involved in mRNA 3' end formation. This suggests a role for Su(f) in mRNA 3' end formation in Drosophila. The su(f) gene produces three transcripts; two of them are polyadenylated at the end of the transcription unit, and one is a truncated transcript, polyadenylated in intron 4. It is thought that su(f) plays a role in the regulation of poly(A) site utilisation and the GU-rich sequence is important for this regulation to occur .; GO: 0006397 mRNA processing, 0005634 nucleus; PDB: 2ooe_A 2ond_A 2uy1_A.
Probab=98.08  E-value=1.7e-05  Score=44.90  Aligned_cols=102  Identities=17%  Similarity=0.032  Sum_probs=85.5

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999870788899999998853166530233444556533-211110000111000000000011334689998
Q T0595             7 LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTK-LLEFQLALKDCEECIQLEPTFIKGYTRKAAALE   85 (123)
Q Consensus         7 ~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~-~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~   85 (123)
                      ..|+...+...+.+..+.|-..|.+|++..+....+|..-|...+. .++.+.|...|+++++..|.+...|..-...+.
T Consensus         2 ~v~i~~~~~~~R~~g~~~aR~~f~~a~~~~~~~~~v~~~~A~~E~~~~~d~~~A~~IfE~glk~~~~~~~~~~~Yl~~l~   81 (284)
T PF05843_consen    2 LVWIQYMRFMRRNEGIEEARKVFKRARKRGRITYEVYIAYALLEYRCNKDPKRARKIFERGLKKFPKDPDFWLQYLDFLI   81 (284)
T ss_dssp             HHHHHHHHHHHHH---HHHHHHHHHHHTSTT--THHHHHHHHHHHHCT--HHHHHHHHH----S-TT-HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             78999999999834819999999999816898899999999999997799799999999999987998899999999999


Q ss_pred             HHCCHHHHHHHHHHHHHHCCCCH
Q ss_conf             72688899999999997489968
Q T0595            86 AMKDYTKAMDVYQKALDLDSSCK  108 (123)
Q Consensus        86 ~~~~~~~A~~~~~~al~l~p~~~  108 (123)
                      .+++.+.|...|++++..-|...
T Consensus        82 ~~~d~~~~R~lferai~~l~~~~  104 (284)
T PF05843_consen   82 KLNDIDNARSLFERAISSLPKEK  104 (284)
T ss_dssp             CTT-HHHHHHHHHHCHH---GGG
T ss_pred             HCCCHHHHHHHHHHHHHHCCCCH
T ss_conf             75988999999999998666632


No 11 
>PF00515 TPR_1:  Tetratricopeptide repeat;  InterPro: IPR001440   The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins , , . It mediates proteinprotein interactions and the assembly of multiprotein complexes . The TPR motif consists of 316 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding.   The X-ray structure of a domain containing three TPRs from protein phosphatase 5 revealed that TPR adopts a helixturnhelix arrangement, with adjacent TPR motifs packing in a parallel fashion, resulting in a spiral of repeating anti-parallel alpha-helices . The two helices are denoted helix A and helix B. The packing angle between helix A and helix B is ~24 within a single TPR and generates a right-handed superhelical shape. Helix A interacts with helix B and with helix A' of the next TPR. Two protein surfaces are generated: the inner concave surface is contributed to mainly by residue on helices A, and the other surface presents residues from both helices A and B. ; PDB: 2kc7_A 2kck_A 2c2l_D 2vyi_B 1ihg_A 1p5q_C 1qz2_C 1kt0_A 1kt1_A 1wao_1 ....
Probab=97.83  E-value=5.2e-06  Score=47.53  Aligned_cols=32  Identities=31%  Similarity=0.583  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCC
Q ss_conf             11334689998726888999999999974899
Q T0595            75 KGYTRKAAALEAMKDYTKAMDVYQKALDLDSS  106 (123)
Q Consensus        75 ~~~~~lg~~~~~~~~~~~A~~~~~~al~l~p~  106 (123)
                      .+|+++|.++..+|++++|+++|+++++++|+
T Consensus         2 ~~~~~~G~~~~~~~~~~~Ai~~~~~Al~l~p~   33 (34)
T PF00515_consen    2 EAYYNLGNCYFKLGDYDEAIEYYEKALELDPN   33 (34)
T ss_dssp             HHHHHHHHHHHHTTHHHHHHHHHHHHHHHSTT
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCC
T ss_conf             89999999999959989999999999977849


No 12 
>PF07719 TPR_2:  Tetratricopeptide repeat;  InterPro: IPR013105   This Pfam entry includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by IPR001440 from INTERPRO. See: , . ; PDB: 2pl2_A 2if4_A.
Probab=97.82  E-value=7.2e-06  Score=46.81  Aligned_cols=32  Identities=25%  Similarity=0.539  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCC
Q ss_conf             99999999998707888999999988531665
Q T0595             7 LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPK   38 (123)
Q Consensus         7 ~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~   38 (123)
                      ..|..+|..++.+|+|++|+.+|+++|+++|+
T Consensus         2 ~~~~~~g~~~~~~g~~~~A~~~~~~al~l~P~   33 (34)
T PF07719_consen    2 EAWYNLGYAYYKQGDYDEAIEAFEKALELDPN   33 (34)
T ss_dssp             HHHHHHHHHHHH---HHHHHHHHHHHHCCSTT
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCC
T ss_conf             89999999999958999999999999977849


No 13 
>PF00515 TPR_1:  Tetratricopeptide repeat;  InterPro: IPR001440   The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins , , . It mediates proteinprotein interactions and the assembly of multiprotein complexes . The TPR motif consists of 316 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding.   The X-ray structure of a domain containing three TPRs from protein phosphatase 5 revealed that TPR adopts a helixturnhelix arrangement, with adjacent TPR motifs packing in a parallel fashion, resulting in a spiral of repeating anti-parallel alpha-helices . The two helices are denoted helix A and helix B. The packing angle between helix A and helix B is ~24 within a single TPR and generates a right-handed superhelical shape. Helix A interacts with helix B and with helix A' of the next TPR. Two protein surfaces are generated: the inner concave surface is contributed to mainly by residue on helices A, and the other surface presents residues from both helices A and B. ; PDB: 2kc7_A 2kck_A 2c2l_D 2vyi_B 1ihg_A 1p5q_C 1qz2_C 1kt0_A 1kt1_A 1wao_1 ....
Probab=97.81  E-value=6.8e-06  Score=46.93  Aligned_cols=34  Identities=35%  Similarity=0.586  Sum_probs=24.7

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCC
Q ss_conf             8999999999987078889999999885316653
Q T0595             6 ALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKD   39 (123)
Q Consensus         6 a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~   39 (123)
                      |..|.++|.+++.+|+|++|+.+|+++|+++|++
T Consensus         1 A~~~~~~G~~~~~~~~~~~Ai~~~~~Al~l~p~~   34 (34)
T PF00515_consen    1 AEAYYNLGNCYFKLGDYDEAIEYYEKALELDPNN   34 (34)
T ss_dssp             HHHHHHHHHHHHHTTHHHHHHHHHHHHHHHSTTT
T ss_pred             CHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9899999999999599899999999999778498


No 14 
>PF07719 TPR_2:  Tetratricopeptide repeat;  InterPro: IPR013105   This Pfam entry includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by IPR001440 from INTERPRO. See: , . ; PDB: 2pl2_A 2if4_A.
Probab=97.78  E-value=6.1e-06  Score=47.17  Aligned_cols=34  Identities=26%  Similarity=0.447  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCC
Q ss_conf             0113346899987268889999999999748996
Q T0595            74 IKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSC  107 (123)
Q Consensus        74 ~~~~~~lg~~~~~~~~~~~A~~~~~~al~l~p~~  107 (123)
                      +.+|+++|.+++.+|++++|+++|+++++++|++
T Consensus         1 a~~~~~~g~~~~~~g~~~~A~~~~~~al~l~P~~   34 (34)
T PF07719_consen    1 AEAWYNLGYAYYKQGDYDEAIEAFEKALELDPNN   34 (34)
T ss_dssp             HHHHHHHHHHHHH---HHHHHHHHHHHHCCSTT-
T ss_pred             CHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9899999999999589999999999999778498


No 15 
>PF02259 FAT:  FAT domain;  InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases. Members of the family of PIK-related kinases may act as intracellular sensors that govern radial and horizontal pathways .
Probab=97.73  E-value=0.00027  Score=38.55  Aligned_cols=119  Identities=15%  Similarity=0.153  Sum_probs=94.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCC----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------
Q ss_conf             71128999999999987078889999999885316----653023344455653321111000011100000--------
Q T0595             2 NPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRN----PKDAKLYSNRAACYTKLLEFQLALKDCEECIQL--------   69 (123)
Q Consensus         2 nP~~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~----p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~--------   69 (123)
                      .++.+..|...+..+.+.|.++.|...+.++...+    +..+.+....+......|+..+|+..++..+..        
T Consensus       142 ~~~~~~~~l~~a~~aRk~g~~~~a~~~l~~~~~~~~~~~~~~~~v~~e~akllw~~g~~~~Ai~~L~~~~~~~~~~~~~~  221 (351)
T PF02259_consen  142 PEELAKTWLKFAKLARKAGRFQLAESALNRLMKLNQEDSDDDPQVFLEYAKLLWAQGEREEAIQMLEELLKNYLQKDIDS  221 (351)
T ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCEEHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             47799999999999987889899999999987036532588871219999999983796899999999997676530110


Q ss_pred             --------------------------HHHHHHHHHHHHHHHHHH------CCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             --------------------------000001133468999872------688899999999997489968889999999
Q T0595            70 --------------------------EPTFIKGYTRKAAALEAM------KDYTKAMDVYQKALDLDSSCKEAADGYQRC  117 (123)
Q Consensus        70 --------------------------~p~~~~~~~~lg~~~~~~------~~~~~A~~~~~~al~l~p~~~~a~~~l~~~  117 (123)
                                                .+..+.++..+|.-...+      ++.++++..|.++++++|+...++...+..
T Consensus       222 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~la~w~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~k~~~~~a~~  301 (351)
T PF02259_consen  222 NSDAELLSWLLENLEPINLENLEFENKKLKARAYLLLAKWCDSLRMKSSQENSDEILKLFKEAVKLDPNWEKAWHSWAKF  301 (351)
T ss_pred             CHHHHHHHHHCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             21788864200000100000000122799999999999999986432253218999999999987393039999999999


Q ss_pred             HHH
Q ss_conf             975
Q T0595           118 MMA  120 (123)
Q Consensus       118 ~~~  120 (123)
                      ...
T Consensus       302 ~~~  304 (351)
T PF02259_consen  302 NDK  304 (351)
T ss_pred             HHH
T ss_conf             999


No 16 
>PF05843 Suf:  Suppressor of forked protein (Suf);  InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins. The Drosophila melanogaster suppressor of forked [Su(f)] protein shares homology with the Saccharomyces cerevisiae RNA14 protein and the 77 kDa subunit of Homo sapiens cleavage stimulation factor, which are proteins involved in mRNA 3' end formation. This suggests a role for Su(f) in mRNA 3' end formation in Drosophila. The su(f) gene produces three transcripts; two of them are polyadenylated at the end of the transcription unit, and one is a truncated transcript, polyadenylated in intron 4. It is thought that su(f) plays a role in the regulation of poly(A) site utilisation and the GU-rich sequence is important for this regulation to occur .; GO: 0006397 mRNA processing, 0005634 nucleus; PDB: 2ooe_A 2ond_A 2uy1_A.
Probab=97.58  E-value=0.00041  Score=37.59  Aligned_cols=106  Identities=17%  Similarity=0.081  Sum_probs=90.0

Q ss_pred             HHHHHHHHHHHHH-HCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHH
Q ss_conf             8999999999987-07888999999988531665302334445565332111100001110000000000---1133468
Q T0595             6 ALEEKNKGNECFQ-KGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFI---KGYTRKA   81 (123)
Q Consensus         6 a~~~~~~g~~~~~-~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~---~~~~~lg   81 (123)
                      ...|..-|..-+. .++.+.|..-|+.+++..|.+.++|..-...+...|+.+.|-..+++++..-|...   ..|-...
T Consensus        35 ~~v~~~~A~~E~~~~~d~~~A~~IfE~glk~~~~~~~~~~~Yl~~l~~~~d~~~~R~lferai~~l~~~~~~~~l~~~~~  114 (284)
T PF05843_consen   35 YEVYIAYALLEYRCNKDPKRARKIFERGLKKFPKDPDFWLQYLDFLIKLNDIDNARSLFERAISSLPKEKQSKKLWKKYI  114 (284)
T ss_dssp             THHHHHHHHHHHHCT--HHHHHHHHH----S-TT-HHHHHHHHHHHHCTT-HHHHHHHHHHCHH---GGG-BHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             99999999999997799799999999999987998899999999999759889999999999986666325999999999


Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             999872688899999999997489968889
Q T0595            82 AALEAMKDYTKAMDVYQKALDLDSSCKEAA  111 (123)
Q Consensus        82 ~~~~~~~~~~~A~~~~~~al~l~p~~~~a~  111 (123)
                      ..-...|+.+.+...++++.++-|......
T Consensus       115 ~fE~~~G~~~~v~~v~~r~~~~~~~~~~~~  144 (284)
T PF05843_consen  115 EFESKYGDLESVRKVEKRAEELFPEDPSLE  144 (284)
T ss_dssp             HHHHH---HHHHHHHHHHHHHHTTT--HHH
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             999983989999999999999777842899


No 17 
>PF03704 BTAD:  Bacterial transcriptional activator domain;  InterPro: IPR005158   Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production.; PDB: 2fez_A 2ff4_B.
Probab=97.54  E-value=4.1e-05  Score=42.84  Aligned_cols=66  Identities=18%  Similarity=0.200  Sum_probs=52.1

Q ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             128999999999987078889999999885316653023344455653321111000011100000
Q T0595             4 DLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQL   69 (123)
Q Consensus         4 ~~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~   69 (123)
                      .....+..++..+...|++++|+..+++++..+|.+..+|..+..++...|+..+|+..|+++...
T Consensus        60 ~~~~~~~~la~~~~~~g~~~~a~~~~~~~l~~dP~~E~~~~~lm~a~~~~G~~~~Al~~Y~~~~~~  125 (146)
T PF03704_consen   60 LYLEALERLAEALLELGDYEEALELLERALELDPYDEEAYRLLMRALARLGRRAEALRAYERLRRA  125 (146)
T ss_dssp             HHHHHHHHHHHHHHH---HHHHHHHHHHHHHHSTT-HHHHHHHHHHHHHTT-HHHH---HHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             999999999999988799999999999999878998999999999999887999999999999999


No 18 
>PF10579 Rapsyn_N:  Rapsyn N-terminal myristoylation and linker region
Probab=97.53  E-value=8.3e-05  Score=41.25  Aligned_cols=68  Identities=18%  Similarity=0.302  Sum_probs=55.8

Q ss_pred             CHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             112899999999998707888999999988531665302---33444556533211110000111000000
Q T0595             3 PDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAK---LYSNRAACYTKLLEFQLALKDCEECIQLE   70 (123)
Q Consensus         3 P~~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~~~---~~~~~a~~~~~~~~~~~A~~~~~~al~~~   70 (123)
                      .+.+..+.++|..++..+++++|+..+.++++..++.++   ++.+++.+|..+|+|++++....+-|++.
T Consensus         3 q~~akq~ie~Gl~lYq~~~~~~Al~~W~kal~~~~~~~~~~~~lg~L~~A~~e~Gky~e~l~~a~~ql~la   73 (80)
T PF10579_consen    3 QDQAKQQIERGLRLYQQNQYQKALSIWRKALSKTCDPPDRFRALGYLATAYQEMGKYQEMLAFAIQQLELA   73 (80)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             06899999999999986618999999999998747908999999899999999877999999999999999


No 19 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225)
Probab=97.44  E-value=0.00027  Score=38.60  Aligned_cols=95  Identities=18%  Similarity=0.185  Sum_probs=69.5

Q ss_pred             HHHHHHCCHHHHHHHHHHHHHCC-------CCCHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHH--H----
Q ss_conf             99987078889999999885316-------653023344455653321111-------000011100000000--0----
Q T0595            14 NECFQKGDYPQAMKHYTEAIKRN-------PKDAKLYSNRAACYTKLLEFQ-------LALKDCEECIQLEPT--F----   73 (123)
Q Consensus        14 ~~~~~~~~~~~Ai~~~~~ai~~~-------p~~~~~~~~~a~~~~~~~~~~-------~A~~~~~~al~~~p~--~----   73 (123)
                      ..+-...++++|+..|..||...       ..-+.++..+|.+|..+|+.+       .|...|.++++..+.  .    
T Consensus        85 ~~~~~~r~~~~Ai~~YkLAll~~~~~~~~~s~~A~~~lriAWlYR~~~d~~~E~~~l~~Al~~y~~ay~~e~~~~~~~~~  164 (214)
T PF09986_consen   85 RDFSGERTYDEAIESYKLALLCYQLRGEKPSEKAYLYLRIAWLYRDLGDEEKEKRFLKKALEIYEKAYENESFPIEGMDE  164 (214)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHH
T ss_conf             78765477999999999999999981798489999999999999962888899999999999999998426776555118


Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCH
Q ss_conf             01133468999872688899999999997489968
Q T0595            74 IKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCK  108 (123)
Q Consensus        74 ~~~~~~lg~~~~~~~~~~~A~~~~~~al~l~p~~~  108 (123)
                      ....+.+|.+..++|++++|+..|.+++.....+.
T Consensus       165 ~~l~YLlGeL~rrlG~~~eA~~wfs~vi~~~~~s~  199 (214)
T PF09986_consen  165 ARLLYLLGELNRRLGNYEEALRWFSRVIGSKKASK  199 (214)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCC
T ss_conf             88999999999995899999999999963887887


No 20 
>PF04184 ST7:  ST7 protein;  InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene. The molecular function of this protein is uncertain.
Probab=97.39  E-value=0.00053  Score=37.03  Aligned_cols=104  Identities=12%  Similarity=0.110  Sum_probs=48.3

Q ss_pred             HHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHH---------------
Q ss_conf             9998707888999999988531665302334445565332111100001110000-------000---------------
Q T0595            14 NECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQ-------LEP---------------   71 (123)
Q Consensus        14 ~~~~~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~-------~~p---------------   71 (123)
                      ..+.+..+++.-|..-.+|++++|+-+++|..++.-.-  ....+++..++++++       .+.               
T Consensus       176 q~AWrErn~~~RIklAkkALeisP~CAdAYILLAEEea--~ti~Eae~L~kqAVkAgE~~Lrks~~~q~~g~~~e~~~rr  253 (539)
T PF04184_consen  176 QDAWRERNPKRRIKLAKKALEISPDCADAYILLAEEEA--TTINEAEELYKQAVKAGENNLRKSQFQQHQGQFHEALHRR  253 (539)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHHHHCHHHHHHCCCHHHHHHHHC
T ss_conf             99986369999999999998504443588999866530--4679999999999999987746256663211245566642


Q ss_pred             -H--HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHH
Q ss_conf             -0--0011334689998726888999999999974899--6888999999997
Q T0595            72 -T--FIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS--CKEAADGYQRCMM  119 (123)
Q Consensus        72 -~--~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l~p~--~~~a~~~l~~~~~  119 (123)
                       .  .+.+-.++|.|.-++|+.++|++.++..++..|.  +..++..+-.+++
T Consensus       254 d~~~~~y~rrrLAmcawklG~~~EAIk~~rdLlke~p~~d~l~Ir~nLie~LL  306 (539)
T PF04184_consen  254 DTNPLVYARRRLAMCAWKLGRRREAIKMMRDLLKEFPNMDNLNIRENLIEALL  306 (539)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             35236999999999999828689999999999974897313459999999999


No 21 
>PF10602 RPN7:  26S proteasome subunit RPN7
Probab=97.32  E-value=0.00066  Score=36.54  Aligned_cols=100  Identities=13%  Similarity=0.082  Sum_probs=81.6

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHH
Q ss_conf             899999999998707888999999988531665---30233444556533211110000111000000000------011
Q T0595             6 ALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPK---DAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTF------IKG   76 (123)
Q Consensus         6 a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~---~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~------~~~   76 (123)
                      ..++..+|..+.+.|+++.|+++|.++....+.   ..+++.++..+.+..+++..+.....++-..-...      ...
T Consensus        36 r~~~~~la~~Y~~iGd~~~A~~~y~~~~~~~~s~~~~id~~l~~irv~i~~~d~~~v~~~l~ka~~~~~~~~d~~~~~rl  115 (177)
T PF10602_consen   36 RMAYLDLADYYAKIGDLENALKAYERAREYCTSPGHKIDMCLNIIRVAIFFGDWDHVQKYLNKAKSLLEKGGDWERKNRL  115 (177)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             99999999999982899999999999998749878999999999999999758999999999999877705758799999


Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHCC
Q ss_conf             33468999872688899999999997489
Q T0595            77 YTRKAAALEAMKDYTKAMDVYQKALDLDS  105 (123)
Q Consensus        77 ~~~lg~~~~~~~~~~~A~~~~~~al~l~p  105 (123)
                      ..-.|..+...++|.+|.+.|-.++..-+
T Consensus       116 k~~~gl~~l~~r~f~~AA~~fl~~~~t~~  144 (177)
T PF10602_consen  116 KVYEGLYYLAQRDFKEAAELFLDSLSTFT  144 (177)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999986389999999980777656


No 22 
>PF04184 ST7:  ST7 protein;  InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene. The molecular function of this protein is uncertain.
Probab=97.29  E-value=0.00082  Score=36.05  Aligned_cols=100  Identities=20%  Similarity=0.128  Sum_probs=51.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCC-----------------------C--HHHHHHHHHHHHHHHH
Q ss_conf             97112899999999998707888999999988531665-----------------------3--0233444556533211
Q T0595             1 MNPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPK-----------------------D--AKLYSNRAACYTKLLE   55 (123)
Q Consensus         1 lnP~~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~-----------------------~--~~~~~~~a~~~~~~~~   55 (123)
                      +||+-|.+|+-++....  ....++...|.++++....                       +  +.+-..+|+|..++|+
T Consensus       197 isP~CAdAYILLAEEea--~ti~Eae~L~kqAVkAgE~~Lrks~~~q~~g~~~e~~~rrd~~~~~y~rrrLAmcawklG~  274 (539)
T PF04184_consen  197 ISPDCADAYILLAEEEA--TTINEAEELYKQAVKAGENNLRKSQFQQHQGQFHEALHRRDTNPLVYARRRLAMCAWKLGR  274 (539)
T ss_pred             CCCCCHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHHHHCHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             04443588999866530--4679999999999999987746256663211245566642352369999999999998286


Q ss_pred             HHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             11000011100000000--001133468999872688899999999997
Q T0595            56 FQLALKDCEECIQLEPT--FIKGYTRKAAALEAMKDYTKAMDVYQKALD  102 (123)
Q Consensus        56 ~~~A~~~~~~al~~~p~--~~~~~~~lg~~~~~~~~~~~A~~~~~~al~  102 (123)
                      -++||+.+...++..|.  .-..+.++-.++...+.+.++...+.+--+
T Consensus       275 ~~EAIk~~rdLlke~p~~d~l~Ir~nLie~LLe~q~yad~q~lLakYdd  323 (539)
T PF04184_consen  275 RREAIKMMRDLLKEFPNMDNLNIRENLIEALLEEQRYADVQALLAKYDD  323 (539)
T ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8999999999997489731345999999999984136999999985424


No 23 
>PF02259 FAT:  FAT domain;  InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases. Members of the family of PIK-related kinases may act as intracellular sensors that govern radial and horizontal pathways .
Probab=97.10  E-value=0.00088  Score=35.88  Aligned_cols=102  Identities=21%  Similarity=0.232  Sum_probs=79.0

Q ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCC----------------------------------CHHHHHHHHHHH
Q ss_conf             2899999999998707888999999988531665----------------------------------302334445565
Q T0595             5 LALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPK----------------------------------DAKLYSNRAACY   50 (123)
Q Consensus         5 ~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~----------------------------------~~~~~~~~a~~~   50 (123)
                      .+....+.+.....+|+-.+|+..+...+...+.                                  .+.++..+|...
T Consensus       183 ~~~v~~e~akllw~~g~~~~Ai~~L~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~la~w~  262 (351)
T PF02259_consen  183 DPQVFLEYAKLLWAQGEREEAIQMLEELLKNYLQKDIDSNSDAELLSWLLENLEPINLENLEFENKKLKARAYLLLAKWC  262 (351)
T ss_pred             CCEEHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             87121999999998379689999999999767653011021788864200000100000000122799999999999999


Q ss_pred             HHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC----------------HHHHHHHHHHHHHHCCC
Q ss_conf             332------111100001110000000000113346899987268----------------88999999999974899
Q T0595            51 TKL------LEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKD----------------YTKAMDVYQKALDLDSS  106 (123)
Q Consensus        51 ~~~------~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~----------------~~~A~~~~~~al~l~p~  106 (123)
                      ..+      +..++++..+..+++.+|++..+|+..|..+..+-.                ...|+..|-+++.+.|+
T Consensus       263 ~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~k~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~ai~~yl~al~~~~~  340 (351)
T PF02259_consen  263 DSLRMKSSQENSDEILKLFKEAVKLDPNWEKAWHSWAKFNDKLLESDKNEKERMSEDRSEFLEQAIEGYLKALSLGPK  340 (351)
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             986432253218999999999987393039999999999999998725322002268999999999999999974899


No 24 
>PF09613 HrpB1_HrpK:  Bacterial type III secretion protein (HrpB1_HrpK)
Probab=97.06  E-value=0.005  Score=31.94  Aligned_cols=107  Identities=15%  Similarity=-0.009  Sum_probs=90.8

Q ss_pred             CHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11289999999999870788899999998853166530233444556533211110000111000000000011334689
Q T0595             3 PDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAA   82 (123)
Q Consensus         3 P~~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~   82 (123)
                      +..+..++.........++.+++-..++-.--+.|+.+.+-..-|.++...|++.+|+..++...+..|.++.+--.++.
T Consensus         7 ~~~v~gLie~~~~Al~~~d~~Dae~lL~aLrvLrP~~~e~~~~~g~l~i~r~~w~eA~rvlr~l~~~~~~~~~akALlA~   86 (160)
T PF09613_consen    7 NAIVGGLIEVLSVALRLGDPDDAEALLDALRVLRPENAELDLFDGWLHIVRGNWDEAIRVLRELEEDAPCFPYAKALLAL   86 (160)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             89999999999999804988679999999986189950123778899998377899999999850468777468999999


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             99872688899999999997489968889
Q T0595            83 ALEAMKDYTKAMDVYQKALDLDSSCKEAA  111 (123)
Q Consensus        83 ~~~~~~~~~~A~~~~~~al~l~p~~~~a~  111 (123)
                      |++.+++.+- ...-.++++-++ ++++.
T Consensus        87 CL~a~~Dp~W-r~~A~~vle~~~-d~~a~  113 (160)
T PF09613_consen   87 CLFALGDPEW-RRYADEVLESGA-DPDAR  113 (160)
T ss_pred             HHHHCCCHHH-HHHHHHHHHCCC-CHHHH
T ss_conf             9986389889-999999986099-87899


No 25 
>PF04781 DUF627:  Protein of unknown function (DUF627);  InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function.
Probab=96.73  E-value=0.0019  Score=34.15  Aligned_cols=93  Identities=20%  Similarity=0.310  Sum_probs=77.7

Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHCCCCCH---HHHHHHHHHHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999870788899999998853166530---233444556533211-----------1100001110000000000113
Q T0595            12 KGNECFQKGDYPQAMKHYTEAIKRNPKDA---KLYSNRAACYTKLLE-----------FQLALKDCEECIQLEPTFIKGY   77 (123)
Q Consensus        12 ~g~~~~~~~~~~~Ai~~~~~ai~~~p~~~---~~~~~~a~~~~~~~~-----------~~~A~~~~~~al~~~p~~~~~~   77 (123)
                      ++..++..|++-+|++..+..|....++.   ..+..-|.++..+..           .-.|++++.++..+.|..+..+
T Consensus         2 ~A~~~~~~GnhiKAL~iieD~i~~h~~~~~~~~~h~~QG~if~~lA~~ten~d~K~~~l~~sVe~~s~~~~Ls~~sA~sL   81 (111)
T PF04781_consen    2 KALDYFARGNHIKALEIIEDLISKHGNDESSWLLHRLQGTIFVKLAKKTENPDVKFRYLLGSVECFSKAVELSPDSANSL   81 (111)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             27899885572999999999998711554048999999599999999715811779999998999988651287899999


Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHC
Q ss_conf             346899987268889999999999748
Q T0595            78 TRKAAALEAMKDYTKAMDVYQKALDLD  104 (123)
Q Consensus        78 ~~lg~~~~~~~~~~~A~~~~~~al~l~  104 (123)
                      +.+|.-+-...-|++++..-+++|.+.
T Consensus        82 ~~La~~l~s~~~Ykk~v~kak~aLsv~  108 (111)
T PF04781_consen   82 FELADQLGSVKYYKKAVKKAKRALSVT  108 (111)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999998713889999999999772354


No 26 
>PF08424 DUF1740:  Protein of unknown function (DUF1740);  InterPro: IPR013633   This is domain is found in eukaryotic proteins of unknown function. 
Probab=96.22  E-value=0.018  Score=29.06  Aligned_cols=102  Identities=17%  Similarity=0.178  Sum_probs=42.2

Q ss_pred             CHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH-HH--HHHHHHHHHHHHHHH----------
Q ss_conf             11289999999999870788899999998853166530233444556533-21--111000011100000----------
Q T0595             3 PDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTK-LL--EFQLALKDCEECIQL----------   69 (123)
Q Consensus         3 P~~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~~~~~~~~a~~~~~-~~--~~~~A~~~~~~al~~----------   69 (123)
                      |+...-+...=....+.-+-++-...+++++..+|.++.+|...-..... ..  .++.+...|.++|..          
T Consensus        69 p~~~~Lll~~l~~~~~~w~~~~l~~~We~~l~~~p~~~~LW~~yL~~~q~~~~~f~~~~v~~~y~~cl~~l~~~~~~~~~  148 (236)
T PF08424_consen   69 PDNERLLLGYLEEGEKLWDTKKLASRWEKVLKENPGSYSLWREYLDFRQGDFSRFTVEDVRKIYEKCLRSLSAAQDGEIT  148 (236)
T ss_pred             CCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99799999999999872788999999999999879981899999999973101563999999999999998774035444


Q ss_pred             --------HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHC
Q ss_conf             --------00000113346899987268889999999999748
Q T0595            70 --------EPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLD  104 (123)
Q Consensus        70 --------~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l~  104 (123)
                              +......+.++.....+.|..+.|+..++-.++++
T Consensus       149 ~~~~~~~~e~~~l~lflr~~~flrqaG~~E~A~al~QA~lE~n  191 (236)
T PF08424_consen  149 SHPDSPELEEIMLYLFLRLCLFLRQAGHTERAVALWQALLEFN  191 (236)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             5666530468999999999999998595999999999999887


No 27 
>PF10579 Rapsyn_N:  Rapsyn N-terminal myristoylation and linker region
Probab=95.80  E-value=0.0052  Score=31.82  Aligned_cols=64  Identities=19%  Similarity=0.169  Sum_probs=52.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             0233444556533211110000111000000000---011334689998726888999999999974
Q T0595            40 AKLYSNRAACYTKLLEFQLALKDCEECIQLEPTF---IKGYTRKAAALEAMKDYTKAMDVYQKALDL  103 (123)
Q Consensus        40 ~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~---~~~~~~lg~~~~~~~~~~~A~~~~~~al~l  103 (123)
                      +.-+..+|.-++..+++++|+..++++++..++.   ..++-.++.+|..+|+|.+++..-.+-+++
T Consensus         6 akq~ie~Gl~lYq~~~~~~Al~~W~kal~~~~~~~~~~~~lg~L~~A~~e~Gky~e~l~~a~~ql~l   72 (80)
T PF10579_consen    6 AKQQIERGLRLYQQNQYQKALSIWRKALSKTCDPPDRFRALGYLATAYQEMGKYQEMLAFAIQQLEL   72 (80)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999998661899999999999874790899999989999999987799999999999999


No 28 
>PF09613 HrpB1_HrpK:  Bacterial type III secretion protein (HrpB1_HrpK)
Probab=95.79  E-value=0.011  Score=30.12  Aligned_cols=79  Identities=11%  Similarity=-0.053  Sum_probs=40.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             3344455653321111000011100000000001133468999872688899999999997489968889999999975
Q T0595            42 LYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMA  120 (123)
Q Consensus        42 ~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l~p~~~~a~~~l~~~~~~  120 (123)
                      .+.....+-+..++.+++...+.-.--+.|..+..-..-|.+++..|+|.+|+..|+.+.+-.|.++-+.-.++-|+.+
T Consensus        12 gLie~~~~Al~~~d~~Dae~lL~aLrvLrP~~~e~~~~~g~l~i~r~~w~eA~rvlr~l~~~~~~~~~akALlA~CL~a   90 (160)
T PF09613_consen   12 GLIEVLSVALRLGDPDDAEALLDALRVLRPENAELDLFDGWLHIVRGNWDEAIRVLRELEEDAPCFPYAKALLALCLFA   90 (160)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             9999999998049886799999999861899501237788999983778999999998504687774689999999986


No 29 
>PF07720 TPR_3:  Tetratricopeptide repeat;  InterPro: IPR011716   This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones .; PDB: 2vgx_B 2vgy_A.
Probab=95.44  E-value=0.0062  Score=31.43  Aligned_cols=31  Identities=32%  Similarity=0.424  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHCCHHHHHHHHH--HHHHHCCC
Q ss_conf             13346899987268889999999--99974899
Q T0595            76 GYTRKAAALEAMKDYTKAMDVYQ--KALDLDSS  106 (123)
Q Consensus        76 ~~~~lg~~~~~~~~~~~A~~~~~--~al~l~p~  106 (123)
                      .|+.+|..+..+|++++|++.|+  .++.++|+
T Consensus         3 ~l~~la~~~~~~g~y~~A~~~~qy~~~~~l~~~   35 (36)
T PF07720_consen    3 SLYALAYAYYQQGKYDEAIEYYQYRQALNLDPE   35 (36)
T ss_dssp             HHHHHHHHHHH---HHHHHHHHH--HHHHHTTT
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCC
T ss_conf             899999999987359999999889999876766


No 30 
>PF07720 TPR_3:  Tetratricopeptide repeat;  InterPro: IPR011716   This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones .; PDB: 2vgx_B 2vgy_A.
Probab=95.35  E-value=0.008  Score=30.87  Aligned_cols=33  Identities=21%  Similarity=0.449  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHH--HHHHCCCCC
Q ss_conf             999999999987078889999999--885316653
Q T0595             7 LEEKNKGNECFQKGDYPQAMKHYT--EAIKRNPKD   39 (123)
Q Consensus         7 ~~~~~~g~~~~~~~~~~~Ai~~~~--~ai~~~p~~   39 (123)
                      +.+..+|..++.+|+|++|+..|+  .++.++|+|
T Consensus         2 ~~l~~la~~~~~~g~y~~A~~~~qy~~~~~l~~~n   36 (36)
T PF07720_consen    2 ESLYALAYAYYQQGKYDEAIEYYQYRQALNLDPEN   36 (36)
T ss_dssp             HHHHHHHHHHHH---HHHHHHHHH--HHHHHTTT-
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             68999999999873599999998899998767669


No 31 
>PF08631 SPO22:  Meiosis protein SPO22/ZIP4 like;  InterPro: IPR013940    SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis . It is also involved in sporulation  
Probab=95.33  E-value=0.05  Score=26.70  Aligned_cols=99  Identities=21%  Similarity=0.186  Sum_probs=70.2

Q ss_pred             HHHHHHHHHHHHHHC-CHHHHHHHHHHHHHCCCC-------C-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
Q ss_conf             899999999998707-888999999988531665-------3-------02334445565332111100001110000--
Q T0595             6 ALEEKNKGNECFQKG-DYPQAMKHYTEAIKRNPK-------D-------AKLYSNRAACYTKLLEFQLALKDCEECIQ--   68 (123)
Q Consensus         6 a~~~~~~g~~~~~~~-~~~~Ai~~~~~ai~~~p~-------~-------~~~~~~~a~~~~~~~~~~~A~~~~~~al~--   68 (123)
                      +..+++.|...+..+ +|+.|+..+++++++-+.       .       ..++..++.+++..+.++.... +..++.  
T Consensus        35 a~~~y~~G~s~l~~~~~~~~A~~wL~~a~d~l~~~~~~~~~~~~~~eLr~~vL~~La~a~l~~~~~~s~~k-~~~~l~~l  113 (280)
T PF08631_consen   35 ARVCYNIGKSLLEKRNDYSDAVKWLQRAYDYLEKLAEMDQDSPEYSELRFSVLRLLAKAYLQWNTYESYLK-CINVLRLL  113 (280)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHH-HHHHHHHH
T ss_conf             99999999999975488899999999999987355423567864887999999999999954687112999-99999998


Q ss_pred             --HHHHHHHHHHHHHHHHHH-HCCHHHHHHHHHHHHHHCC
Q ss_conf             --000000113346899987-2688899999999997489
Q T0595            69 --LEPTFIKGYTRKAAALEA-MKDYTKAMDVYQKALDLDS  105 (123)
Q Consensus        69 --~~p~~~~~~~~lg~~~~~-~~~~~~A~~~~~~al~l~p  105 (123)
                        -.|+.+..++..=.+... .++..++.+.+.+.+..-.
T Consensus       114 ~~e~~~~~~~~~L~l~~l~~~~~~~~~~~~~L~~mi~~~~  153 (280)
T PF08631_consen  114 EKEYPNKPELYLLALEILKKESGDEEEAEDELMRMIRNVD  153 (280)
T ss_pred             HHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCC
T ss_conf             7636777413786699986257745789999999986255


No 32 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225)
Probab=95.31  E-value=0.0092  Score=30.54  Aligned_cols=67  Identities=18%  Similarity=0.121  Sum_probs=41.8

Q ss_pred             HHHHHHHHHHHHHHCC-------HHHHHHHHHHHHHCCCC--C----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8999999999987078-------88999999988531665--3----023344455653321111000011100000000
Q T0595             6 ALEEKNKGNECFQKGD-------YPQAMKHYTEAIKRNPK--D----AKLYSNRAACYTKLLEFQLALKDCEECIQLEPT   72 (123)
Q Consensus         6 a~~~~~~g~~~~~~~~-------~~~Ai~~~~~ai~~~p~--~----~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~   72 (123)
                      |..+..+|..+...|+       +..|...|.++++.+..  .    ..+.+.+|.....+|++++|+..+.+++.....
T Consensus       118 A~~~lriAWlYR~~~d~~~E~~~l~~Al~~y~~ay~~e~~~~~~~~~~~l~YLlGeL~rrlG~~~eA~~wfs~vi~~~~~  197 (214)
T PF09986_consen  118 AYLYLRIAWLYRDLGDEEKEKRFLKKALEIYEKAYENESFPIEGMDEARLLYLLGELNRRLGNYEEALRWFSRVIGSKKA  197 (214)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCC
T ss_conf             99999999999962888899999999999999998426776555118889999999999958999999999999638878


No 33 
>PF10602 RPN7:  26S proteasome subunit RPN7
Probab=95.03  E-value=0.052  Score=26.59  Aligned_cols=86  Identities=16%  Similarity=0.134  Sum_probs=65.7

Q ss_pred             CHHHHHHHHHHHHHCCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHCCHH
Q ss_conf             888999999988531665------302334445565332111100001110000000---00011334689998726888
Q T0595            21 DYPQAMKHYTEAIKRNPK------DAKLYSNRAACYTKLLEFQLALKDCEECIQLEP---TFIKGYTRKAAALEAMKDYT   91 (123)
Q Consensus        21 ~~~~Ai~~~~~ai~~~p~------~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p---~~~~~~~~lg~~~~~~~~~~   91 (123)
                      ..++.+..++..|+-..+      -..++..+|..|...|+++.|+..|.++.+...   .-.+.++++-.+....+++.
T Consensus        11 ~~~~~~~~L~~~lk~~~~n~~~e~ir~~~~~la~~Y~~iGd~~~A~~~y~~~~~~~~s~~~~id~~l~~irv~i~~~d~~   90 (177)
T PF10602_consen   11 KNQEELEELEAELKDAKENLGKESIRMAYLDLADYYAKIGDLENALKAYERAREYCTSPGHKIDMCLNIIRVAIFFGDWD   90 (177)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             99999999999999998713609999999999999998289999999999999874987899999999999999975899


Q ss_pred             HHHHHHHHHHHHCCC
Q ss_conf             999999999974899
Q T0595            92 KAMDVYQKALDLDSS  106 (123)
Q Consensus        92 ~A~~~~~~al~l~p~  106 (123)
                      .+...+.++-.+-..
T Consensus        91 ~v~~~l~ka~~~~~~  105 (177)
T PF10602_consen   91 HVQKYLNKAKSLLEK  105 (177)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             999999999987770


No 34 
>PF04910 DUF654:  Protein of unknown function, DUF654;  InterPro: IPR006994   This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs , .    Human Nulp1 (Q2MK75 from SWISSPROT) is a basic helix-loop-helix protein expressed broadly during early embryonic organogenesis. Over expression of human Nulp1 in COS-7 cells inhibits the transcriptional activity of serum response factor (SRF), suggesting that Nulp1 may act as a novel bHLH transcriptional repressor in the SRF signalling pathway to mediate cellular functions . 
Probab=94.08  E-value=0.098  Score=25.14  Aligned_cols=97  Identities=18%  Similarity=0.109  Sum_probs=55.6

Q ss_pred             CCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHC--------------C------------CCCHH---HHHHHHHHHHH
Q ss_conf             7112899999999998707888999999988531--------------6------------65302---33444556533
Q T0595             2 NPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKR--------------N------------PKDAK---LYSNRAACYTK   52 (123)
Q Consensus         2 nP~~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~--------------~------------p~~~~---~~~~~a~~~~~   52 (123)
                      +|-.+..+..++.++..+|++..|-+..++||-.              +            ++|-.   ++..-...+.+
T Consensus        36 ~PYHvdsLLqls~i~~~~gd~~~a~~lieraL~~~e~~~h~~F~~~~~~~~~g~~rL~~~~~eNR~fflaL~r~i~~L~~  115 (358)
T PF04910_consen   36 NPYHVDSLLQLSEIYRRQGDHAMANDLIERALFAFERAFHPSFSPFFSNLTSGNCRLDYRRPENRQFFLALFRYIQNLGR  115 (358)
T ss_pred             CCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             99838999999999998588999999999999999876445443211456778631687643467999999999999985


Q ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHH-HHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             21111000011100000000-0011-3346899987268889999999
Q T0595            53 LLEFQLALKDCEECIQLEPT-FIKG-YTRKAAALEAMKDYTKAMDVYQ   98 (123)
Q Consensus        53 ~~~~~~A~~~~~~al~~~p~-~~~~-~~~lg~~~~~~~~~~~A~~~~~   98 (123)
                      .|-+..|.+.|+..+++||. ++-+ .+.+-....+.++|+-=+...+
T Consensus       116 RGc~rTALE~~KLLLSLDp~~DP~g~ll~ID~~ALrs~ey~~Li~f~~  163 (358)
T PF04910_consen  116 RGCWRTALEWCKLLLSLDPDEDPLGALLCIDYYALRSKEYDWLIDFSE  163 (358)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             663999999999998169998835229999999985487889999998


No 35 
>PF10345 Cohesin_load:  Cohesin loading factor
Probab=93.84  E-value=0.12  Score=24.71  Aligned_cols=98  Identities=20%  Similarity=0.085  Sum_probs=46.3

Q ss_pred             HHHHHHHHH-HHHHHCCHHHHHHHHHHHHHCCCC--CHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHH
Q ss_conf             899999999-998707888999999988531665--302----3344455653321111000011100000000---001
Q T0595             6 ALEEKNKGN-ECFQKGDYPQAMKHYTEAIKRNPK--DAK----LYSNRAACYTKLLEFQLALKDCEECIQLEPT---FIK   75 (123)
Q Consensus         6 a~~~~~~g~-~~~~~~~~~~Ai~~~~~ai~~~p~--~~~----~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~---~~~   75 (123)
                      +.....+|. .+.+..++++|..++++++.+...  ..+    +...++.++.+.|... |+..++++|+.-.+   +..
T Consensus        59 a~~~l~la~iL~~eT~n~~~Ae~~L~k~~~l~~~~~l~d~k~~~~~Ll~~~~~k~~~~~-a~~~l~~~i~~~~~~~~~~~  137 (608)
T PF10345_consen   59 AKTRLRLARILLEETENLDLAETYLSKAILLCEQNGLFDLKFRCEFLLARIYQKTNPKA-ALKNLNKCIEDYENYGHSAW  137 (608)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCHHH-HHHHHHHHHHHHHCCCHHHH
T ss_conf             99999999999998268999999999998762268828899999999999998619488-99999999998753324369


Q ss_pred             HH---HHHHHHHHHHCCHHHHHHHHHHHHHHC
Q ss_conf             13---346899987268889999999999748
Q T0595            76 GY---TRKAAALEAMKDYTKAMDVYQKALDLD  104 (123)
Q Consensus        76 ~~---~~lg~~~~~~~~~~~A~~~~~~al~l~  104 (123)
                      .|   +.+.......+++..|.+.++....+.
T Consensus       138 ~~~f~~l~i~l~l~~~d~~~A~~~L~~~~~~a  169 (608)
T PF10345_consen  138 VWAFRFLRIQLALAHKDYQRALEILQKLSQLA  169 (608)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             99999999999984168999999999999875


No 36 
>PF10858 DUF2659:  Protein of unknown function (DUF2659)
Probab=93.80  E-value=0.12  Score=24.68  Aligned_cols=111  Identities=13%  Similarity=0.138  Sum_probs=83.6

Q ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HH---HHHHHH
Q ss_conf             9999999998707888999999988531--6653023344455653321111000011100000-----00---000113
Q T0595             8 EEKNKGNECFQKGDYPQAMKHYTEAIKR--NPKDAKLYSNRAACYTKLLEFQLALKDCEECIQL-----EP---TFIKGY   77 (123)
Q Consensus         8 ~~~~~g~~~~~~~~~~~Ai~~~~~ai~~--~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~-----~p---~~~~~~   77 (123)
                      +..+..-...+.|+|-++.+.+++.+..  .|+....|..++.|++-..+...-+++-.+.++.     +|   -++.+-
T Consensus        95 A~Leqva~ki~~~~~~e~k~l~n~Iia~k~ysei~~~yarI~~~~l~iDd~nl~~~dk~Kl~k~l~~~~d~~~pfwatA~  174 (220)
T PF10858_consen   95 AALEQVAIKISQGKFSEAKELLNKIIANKEYSEISTSYARIAWCALVIDDQNLDIDDKEKLVKYLNYFDDPKKPFWATAT  174 (220)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHH
T ss_conf             99999999972033278999999998521257999999999989961137887756699999985301587751799999


Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             346899987268889999999999748996888999999997
Q T0595            78 TRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMM  119 (123)
Q Consensus        78 ~~lg~~~~~~~~~~~A~~~~~~al~l~p~~~~a~~~l~~~~~  119 (123)
                      .-+|..-.+.|+..+|.+.|+..+.-.-.+... ..-++++.
T Consensus       175 i~~ai~~~k~~~~~~A~k~l~~l~~s~~~s~~l-kdqAk~ll  215 (220)
T PF10858_consen  175 IIKAIWDIKNNMKDQAEKYLKNLLASNNVSDNL-KDQAKALL  215 (220)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHH-HHHHHHHH
T ss_conf             999999987499169999999998844357788-88999998


No 37 
>PF10255 Paf67:  RNA polymerase I-associated factor PAF67
Probab=93.60  E-value=0.026  Score=28.17  Aligned_cols=59  Identities=20%  Similarity=0.229  Sum_probs=37.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             444556533211110000111000000---------000011334689998726888999999999974
Q T0595            44 SNRAACYTKLLEFQLALKDCEECIQLE---------PTFIKGYTRKAAALEAMKDYTKAMDVYQKALDL  103 (123)
Q Consensus        44 ~~~a~~~~~~~~~~~A~~~~~~al~~~---------p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l  103 (123)
                      ..+..++--+|+|..|+...+- |+++         |.+...++..|-+|+.+++|.+|+..|.+++-.
T Consensus       126 igLlRlhvLLGDY~~Alk~l~~-idl~~~~l~~~V~~~~vs~~Y~vGFaYlMlrRY~DAir~f~~iL~y  193 (404)
T PF10255_consen  126 IGLLRLHVLLGDYYTALKVLEP-IDLNKKGLYSKVPACHVSTYYYVGFAYLMLRRYNDAIRIFSQILLY  193 (404)
T ss_pred             HHHHHHHHHHCCHHHHHHHHHC-CCCCCCCCCCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999998750476999997612-6833020124565403674208889999997799999999999999


No 38 
>PF04781 DUF627:  Protein of unknown function (DUF627);  InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function.
Probab=91.58  E-value=0.096  Score=25.20  Aligned_cols=69  Identities=13%  Similarity=0.051  Sum_probs=41.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHCC-----------HHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             45565332111100001110000000000---113346899987268-----------8899999999997489968889
Q T0595            46 RAACYTKLLEFQLALKDCEECIQLEPTFI---KGYTRKAAALEAMKD-----------YTKAMDVYQKALDLDSSCKEAA  111 (123)
Q Consensus        46 ~a~~~~~~~~~~~A~~~~~~al~~~p~~~---~~~~~lg~~~~~~~~-----------~~~A~~~~~~al~l~p~~~~a~  111 (123)
                      ++.-++..|++-+|+...+..+.....+.   ..+...|.++..+..           .-.|+++|.++..+-|......
T Consensus         2 ~A~~~~~~GnhiKAL~iieD~i~~h~~~~~~~~~h~~QG~if~~lA~~ten~d~K~~~l~~sVe~~s~~~~Ls~~sA~sL   81 (111)
T PF04781_consen    2 KALDYFARGNHIKALEIIEDLISKHGNDESSWLLHRLQGTIFVKLAKKTENPDVKFRYLLGSVECFSKAVELSPDSANSL   81 (111)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             27899885572999999999998711554048999999599999999715811779999998999988651287899999


Q ss_pred             HHH
Q ss_conf             999
Q T0595           112 DGY  114 (123)
Q Consensus       112 ~~l  114 (123)
                      ..+
T Consensus        82 ~~L   84 (111)
T PF04781_consen   82 FEL   84 (111)
T ss_pred             HHH
T ss_conf             999


No 39 
>PF04053 Coatomer_WDAD:  Coatomer WD associated region ;  InterPro: IPR006692   Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer . While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins . For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi . Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes . Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerize, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.    This entry represents the WD-associated region found in coatomer subunits alpha, beta and beta' subunits. The alpha-subunit (RET1P) of the coatomer complex in Saccharomyces cerevisiae (Baker's yeast), participates in membrane transport between the endoplasmic reticulum and Golgi apparatus. The protein contains six WD-40 repeat motifs in its N-terminal region .   More information about these proteins can be found at Protein of the Month: Clathrin .; GO: 0005198 structural molecule activity, 0005515 protein binding, 0008565 protein transporter activity, 0006461 protein complex assembly, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030117 membrane coat
Probab=91.44  E-value=0.23  Score=23.21  Aligned_cols=30  Identities=27%  Similarity=0.327  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             011334689998726888999999999974
Q T0595            74 IKGYTRKAAALEAMKDYTKAMDVYQKALDL  103 (123)
Q Consensus        74 ~~~~~~lg~~~~~~~~~~~A~~~~~~al~l  103 (123)
                      +.-|-++|......|+++-|.++|+++-+.
T Consensus       348 ~~~Wk~Lg~~AL~~g~~~lAe~c~~k~~d~  377 (444)
T PF04053_consen  348 PEKWKRLGDAALKQGNFELAEECYQKAKDF  377 (444)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHCH
T ss_conf             889999999999859969999999975062


No 40 
>PF10516 SHNi-TPR:  SHNi-TPR
Probab=90.91  E-value=0.09  Score=25.33  Aligned_cols=26  Identities=23%  Similarity=0.418  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             33468999872688899999999997
Q T0595            77 YTRKAAALEAMKDYTKAMDVYQKALD  102 (123)
Q Consensus        77 ~~~lg~~~~~~~~~~~A~~~~~~al~  102 (123)
                      |..+|.+....++|.+|+.+|+++|+
T Consensus         4 ~~~LGeisle~e~f~qA~~D~~~aL~   29 (38)
T PF10516_consen    4 YDLLGEISLENENFEQAIEDYEKALE   29 (38)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             99878899885569999999999999


No 41 
>PF10516 SHNi-TPR:  SHNi-TPR
Probab=90.48  E-value=0.093  Score=25.27  Aligned_cols=28  Identities=18%  Similarity=0.325  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             9999999998707888999999988531
Q T0595             8 EEKNKGNECFQKGDYPQAMKHYTEAIKR   35 (123)
Q Consensus         8 ~~~~~g~~~~~~~~~~~Ai~~~~~ai~~   35 (123)
                      .+..+|.+.+..++|++|+..|.++|.+
T Consensus         3 ~~~~LGeisle~e~f~qA~~D~~~aL~i   30 (38)
T PF10516_consen    3 CYDLLGEISLENENFEQAIEDYEKALEI   30 (38)
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             9998788998855699999999999999


No 42 
>PF07079 DUF1347:  Protein of unknown function (DUF1347);  InterPro: IPR010764   This family consists of several hypothetical bacterial proteins of around 610 residues in length. Members of this family are highly conserved and seem to be specific to Chlamydia species. The function of this family is unknown.
Probab=89.50  E-value=0.18  Score=23.76  Aligned_cols=54  Identities=15%  Similarity=0.081  Sum_probs=44.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
Q ss_conf             4556533211110000111000000000011334689998726888999999999
Q T0595            46 RAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKA  100 (123)
Q Consensus        46 ~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~a  100 (123)
                      =|.-++.+|+|.+|+-+-...-++.| ++.++-.+|.++...+.|.+|.+++...
T Consensus       468 DAeyLfs~gdY~kCy~YS~WLtkvaP-S~~~yrLlGLcL~enK~Y~EAwe~l~~L  521 (549)
T PF07079_consen  468 DAEYLFSQGDYHKCYLYSLWLTKVAP-SPLAYRLLGLCLLENKEYLEAWEYLHKL  521 (549)
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             48999744770030535988987289-6889999878885106589999999748


No 43 
>PF11817 Foie-gras_1:  Foie gras liver health family 1
Probab=89.49  E-value=0.2  Score=23.56  Aligned_cols=47  Identities=15%  Similarity=0.024  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHC
Q ss_conf             000011100000000------00113346899987268889999999999748
Q T0595            58 LALKDCEECIQLEPT------FIKGYTRKAAALEAMKDYTKAMDVYQKALDLD  104 (123)
Q Consensus        58 ~A~~~~~~al~~~p~------~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l~  104 (123)
                      ..++.+.+|++.-..      -...-..+|..|+..|+++.|++.|+.+....
T Consensus       169 ~iI~lL~~A~~~f~~~~~~R~~~~l~~~mA~ey~~~g~~~~A~~~l~~~~~~y  221 (260)
T PF11817_consen  169 LIIELLEKAYEQFKKRGQQRMASYLSLEMAEEYMRLGDYDKALKLLEPVALSY  221 (260)
T ss_pred             HHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             99999999999998722155999999999999998689999999999999999


No 44 
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714   Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer . While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins . For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi . Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes . Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerize, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.    This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit , . This domain is found along with the IPR006692 from INTERPRO domain.   More information about these proteins can be found at Protein of the Month: Clathrin .; GO: 0005198 structural molecule activity, 0005515 protein binding, 0008565 protein transporter activity, 0006461 protein complex assembly, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat
Probab=89.01  E-value=0.43  Score=21.77  Aligned_cols=105  Identities=17%  Similarity=0.172  Sum_probs=64.3

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCH--------HH--HHHHHH-------HHHHHHHHH-HHHHHHHHH--
Q ss_conf             9999999999870788899999998853166530--------23--344455-------653321111-000011100--
Q T0595             7 LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDA--------KL--YSNRAA-------CYTKLLEFQ-LALKDCEEC--   66 (123)
Q Consensus         7 ~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~~--------~~--~~~~a~-------~~~~~~~~~-~A~~~~~~a--   66 (123)
                      ......|..++..|+|.+|+..|...|..-|-..        .+  +..++.       |.+...... ....+-.+.  
T Consensus       205 ~~~Lk~gyk~~t~gKf~eAl~~Fr~iL~~i~l~~v~~~~E~~e~~~li~icreYilal~iEl~Rr~l~~~~~~~~kR~lE  284 (422)
T PF06957_consen  205 EEKLKEGYKLTTAGKFEEALEIFRSILHSIPLLVVESEEEVDEAKELIEICREYILALSIELERRELPKDDVEDQKRNLE  284 (422)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             99999999998637799999999999997615661667779999999999999999998999985024563667899999


Q ss_pred             -------HHHHHHHHHHHHHHHH-HHHHHCCHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             -------0000000011334689-99872688899999999997489968889
Q T0595            67 -------IQLEPTFIKGYTRKAA-ALEAMKDYTKAMDVYQKALDLDSSCKEAA  111 (123)
Q Consensus        67 -------l~~~p~~~~~~~~lg~-~~~~~~~~~~A~~~~~~al~l~p~~~~a~  111 (123)
                             .+++|.+-..-++.|. ..++.++|.-|...-++.|++.|+-..+.
T Consensus       285 LaaYFT~~~Lqp~H~~LaLr~AM~~a~K~KNy~tAa~fA~rLLel~p~~~~ae  337 (422)
T PF06957_consen  285 LAAYFTHCKLQPSHRILALRSAMSLAFKNKNYKTAASFARRLLELNPSPEVAE  337 (422)
T ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99997327875899999999999999985219999999999986289778999


No 45 
>PF10952 DUF2753:  Protein of unknown function (DUF2753)
Probab=87.02  E-value=0.29  Score=22.66  Aligned_cols=88  Identities=17%  Similarity=0.184  Sum_probs=56.7

Q ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCC---------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH----
Q ss_conf             99999999987078889999999885316653---------------02334445565332111100001110000----
Q T0595             8 EEKNKGNECFQKGDYPQAMKHYTEAIKRNPKD---------------AKLYSNRAACYTKLLEFQLALKDCEECIQ----   68 (123)
Q Consensus         8 ~~~~~g~~~~~~~~~~~Ai~~~~~ai~~~p~~---------------~~~~~~~a~~~~~~~~~~~A~~~~~~al~----   68 (123)
                      .+-.+|+.+++.+++-.||.+|.+|+.+..+-               +....|+|..+..+|+.+-.+.+++.|-+    
T Consensus         3 rhtllAd~a~~~~~~~~ai~hYQqAlslse~l~~~~~~~~~d~l~i~ViscHNLA~fwr~~~d~~yeLkYLqlAse~Vlt   82 (140)
T PF10952_consen    3 RHTLLADQAFKEGDPLRAILHYQQALSLSEELDESNEDDLDDLLTISVISCHNLADFWRSQGDSEYELKYLQLASEKVLT   82 (140)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             47888999875666899999999999999998521310379999999999824999999859968889999998999998


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             00000011334689998726888999999
Q T0595            69 LEPTFIKGYTRKAAALEAMKDYTKAMDVY   97 (123)
Q Consensus        69 ~~p~~~~~~~~lg~~~~~~~~~~~A~~~~   97 (123)
                      +-|..+..-  -....-.+|=-..|+-.|
T Consensus        83 LipqCp~~~--c~sfi~slgcc~~aLidF  109 (140)
T PF10952_consen   83 LIPQCPNSE--CESFIDSLGCCKKALIDF  109 (140)
T ss_pred             HCCCCCCCC--HHHHHHHHHCCHHHHHHH
T ss_conf             664799833--699987630118999999


No 46 
>PF04212 MIT:  MIT (microtubule interacting and transport) domain;  InterPro: IPR007330   The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking.; PDB: 2v6x_A 1yxr_A 2k3w_A 2jq9_A 2jqk_A 1wr0_A 2jqh_A 2cpt_A 2v6y_A 3eab_A ....
Probab=86.76  E-value=0.36  Score=22.22  Aligned_cols=31  Identities=32%  Similarity=0.444  Sum_probs=22.7

Q ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             2899999999998707888999999988531
Q T0595             5 LALEEKNKGNECFQKGDYPQAMKHYTEAIKR   35 (123)
Q Consensus         5 ~a~~~~~~g~~~~~~~~~~~Ai~~~~~ai~~   35 (123)
                      .|..+...|..+-..|+|++|+.+|.+||..
T Consensus         4 ~A~~~~~~Av~~D~~g~~~eA~~~Y~~ai~~   34 (69)
T PF04212_consen    4 KAIELIKQAVEADEAGKYEEALELYKEAIEY   34 (69)
T ss_dssp             HHHHHHHHHHHHHHTT-HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             8999999999988878999999999999999


No 47 
>PF09670 Cas_Cas02710:  CRISPR-associated protein (Cas_Cas02710)
Probab=85.94  E-value=0.67  Score=20.77  Aligned_cols=102  Identities=22%  Similarity=0.227  Sum_probs=65.7

Q ss_pred             CCHHHH--HHHHHHHHHHHHCCHHHHHHHHHHHHHC-CCCCH-HHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHH---
Q ss_conf             711289--9999999998707888999999988531-66530-233444--55653321111000011100000000---
Q T0595             2 NPDLAL--EEKNKGNECFQKGDYPQAMKHYTEAIKR-NPKDA-KLYSNR--AACYTKLLEFQLALKDCEECIQLEPT---   72 (123)
Q Consensus         2 nP~~a~--~~~~~g~~~~~~~~~~~Ai~~~~~ai~~-~p~~~-~~~~~~--a~~~~~~~~~~~A~~~~~~al~~~p~---   72 (123)
                      ||-.+.  ....++..+|...+|..|...|...+.. .|+.. ..+..+  |..++..-++++|.+.+++.+...-.   
T Consensus       125 ~p~~v~~~~~~~~a~~l~~~~~y~aA~~~l~~l~~rl~~~~~y~~~~~l~~~y~~WD~fd~~~A~~~Lek~l~~~~~l~~  204 (379)
T PF09670_consen  125 NPYEVFGEREWRQAKELFNRYDYGAAERILEELLRRLPGEEEYELYKDLCEGYLAWDRFDHEEAYDYLEKLLKKLLQLNA  204 (379)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             87999879889999999980786999999999997579505799999999999998754899999999986634301155


Q ss_pred             HHH-----------------------------HHHHHHH------HHHHHCCHHHHHHHHHHHHHH
Q ss_conf             001-----------------------------1334689------998726888999999999974
Q T0595            73 FIK-----------------------------GYTRKAA------ALEAMKDYTKAMDVYQKALDL  103 (123)
Q Consensus        73 ~~~-----------------------------~~~~lg~------~~~~~~~~~~A~~~~~~al~l  103 (123)
                      +.+                             .+..+..      --...|+|+.|.--+-+++++
T Consensus       205 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~dLl~NA~RR~~~grydda~~rlYR~lEl  270 (379)
T PF09670_consen  205 EREGLEKLVEVLRALESILPSKEGARNRGNKFYYALLADLLANAERRAAQGRYDDAVARLYRALEL  270 (379)
T ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             799999999999988720654776331444309999999999899877656888999999999999


No 48 
>PF11207 DUF2989:  Protein of unknown function (DUF2989)
Probab=83.60  E-value=0.56  Score=21.18  Aligned_cols=50  Identities=18%  Similarity=-0.005  Sum_probs=32.6

Q ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHC-C---CCHHHHHHHHHHHHHHCC
Q ss_conf             00113346899987268889999999999748-9---968889999999975429
Q T0595            73 FIKGYTRKAAALEAMKDYTKAMDVYQKALDLD-S---SCKEAADGYQRCMMAQYN  123 (123)
Q Consensus        73 ~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l~-p---~~~~a~~~l~~~~~~q~n  123 (123)
                      .+...+.+|.. +...+..+++..+.+++++. +   -++++...++-+.+.+.|
T Consensus       140 ~~elq~aLAty-Y~k~d~~Kt~~Ll~~~L~l~~~~~~~n~~il~sLasiy~~~~~  193 (203)
T PF11207_consen  140 DPELQYALATY-YTKRDPDKTIQLLYHALELSQEDDDFNPEILLSLASIYQKQGN  193 (203)
T ss_pred             CHHHHHHHHHH-HHCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             89999999999-9804889999999999984388777798999999999987132


No 49 
>PF07721 TPR_4:  Tetratricopeptide repeat;  InterPro: IPR011717   This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models. The tetratricopeptide repeat (TPR) motif is a protein-protein interaction module found in multiple copies in a number of functionally different proteins that facilitates specific interactions with a partner protein(s) .
Probab=82.15  E-value=0.33  Score=22.37  Aligned_cols=22  Identities=23%  Similarity=0.040  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             1334689998726888999999
Q T0595            76 GYTRKAAALEAMKDYTKAMDVY   97 (123)
Q Consensus        76 ~~~~lg~~~~~~~~~~~A~~~~   97 (123)
                      +++++|.++...|++++|...+
T Consensus         3 a~~~la~~~~~~G~~~~A~~~~   24 (26)
T PF07721_consen    3 ALYNLARALLAQGRPDEARALL   24 (26)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHH
T ss_conf             8899999999959999999997


No 50 
>PF07219 HemY_N:  HemY protein N-terminus;  InterPro: IPR010817   This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins. These are membrane protein involved in a late step of protoheme IX synthesis .
Probab=66.96  E-value=2.6  Score=17.67  Aligned_cols=30  Identities=20%  Similarity=0.133  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             011334689998726888999999999974
Q T0595            74 IKGYTRKAAALEAMKDYTKAMDVYQKALDL  103 (123)
Q Consensus        74 ~~~~~~lg~~~~~~~~~~~A~~~~~~al~l  103 (123)
                      .......|.+-..-|+++.|.+...++.+.
T Consensus        85 a~~al~~Gl~a~~~G~~~~A~k~l~~a~~~  114 (134)
T PF07219_consen   85 AYRALSRGLIALAEGDWQRAEKLLAKAAKL  114 (134)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHC
T ss_conf             999999999999789999999999987766


No 51 
>PF09797 NatB_MDM20:  N-acetyltransferase B complex (NatB) non catalytic subunit
Probab=62.83  E-value=3.2  Score=17.23  Aligned_cols=45  Identities=11%  Similarity=0.004  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             111100001110000000000113346899987268889999999
Q T0595            54 LEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQ   98 (123)
Q Consensus        54 ~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~   98 (123)
                      +..-+|+..++.++..+|.++...+.+-.+|..+|-...|.+.|.
T Consensus       197 ~~l~~ai~lLE~~l~~sp~n~~~~LlLv~lY~~LG~~~~A~~~~~  241 (365)
T PF09797_consen  197 SYLLQAIALLEHGLKKSPHNYQLRLLLVRLYSLLGAGSLALEHYK  241 (365)
T ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999999999986599779999999999998699799999999


No 52 
>PF00637 Clathrin:  Region in Clathrin and VPS;  InterPro: IPR000547   Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport . Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors , .    Clathrin is a trimer composed of three heavy chains and three light chains, each monomer projecting outwards like a leg; this three-legged structure is known as a triskelion , . The heavy chains form the legs, their N-terminal beta-propeller regions extending outwards, while their C-terminal alpha-alpha-superhelical regions form the central hub of the triskelion. Peptide motifs can bind between the beta-propeller blades. The light chains appear to have a regulatory role, and may help orient the assembly and disassembly of clathrin coats as they interact with hsc70 uncoating ATPase . Clathrin triskelia self-polymerise into a curved lattice by twisting individual legs together. The clathrin lattice forms around a vesicle as it buds from the TGN, plasma membrane or endosomes, acting to stabilise the vesicle and facilitate the budding process . The multiple blades created when the triskelia polymerise are involved in multiple protein interactions, enabling the recruitment of different cargo adaptors and membrane attachment proteins .    This entry represents the 7-fold alpha-alpha-superhelical ARM-type repeat found at the C-terminal of clathrin heavy chains and in VPS (vacuolar protein sorting-associated) proteins. In clathrin heavy chains, the C-terminal 7-fold ARM-type repeats interact to form the central hub of the triskelion. VPS proteins are required for vacuolar assembly and vacuolar traffick, and contain one clathrin-type repeat .   More information about these proteins can be found at Protein of the Month: Clathrin .; GO: 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport; PDB: 1b89_A.
Probab=59.06  E-value=3.7  Score=16.86  Aligned_cols=105  Identities=12%  Similarity=0.063  Sum_probs=67.5

Q ss_pred             HHHHHHCCHHHHHHHHHHHH-HCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHH
Q ss_conf             99987078889999999885-3166530233444556533211110000111000000000-------011334689998
Q T0595            14 NECFQKGDYPQAMKHYTEAI-KRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTF-------IKGYTRKAAALE   85 (123)
Q Consensus        14 ~~~~~~~~~~~Ai~~~~~ai-~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~-------~~~~~~lg~~~~   85 (123)
                      ..+.+.+..+..+.+++..+ .....++.....+..+|.+.+. ++-+..++..-..++..       ...|-....+|.
T Consensus        15 ~~~~~~~~~~~l~~yLe~~~~~~~~~~~~~~~~L~~ly~~~~~-~~L~~~L~~~~~yd~~~~~~~~~~~~~~~~av~Ly~   93 (144)
T PF00637_consen   15 QAFEKANQPELLIEYLEALIESDPSNNPELHNLLLELYAKYEP-EKLLDFLKTSNNYDVDKALRLCEEHKLYEEAVYLYS   93 (144)
T ss_dssp             HHHHHTT-CCCCHHHHHHHH---TT--HHHHHHHHHHHHCTTH-HHHHHHHHHHTTS-HHHHHHHHCTTCHHHHHHHHHH
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH-HHHHHHHHCCCCCCHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999789999999999999875267888999999999999747-899999864456998999999885060899999985


Q ss_pred             HHCCHHHHHHHHH--------HHHHH--CCCCHHHHHHHHHHHH
Q ss_conf             7268889999999--------99974--8996888999999997
Q T0595            86 AMKDYTKAMDVYQ--------KALDL--DSSCKEAADGYQRCMM  119 (123)
Q Consensus        86 ~~~~~~~A~~~~~--------~al~l--~p~~~~a~~~l~~~~~  119 (123)
                      +.|++++|+..+-        .+++.  ..++++.|..+.....
T Consensus        94 ~~~~~~~al~~~l~~~~~~~~~a~e~~~~~~~~~lw~~l~~~~l  137 (144)
T PF00637_consen   94 KMGDHEEALDLLLHKLKDYKEEAIEYAKKVNDPELWKQLLSACL  137 (144)
T ss_dssp             HTT-HHHHHHHHHSTTTTH-HHHCHHHCCTTSCHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHCCCCCHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             23556999998980212418999999987187999999999997


No 53 
>PF04348 LppC:  LppC putative lipoprotein;  InterPro: IPR007443 This family includes several bacterial outer membrane antigens, whose molecular function is unknown.; PDB: 3ckm_A.
Probab=56.07  E-value=0.96  Score=19.95  Aligned_cols=95  Identities=23%  Similarity=0.090  Sum_probs=67.4

Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHH--HCCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HH-HHHHHHHHHHHH
Q ss_conf             999999987078889999999885--316653-02334445565332111100001110000---00-000011334689
Q T0595            10 KNKGNECFQKGDYPQAMKHYTEAI--KRNPKD-AKLYSNRAACYTKLLEFQLALKDCEECIQ---LE-PTFIKGYTRKAA   82 (123)
Q Consensus        10 ~~~g~~~~~~~~~~~Ai~~~~~ai--~~~p~~-~~~~~~~a~~~~~~~~~~~A~~~~~~al~---~~-p~~~~~~~~lg~   82 (123)
                      ..-+..+...|+++.|...+++.-  .+.|.. ......++.+.+..|+++.|+..+.. +.   +. +.....|..++.
T Consensus        28 L~Aa~a~i~eg~~~~A~~ll~~l~~~~L~~~q~~~~~Ll~A~la~~~~~~~~Al~~L~~-~~~~~l~~~q~~r~~~~~A~  106 (536)
T PF04348_consen   28 LLAARALIQEGKWAQAQALLNQLDRQQLTPEQQAEYQLLRAELALAQGQPQQALALLNF-QDLWQLPQEQQIRYYQLRAQ  106 (536)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHCC-CCCHHCCHHHHHHHHHHHHH
T ss_conf             99999999789999999999844355588667999999999999985899999998667-98022799999999999999


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHCC
Q ss_conf             99872688899999999997489
Q T0595            83 ALEAMKDYTKAMDVYQKALDLDS  105 (123)
Q Consensus        83 ~~~~~~~~~~A~~~~~~al~l~p  105 (123)
                      ++...|++-+|...+-..-.+-+
T Consensus       107 ~~~~~~~~l~aar~~i~l~~ll~  129 (536)
T PF04348_consen  107 ALEAQGDPLEAARERIALSPLLT  129 (536)
T ss_dssp             -----------------------
T ss_pred             HHHHCCCHHHHHHHHHHHHHHCC
T ss_conf             99976878999999999744458


No 54 
>PF11846 DUF3366:  Domain of unknown function (DUF3366)
Probab=50.41  E-value=5.3  Score=16.08  Aligned_cols=50  Identities=22%  Similarity=0.110  Sum_probs=39.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCC
Q ss_conf             100001110000000000113346899987268889999999999748996
Q T0595            57 QLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSC  107 (123)
Q Consensus        57 ~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l~p~~  107 (123)
                      ...++-.++.++..| .+..+.+++.++..+|+.++|.....++..+.|..
T Consensus       128 ~~~~~~a~~~l~~~P-~p~~~~~la~~~~~~G~~~~A~~~~~~~~~lyp~~  177 (192)
T PF11846_consen  128 AAYIEWAEQLLKYRP-RPNVYQRLALALALQGDPEEARQWMAQAQYLYPLQ  177 (192)
T ss_pred             HHHHHHHHHHHHCCC-CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCH
T ss_conf             999999999987199-73999999999998699899999999999868967


No 55 
>PF01239 PPTA:  Protein prenyltransferase alpha subunit repeat;  InterPro: IPR002088   Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein. Farnesyl and geranylgeranyl groups are polyisoprenes, unsaturated hydrocarbons with a multiple of five carbons; the chain is 15 carbons long in the farnesyl moiety and 20 carbons long in the geranylgeranyl moiety. There are three different protein prenyltransferases in humans: farnesyltransferase (FT) and geranylgeranyltransferase 1 (GGT1) share the same motif (the CaaX box) around the cysteine in their substrates, and are thus called CaaX prenyltransferases, whereas geranylgeranyltransferase 2 (GGT2, also called Rab geranylgeranyltransferase) recognises a different motif and is thus called a non-CaaX prenyltransferase. Protein prenyltransferases are currently known only in eukaryotes, but they are widespread, being found in vertebrates, insects, nematodes, plants, fungi and protozoa, including several parasites.     Each protein consists of two subunits, alpha and beta; the alpha subunit of FT and GGT1 is encoded by the same gene, FNTA. The alpha subunit is thought to participate in a stable complex with the isoprenyl substrate; the beta subunit binds the peptide substrate. In the alpha subunits of both types of protein prenyltransferases, seven tetratricopeptide repeats are formed by pairs of helices that are stabilized by conserved intercalating residues. The alpha subunits of GGT2 in mammals and plants also have an immunoglobulin-like domain between the fifth and sixth tetratricopeptide repeat, as well as leucine-rich repeats at the carboxyl terminus. The functions of these additional domains in GGT2 are as yet undefined, but they are apparently not directly involved in the interaction with substrates and Rab escort proteins. The tetratricopeptide repeats of the alpha subunit form a right-handed superhelix, which embraces the (alpha-alpha)6 barrel of the beta subunit . ; GO: 0008318 protein prenyltransferase activity, 0018346 protein amino acid prenylation; PDB: 3dsv_A 3dss_A 3c72_A 3dsw_A 1dce_A 1ltx_A 3dst_A 3dsx_A 3dsu_A 3dra_A ....
Probab=40.89  E-value=7.6  Score=15.26  Aligned_cols=26  Identities=19%  Similarity=0.295  Sum_probs=11.7

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             99999885316653023344455653
Q T0595            26 MKHYTEAIKRNPKDAKLYSNRAACYT   51 (123)
Q Consensus        26 i~~~~~ai~~~p~~~~~~~~~a~~~~   51 (123)
                      +..-.++|..+|.+..+|..|-.+..
T Consensus         3 L~~~~~~i~~~p~nys~W~yR~~ll~   28 (31)
T PF01239_consen    3 LEFTNKAISMDPKNYSAWNYRRWLLE   28 (31)
T ss_dssp             HHHHHHHHHHSTT-HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             99999999878102238999999998


No 56 
>PF04190 DUF410:  Protein of unknown function (DUF410) ;  InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function.
Probab=37.59  E-value=8.6  Score=14.97  Aligned_cols=114  Identities=18%  Similarity=0.216  Sum_probs=55.5

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHH----------------HCCCCCHHHHHHHHH-HHHHHHHHHHHHHHHHHHHH
Q ss_conf             8999999999987078889999999885----------------316653023344455-65332111100001110000
Q T0595             6 ALEEKNKGNECFQKGDYPQAMKHYTEAI----------------KRNPKDAKLYSNRAA-CYTKLLEFQLALKDCEECIQ   68 (123)
Q Consensus         6 a~~~~~~g~~~~~~~~~~~Ai~~~~~ai----------------~~~p~~~~~~~~~a~-~~~~~~~~~~A~~~~~~al~   68 (123)
                      +.-+...|..+++.+++.+|..+|=.+-                +-.|..++.+..|+. .|+.+++...|...+..-.+
T Consensus        90 p~LH~~ig~~~~~e~~~~~Ae~Hlilg~~~s~~~~~~ll~~w~~~~~~~e~~lf~~RaVL~yL~l~n~~~A~~~~~~f~~  169 (260)
T PF04190_consen   90 PELHHVIGEKYWEEGEFYEAERHLILGTDPSAFAYVMLLEYWQTKGYPSEADLFIARAVLQYLCLGNLRFANELFDEFTK  169 (260)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             99999999999973318999989763178018889999999998078774658999999999973589999999999998


Q ss_pred             H----HHH---------HHHHHHHHHHHHH------HHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             0----000---------0011334689998------7268889999999999748996888999999997
Q T0595            69 L----EPT---------FIKGYTRKAAALE------AMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMM  119 (123)
Q Consensus        69 ~----~p~---------~~~~~~~lg~~~~------~~~~~~~A~~~~~~al~l~p~~~~a~~~l~~~~~  119 (123)
                      .    +|+         ......+....+.      ....|..-.+.|+..++.+|...++.+.+++.+-
T Consensus       170 ~~~~~~p~~~~~~~~~~~~~pllNFl~lLl~~~e~~~~~~F~~L~~~Y~~~L~~d~~~~~~l~~Ig~~yF  239 (260)
T PF04190_consen  170 KLSESHPKLENSDIEFPPSYPLLNFLQLLLLTCERKNAPLFRQLKEKYKPSLKRDPSFNKYLDKIGQLYF  239 (260)
T ss_pred             HHHHCCCCHHCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHC
T ss_conf             8741285210256788988645999999999997155899999999988876011879999999999981


No 57 
>PF04010 DUF357:  Protein of unknown function (DUF357);  InterPro: IPR007155 Members of this entry are short (less than 100 amino acids) proteins found in archaebacteria. The function of these proteins is unknown.; PDB: 2pmr_A 2oo2_A.
Probab=36.02  E-value=9.1  Score=14.83  Aligned_cols=26  Identities=19%  Similarity=0.342  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             01133468999872688899999999
Q T0595            74 IKGYTRKAAALEAMKDYTKAMDVYQK   99 (123)
Q Consensus        74 ~~~~~~lg~~~~~~~~~~~A~~~~~~   99 (123)
                      +..|+.-|.-|...|++..|+.++.=
T Consensus        35 A~~Y~~Da~~fl~~gD~v~Ala~~sY   60 (75)
T PF04010_consen   35 ARSYLEDAKYFLEKGDYVNALASFSY   60 (75)
T ss_dssp             HHHHHHHHHHHHH---HHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999989999987888999999999


No 58 
>PF09205 DUF1955:  Domain of unknown function (DUF1955);  InterPro: IPR015288   Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus. Their exact function has not, as yet, been determined. ; PDB: 1wy6_A.
Probab=30.48  E-value=11  Score=14.33  Aligned_cols=61  Identities=13%  Similarity=0.015  Sum_probs=36.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             34445565332111100001110000-00000011334689998726888999999999974
Q T0595            43 YSNRAACYTKLLEFQLALKDCEECIQ-LEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDL  103 (123)
Q Consensus        43 ~~~~a~~~~~~~~~~~A~~~~~~al~-~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l  103 (123)
                      |..+|.-++-...-.++++...+-+. -..-.+.....+|.+|.+.|...+|-+.+.+|-+-
T Consensus        88 ~vd~ALd~lv~q~kkd~Le~i~~~l~kn~ei~~~illkia~A~~kiG~~rea~~ll~eAC~k  149 (161)
T PF09205_consen   88 YVDLALDILVQQGKKDQLEKISNELKKNEEISPEILLKIANAYKKIGNRREANELLNEACKK  149 (161)
T ss_dssp             HHHHHHHHHHH---HHHHHH---TT-----S-HHHHHHHHHHHHH---HHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             99999999998260878999999886437998899999999999852244489999999997


No 59 
>PF08311 Mad3_BUB1_I:  Mad3/BUB1 homology region 1;  InterPro: IPR013212   Proteins containing this domain are checkpoint proteins involved in cell division. This region has been shown to be essential for the binding of BUB1 and MAD3 to CDC20p .; PDB: 3esl_A.
Probab=26.94  E-value=13  Score=13.98  Aligned_cols=59  Identities=19%  Similarity=0.205  Sum_probs=32.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             6530233444556533211110000111000--0000000113346899987268889999999999
Q T0595            37 PKDAKLYSNRAACYTKLLEFQLALKDCEECI--QLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL  101 (123)
Q Consensus        37 p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al--~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al  101 (123)
                      |....+|...+....      ++.+.|.-..  .+.-..+..|..-|..+...|++.+|.+.|+..+
T Consensus        66 ~RyLkiWi~y~~~~~------~p~~if~~l~~~~IG~~~AlfYe~~A~~lE~~~~~~~A~~iy~~Gi  126 (126)
T PF08311_consen   66 PRYLKIWIKYADYCS------DPRDIFQFLYSNGIGTKLALFYEEWAQYLESKGNYKEADEIYQLGI  126 (126)
T ss_dssp             HHHHHHHHHHHHHHS------HHHHHHHHHHH------BHHHHHHHHHHHHHTT-HHHHHHHHH---
T ss_pred             HHHHHHHHHHHHHCC------CHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCC
T ss_conf             899999999998646------8999999999868047889999999999998488988999987449


No 60 
>PF05131 Pep3_Vps18:  Pep3/Vps18/deep orange family;  InterPro: IPR007810 This region is found in a number of proteins identified as being involved in Golgi function and vacuolar sorting. The molecular function of this region is unknown. Proteins containing this domain also contain a C-terminal ring finger domain.
Probab=26.30  E-value=7.9  Score=15.15  Aligned_cols=18  Identities=11%  Similarity=0.174  Sum_probs=9.7

Q ss_pred             HHHHHHCCHHHHHHHHHH
Q ss_conf             999872688899999999
Q T0595            82 AALEAMKDYTKAMDVYQK   99 (123)
Q Consensus        82 ~~~~~~~~~~~A~~~~~~   99 (123)
                      .+|...|+|++|+++.+.
T Consensus       111 ~~yl~~~~y~~Al~~~~~  128 (147)
T PF05131_consen  111 RIYLEKGKYDEALQYCRD  128 (147)
T ss_pred             HHHHHCCCHHHHHHHCCC
T ss_conf             999974779999987226


No 61 
>PF05053 Menin:  Menin;  InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 .; GO: 0005634 nucleus
Probab=23.42  E-value=16  Score=13.62  Aligned_cols=65  Identities=14%  Similarity=0.055  Sum_probs=38.3

Q ss_pred             CHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             30233444556533--211110000111000000-----000011334689998726888999999999974
Q T0595            39 DAKLYSNRAACYTK--LLEFQLALKDCEECIQLE-----PTFIKGYTRKAAALEAMKDYTKAMDVYQKALDL  103 (123)
Q Consensus        39 ~~~~~~~~a~~~~~--~~~~~~A~~~~~~al~~~-----p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~l  103 (123)
                      .|.++.++|.+...  ...-..++..|.++|...     ..+...|.-+|--|++.+++.+|+..+-.+-..
T Consensus       276 yPmalg~LgelEe~~~t~~~~~~~~l~~eai~sa~~~Y~n~hvYPy~y~g~y~yr~~~~~eA~~~wa~aa~V  347 (618)
T PF05053_consen  276 YPMALGNLGELEEIDPTPGRPPPEQLFREAISSARTYYRNHHVYPYTYLGGYYYRHRKYREALAAWAEAADV  347 (618)
T ss_pred             CCHHHCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             750322234365437889998789999999999888733566463010004777531399999999988999


No 62 
>PF02064 MAS20:  MAS20 protein import receptor;  InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism : precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane. Many outer-membrane proteins participate in the early stages of import, four of which (MAS20, MAS22, MAS37 and MAS70) are components of the receptor. MAS20, which forms a subcomplex with MAS22, seems to interact with most or all mitochondrial precursors, suggesting that the protein binds directly to mitochondrial targeting sequences. The MAS37 and MAS70 components also form a subcomplex, the two subcomplexes possibly binding via their trans- membrane (TM) regions - the TM region of MAS70 promotes oligomerisation of attatched protein domains and shares sequence similarity with the TM region of MAS20 .; GO: 0006605 protein targeting, 0006886 intracellular protein transport, 0005742 mitochondrial outer membrane translocase complex; PDB: 2v1s_D 1om2_A 2v1t_A.
Probab=21.23  E-value=8.1  Score=15.10  Aligned_cols=40  Identities=15%  Similarity=0.068  Sum_probs=22.5

Q ss_pred             HHHHHHHHHH-CCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             3468999872-688899999999997489968889999999
Q T0595            78 TRKAAALEAM-KDYTKAMDVYQKALDLDSSCKEAADGYQRC  117 (123)
Q Consensus        78 ~~lg~~~~~~-~~~~~A~~~~~~al~l~p~~~~a~~~l~~~  117 (123)
                      ..+|.-+... |+..+|..+|-+||...|+=.+.+..+.+.
T Consensus        97 V~lGE~L~~~~g~~~eaa~hfynAL~VypqP~~LL~IyQ~T  137 (183)
T PF02064_consen   97 VQLGEQLIQDQGKEIEAALHFYNALKVYPQPTDLLQIYQKT  137 (183)
T ss_dssp             -----------------------------------------
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             11111111111111111111111111111111111111111


Done!