Query T0597 3NIE, , 429 residues Match_columns 429 No_of_seqs 178 out of 16889 Neff 8.4 Searched_HMMs 11830 Date Mon Jul 5 09:51:54 2010 Command /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/seq/T0597.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/T0597.hhr No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF00069 Pkinase: Protein kina 100.0 0 0 344.3 18.7 259 30-370 1-260 (260) 2 PF07714 Pkinase_Tyr: Protein 100.0 5.7E-44 0 286.2 22.7 249 31-366 2-257 (259) 3 PF06293 Kdo: Lipopolysacchari 99.2 3.8E-11 3.2E-15 84.1 10.9 127 50-180 29-170 (206) 4 PF01163 RIO1: RIO1 family; I 99.1 1E-10 8.7E-15 81.4 8.2 124 43-181 1-154 (186) 5 PF01636 APH: Phosphotransfera 98.5 2.1E-06 1.8E-10 54.8 12.4 138 33-178 2-194 (238) 6 PF06176 WaaY: Lipopolysacchar 98.2 3.7E-06 3.1E-10 53.3 9.3 140 25-175 28-178 (229) 7 PF10707 YrbL-PhoP_reg: PhoP r 98.2 2E-05 1.7E-09 48.9 11.8 130 34-176 7-168 (199) 8 PF05445 Pox_ser-thr_kin: Poxv 97.2 7.2E-05 6.1E-09 45.4 3.1 74 109-182 248-348 (434) 9 PF07387 Seadorna_VP7: Seadorn 96.1 0.015 1.2E-06 31.2 8.1 98 58-177 90-189 (308) 10 PF01633 Choline_kinase: Choli 94.6 0.014 1.1E-06 31.4 3.9 29 150-178 143-172 (211) 11 PF07914 DUF1679: Protein of u 93.4 0.16 1.3E-05 24.8 8.7 118 37-162 44-199 (414) 12 PF03109 ABC1: ABC1 family; I 93.4 0.026 2.2E-06 29.6 3.4 45 34-84 17-61 (119) 13 PF02958 DUF227: Domain of unk 92.9 0.081 6.8E-06 26.6 5.3 117 37-162 2-142 (293) 14 PF03881 Fructosamin_kin: Fruc 90.4 0.2 1.7E-05 24.2 5.1 73 33-117 22-97 (288) 15 PF04655 APH_6_hur: Aminoglyco 82.9 0.94 7.9E-05 20.1 8.4 74 34-122 8-86 (253) 16 PF12260 PIP49_C: Pancreatitis 71.0 2.1 0.00017 18.0 4.6 94 75-177 12-127 (205) 17 PF10140 essB: Predicted membr 57.6 3.7 0.00031 16.4 8.3 93 75-181 12-107 (359) 18 PF00454 PI3_PI4_kinase: Phosp 56.6 1.6 0.00014 18.6 1.2 25 154-178 138-163 (235) 19 PF02816 Alpha_kinase: Alpha-k 56.4 3.9 0.00033 16.3 8.2 124 37-161 2-149 (188) 20 PF05858 BIV_Env: Bovine immun 27.6 11 0.00095 13.4 2.4 17 78-94 163-179 (548) 21 PF01739 CheR: CheR methyltran 20.5 5.6 0.00047 15.3 -0.9 12 235-246 30-41 (196) No 1 >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain; InterPro: IPR000719 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. The enzymes fall into two broad classes, characterised with respect to substrate specificity: serine/threonine specific and tyrosine specific . Protein kinase function has been evolutionarily conserved from Escherichia coli to Homo sapiens. Protein kinases play a role in a mulititude of cellular processes, including division, proliferation, apoptosis, and differentiation . Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved , leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases . Eukaryotic protein kinases , , , , are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme . This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein amino acid phosphorylation; PDB: 3cok_B 2rku_A 2owb_A 3fc2_A 2v5q_B 2ou7_A 3d5u_A 3d5v_A 3d5x_A 3dbc_A .... Probab=100.00 E-value=0 Score=344.29 Aligned_cols=259 Identities=37% Similarity=0.612 Sum_probs=200.1 Q ss_pred EEEEEEEEECCCEEEEEEEECCCCCEEEEEEECCHHCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCEEEE Q ss_conf 07998764146607999898779978999985521148789999999999998659985699998886488775543789 Q T0597 30 YEIKHLIGRGSYGYVYLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLHDLIIPEDLLKFDELYI 109 (429) Q Consensus 30 Y~i~~~LG~G~fg~V~~a~d~~~~~~vAiK~i~~~~~~~~~~~~~~rEi~il~~l~HpnIv~l~~~~~~~~~~~~~~~yl 109 (429) |++++.||+|+||+||+|+++.+++.||+|++..............+|+.++++++||||+++++++... ..+|+ T Consensus 1 ~~~~~~lg~G~~g~v~~~~~~~~~~~~~~K~~~~~~~~~~~~~~~~~E~~~~~~l~~~~i~~~~~~~~~~-----~~~~~ 75 (260) T PF00069_consen 1 YRIIRKLGEGGFGTVYLAKDKNTGQKVAIKIFNKSDISESQQEKILNEIEILKRLNHPNIIKIIGIFEDD-----EYIYL 75 (260) T ss_dssp EEEEEEEE--TGEEEEEEEETTTTEEEEEEEEEHTHHHHHHHHHHHHHHHHHHHHHBTTBCCEEEEEEES-----SEEEE T ss_pred CEEEEEEEECCCEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-----CCCCC T ss_conf 9890899417988999999999991999998412223114577888776432232102443234643221-----22222 Q ss_pred EEHHHCC-CHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHEEECCCCCEEEECCCEEECCCCCCCCC Q ss_conf 7030127-625786368988989999999999999999984673323456123220799876661452000247754322 Q T0597 110 VLEIADS-DLKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLLNQDCSVKICDFGLARTINSDKDIH 188 (429) Q Consensus 110 VmE~~~~-~L~~~i~~~~~l~~~~~~~i~~Qll~aL~yLH~~~IiHRDiKPeNILi~~~~~iKl~DFGla~~~~~~~~~~ 188 (429) |||+|++ +|.+++..+..+++..+..+++||+.||.|||++|++||||||+|||++.++.++|+|||+|+...... T Consensus 76 v~e~~~~~~L~~~l~~~~~~~~~~~~~i~~~l~~~l~~Lh~~~i~H~dlkp~NIl~~~~~~~~l~Dfg~~~~~~~~~--- 152 (260) T PF00069_consen 76 VMEYCPGGTLSDYLKKNKPLSEEEILKIIKQLLEALEYLHSNGIVHRDLKPSNILIDKNGNIKLIDFGLARKLSNSN--- 152 (260) T ss_dssp EEEECSEEBHHHHHHHHSSBCHHHHHHHHHHHHHHHHHHHHTTEEESS-SGGGEEESTTSEEEES-TTTTEESBETT--- T ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--- T ss_conf 22222222222222222222233201121111222222322332222321222222211222211232222112222--- Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC Q ss_conf 12343332222233333233344110231355667734513566677013223578999999708765666532235566 Q T0597 189 IVNDLEEKEENEEPGPHNKNLKKQLTSHVVTRWYRAPELILLQENYTNSIDIWSTGCIFAELLNMMKSHINNPTNRFPLF 268 (429) Q Consensus 189 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~vgT~~Y~APEvi~~~~~y~~~~DiWSlG~il~ell~g~~~~~~~~~~~~~lF 268 (429) .......+|++|+|||++.....++.++||||+|||+++|++|..|+... T Consensus 153 ----------------------~~~~~~~~~~~y~aPE~~~~~~~~~~~~Di~slG~il~~l~~~~~~~~~~-------- 202 (260) T PF00069_consen 153 ----------------------ESISRQFGTPWYLAPELLNNGGSYSPKSDIYSLGCILYELLTGKPPFSEN-------- 202 (260) T ss_dssp ----------------------SSBSSSSSCGGGS-HHHHTTTSSBCTHHHHHHHHHHHHHHHHSSSSTTTS-------- T ss_pred ----------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHEEEEECCCCCCCCCC-------- T ss_conf ----------------------22222222222222222212221123333454001232201246886764-------- Q ss_pred CCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHCCCCCCCCHHHHCCCCCHHHHHHHH Q ss_conf 76432221110000000000257899999997168983466653153457886404555788768746798989999999 Q T0597 269 PGSSCFPLSPDHNSKKVHEKSNRDQLNIIFNVIGTPPEEDLKCITKQEVIKYIKLFPTRDGIDLSKKYSSISKEGIDLLE 348 (429) Q Consensus 269 ~g~~~~~~~~~~~~~~~~~~~~~~~l~~i~~~lg~p~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~dll~ 348 (429) ...+....+......+ ...... .....+++..+|+. T Consensus 203 --------------------~~~~~~~~~~~~~~~~---------------~~~~~~---------~~~~~~~~l~~li~ 238 (260) T PF00069_consen 203 --------------------NNRDQLQLIESILNKP---------------LPFDFK---------KENQISEELRDLIK 238 (260) T ss_dssp --------------------SHHHHHHHHHHHHHTH---------------HHHHTT---------SHTTSHHHHHHHHH T ss_pred --------------------CCCCEEEEEEEECCCC---------------CCCCCC---------CCCHHHHHHHHHHH T ss_conf --------------------4333024676403554---------------456631---------00136899999999 Q ss_pred HHHHCCCCCCCCHHHHHCCCCC Q ss_conf 8533170227889999659765 Q T0597 349 SMLRFNAQKRITIDKALSHPYL 370 (429) Q Consensus 349 ~lL~~dP~~R~ta~e~l~Hp~f 370 (429) +||..||.+|+|++++++|||| T Consensus 239 ~~l~~dp~~R~s~~~~~~~~~~ 260 (260) T PF00069_consen 239 KMLSPDPEKRPSIEELLQHPWF 260 (260) T ss_dssp HHSSSSGGGS-SHHHHHTSGGG T ss_pred HHCCCCHHHCCCHHHHHHCCCC T ss_conf 9848796689099999618879 No 2 >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain; InterPro: IPR001245 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. The enzymes fall into two broad classes, characterised with respect to substrate specificity: serine/threonine specific and tyrosine specific . Protein kinase function has been evolutionarily conserved from Escherichia coli to Homo sapiens. Protein kinases play a role in a mulititude of cellular processes, including division, proliferation, apoptosis, and differentiation . Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved , leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases . Tyrosine phosphorylating activity was originally detected in two viral transforming proteins , but many retroviral transforming proteins and their cellular counterparts have since been shown to possess such activity. The growth factor receptors, which are activated by ligand binding, and the insulin-related peptide receptor, are also family members. ; GO: 0004713 protein-tyrosine kinase activity, 0005524 ATP binding, 0006468 protein amino acid phosphorylation; PDB: 2eva_A 1uwh_A 3c4d_A 2fb8_A 3d4q_A 3c4c_B 1uwj_B 3hgk_D 2qkw_B 2ivs_B .... Probab=100.00 E-value=5.7e-44 Score=286.15 Aligned_cols=249 Identities=29% Similarity=0.446 Sum_probs=188.0 Q ss_pred EEEEEEEECCCEEEEEEEEC----CCCCEEEEEEECCHHCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCE Q ss_conf 79987641466079998987----79978999985521148789999999999998659985699998886488775543 Q T0597 31 EIKHLIGRGSYGYVYLAYDK----NANKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLHDLIIPEDLLKFDE 106 (429) Q Consensus 31 ~i~~~LG~G~fg~V~~a~d~----~~~~~vAiK~i~~~~~~~~~~~~~~rEi~il~~l~HpnIv~l~~~~~~~~~~~~~~ 106 (429) ++.+.||.|+||.||+|... .++..||||.+.. ..+......+.+|+.+|+.++||||+++++++...+ . T Consensus 2 ~~~~~ig~G~fg~V~~~~~~~~~~~~~~~V~iK~~~~-~~~~~~~~~~~~e~~~l~~l~h~ni~k~~g~~~~~~-----~ 75 (259) T PF07714_consen 2 ELIEQIGQGSFGSVYRGTWHEKDNDKGQEVAIKQLKQ-RSSSEEIEEFLEEINILSKLDHPNIVKLYGICIDSN-----S 75 (259) T ss_dssp EEEEEEE------EEEEEEETTSTSSEEEEEEEEEST-TSSHHHHHHHHHHHHHHHTC-BTTB--BEEEBESSS-----S T ss_pred EECCEECCCCCCEEEEEEEEECCCCCCEEEEEEECCC-CCCCHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCC-----C T ss_conf 7873851079977999999725588987999998210-243035778875101133233310431123432111-----1 Q ss_pred EEEEEHHHC-CCHHHHHHCC--CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHEEECCCCCEEEECCCEEECCCC Q ss_conf 789703012-7625786368--9889899999999999999999846733234561232207998766614520002477 Q T0597 107 LYIVLEIAD-SDLKKLFKTP--IFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLLNQDCSVKICDFGLARTINS 183 (429) Q Consensus 107 ~ylVmE~~~-~~L~~~i~~~--~~l~~~~~~~i~~Qll~aL~yLH~~~IiHRDiKPeNILi~~~~~iKl~DFGla~~~~~ 183 (429) +++|+|||. |+|.++++.. ..++......++.|++.||.|||+++++|+||+|+|||++.++.+||+|||+++.... T Consensus 76 ~~lv~e~~~~g~L~~~L~~~~~~~l~~~~~~~i~~qia~al~yLh~~~ivH~~L~~~nill~~~~~~Kl~d~g~~~~~~~ 155 (259) T PF07714_consen 76 IYLVLEYCPNGSLRDYLKKRKKQKLSESQRLSIAIQIASALAYLHSKGIVHGNLTPSNILLDSNGNVKLSDFGLARNLYS 155 (259) T ss_dssp EEEEEE---B-BHHHHHHHTCTTTSBHHHHHHHHHHHHHHHHHHHHTTEEEST-SGGGEEEETTTEEEE-----CEEGTT T ss_pred CCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCC T ss_conf 21123323320000012222222122232222112222321001012332100011221100001212333211100022 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC Q ss_conf 54322123433322222333332333441102313556677345135666770132235789999997087656665322 Q T0597 184 DKDIHIVNDLEEKEENEEPGPHNKNLKKQLTSHVVTRWYRAPELILLQENYTNSIDIWSTGCIFAELLNMMKSHINNPTN 263 (429) Q Consensus 184 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vgT~~Y~APEvi~~~~~y~~~~DiWSlG~il~ell~g~~~~~~~~~~ 263 (429) ....... ....+...|+|||++.+ ..++.++||||+|+++|||+++... T Consensus 156 ~~~~~~~-----------------------~~~~~~~~~~aPE~l~~-~~~~~ksDvysfG~~l~ei~t~~~~------- 204 (259) T PF07714_consen 156 KDYYSKS-----------------------SSQQGPYRYLAPEVLKG-SEYTEKSDVYSFGMILYEILTLGKI------- 204 (259) T ss_dssp SSTEEES-----------------------TTTEEEGGGS-HHHHHH-SEESHHHHHHHHHHHHHHHHTTTTG------- T ss_pred CCCCCCC-----------------------CCCCCCCCCCCCCCCCC-CCCCCCCCCCCHHHHEEEEECCCCC------- T ss_conf 2211211-----------------------11222223322231123-5532214320101000112002444------- Q ss_pred CCCCCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHCCCCCCCCHHHHCCCCCHHH Q ss_conf 35566764322211100000000002578999999971689834666531534578864045557887687467989899 Q T0597 264 RFPLFPGSSCFPLSPDHNSKKVHEKSNRDQLNIIFNVIGTPPEEDLKCITKQEVIKYIKLFPTRDGIDLSKKYSSISKEG 343 (429) Q Consensus 264 ~~~lF~g~~~~~~~~~~~~~~~~~~~~~~~l~~i~~~lg~p~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~ 343 (429) +|...+ ..+....+ ..... .. .-...+... T Consensus 205 ---p~~~~~-----------------~~~~~~~~-----------------------~~~~~--~~-----~~~~~~~~~ 234 (259) T PF07714_consen 205 ---PFNDLS-----------------NQEIIEKV-----------------------DQGQR--PP-----IPSGCPKEL 234 (259) T ss_dssp ---TTTTSC-----------------HHHHHHHH-----------------------HTTTB--CG-----SBTTSBHHH T ss_pred ---CCCCCC-----------------CCCCCCCC-----------------------CCCCC--CC-----CCCHHHHHH T ss_conf ---445544-----------------22222221-----------------------10013--21-----100278999 Q ss_pred HHHHHHHHHCCCCCCCCHHHHHC Q ss_conf 99999853317022788999965 Q T0597 344 IDLLESMLRFNAQKRITIDKALS 366 (429) Q Consensus 344 ~dll~~lL~~dP~~R~ta~e~l~ 366 (429) .+|+..|+..||++|||+.++++ T Consensus 235 ~~li~~C~~~~p~~RPs~~~i~~ 257 (259) T PF07714_consen 235 YDLIQQCWSYDPEKRPSFQEILQ 257 (259) T ss_dssp HHHHHHHT-SSGGGS--HHHHHH T ss_pred HHHHHHHCCCCHHHCCCHHHHHH T ss_conf 99999973877657909999994 No 3 >PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. The enzymes fall into two broad classes, characterised with respect to substrate specificity: serine/threonine specific and tyrosine specific . Protein kinase function has been evolutionarily conserved from Escherichia coli to Homo sapiens. Protein kinases play a role in a mulititude of cellular processes, including division, proliferation, apoptosis, and differentiation . Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved , leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases . This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in Escherichia coli and that it is required for virulence in invasive strains of S. enterica .; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane Probab=99.24 E-value=3.8e-11 Score=84.07 Aligned_cols=127 Identities=24% Similarity=0.259 Sum_probs=91.4 Q ss_pred CCCCCEEEEEEECCH-----HCCHHHHHHHHHHHHHHHHCCC-----CCEEEEEEEEECCCCCCCCEEEEEEHHHCC--C Q ss_conf 779978999985521-----1487899999999999986599-----856999988864887755437897030127--6 Q T0597 50 KNANKNVAIKKVNRM-----FEDLIDCKRILREITILNRLKS-----DYIIRLHDLIIPEDLLKFDELYIVLEIADS--D 117 (429) Q Consensus 50 ~~~~~~vAiK~i~~~-----~~~~~~~~~~~rEi~il~~l~H-----pnIv~l~~~~~~~~~~~~~~~ylVmE~~~~--~ 117 (429) ...++.+-+|..... ........++.+|...+..|.. |..|-+ .+.... ....-|+|+|.+++ + T Consensus 29 ~~~~~~y~~k~~~~~~~~~~~~~~~~~~ra~~E~~~l~~l~~~GIptP~pva~---~~~r~~-~~~~a~lite~l~g~~~ 104 (206) T PF06293_consen 29 DWVGRRYYRKRQWGKLFRSRLRFPLRRSRAKREWRNLERLRRLGIPTPEPVAF---GERRSG-GFYRAYLITEALPGAQD 104 (206) T ss_pred CCCEEEEEECCEECCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCCCEEEE---EEECCC-CCEEEEEEEEECCCCCC T ss_conf 43014899995621013330345425728999999999999869999966899---998268-85179999950899612 Q ss_pred HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHEEECCCC---CEEEECCCEEEC Q ss_conf 257863689889899999999999999999846733234561232207998---766614520002 Q T0597 118 LKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLLNQDC---SVKICDFGLART 180 (429) Q Consensus 118 L~~~i~~~~~l~~~~~~~i~~Qll~aL~yLH~~~IiHRDiKPeNILi~~~~---~iKl~DFGla~~ 180 (429) |.+++......+....+.++.++...+.-||..||+|+|++|.|||++.++ .+-++||+.++. T Consensus 105 L~~~~~~~~~~~~~~~~~l~~~l~~~i~~mH~~gi~H~DL~~~NILv~~~~~~~~~~lID~dr~~~ 170 (206) T PF06293_consen 105 LRDLLQDWADLDPEQRRALLRALGRLIARMHDAGIIHGDLYPSNILVDPDGGQPQIWLIDFDRARF 170 (206) T ss_pred HHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCEEEEEEEHHHHCC T ss_conf 999996423457578999999999999999988398688994668995799815699982177020 No 4 >PF01163 RIO1: RIO1 family; InterPro: IPR000687 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. The enzymes fall into two broad classes, characterised with respect to substrate specificity: serine/threonine specific and tyrosine specific . Protein kinase function has been evolutionarily conserved from Escherichia coli to Homo sapiens. Protein kinases play a role in a mulititude of cellular processes, including division, proliferation, apoptosis, and differentiation . Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved , leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases . This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases . The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date. Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0004674 protein serine/threonine kinase activity, 0005524 ATP binding; PDB: 1tqm_A 1zar_A 1tqi_A 1zao_A 1tqp_A 1zp9_A 1zth_C 1ztf_A. Probab=99.12 E-value=1e-10 Score=81.39 Aligned_cols=124 Identities=28% Similarity=0.353 Sum_probs=83.1 Q ss_pred EEEEEEECCCCCEEEEEEECC---HHCC-------------------HH--HHHHHHHHHHHHHHCCCC--CEEEEEEEE Q ss_conf 799989877997899998552---1148-------------------78--999999999999865998--569999888 Q T0597 43 YVYLAYDKNANKNVAIKKVNR---MFED-------------------LI--DCKRILREITILNRLKSD--YIIRLHDLI 96 (429) Q Consensus 43 ~V~~a~d~~~~~~vAiK~i~~---~~~~-------------------~~--~~~~~~rEi~il~~l~Hp--nIv~l~~~~ 96 (429) .||.|.+ ..|+.+|||+-.. .|.+ .. ....+.+|.+.|+++..- ++-+.+++- T Consensus 1 ~Vy~~~~-~~~~~~a~Ki~r~~~~~Fk~~~~y~~~~~rf~~~~~~~~~~~~~~~~a~kE~~~L~~l~~~Gv~vP~pi~~~ 79 (186) T PF01163_consen 1 DVYHALD-PDGEKVALKIYRIGRTSFKNRKEYRDYDPRFKNKRHKINWRYLSRLWAKKEFRNLKRLYEAGVPVPKPIDVN 79 (186) T ss_dssp EEEEEB--S----EEEEEE-S---SS-HHHHHT---TTS-GG--G--HHHHHHHHHHHHHHHHHHCHH----S--EEEEE T ss_pred CEEEEEC-CCCCEEEEEEEECCCEEEEEHHHHHCCCHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEC T ss_conf 9799988-999999999941462256261454075433432457878899999999999999999998599788288961 Q ss_pred ECCCCCCCCEEEEEEHHHC--CC-HHHHHHCCCCCCHHHHHHHHHHHHH-HHHHHHHCCCCCCCCCHHHEEECCCCCEEE Q ss_conf 6488775543789703012--76-2578636898898999999999999-999998467332345612322079987666 Q T0597 97 IPEDLLKFDELYIVLEIAD--SD-LKKLFKTPIFLTEQHVKTILYNLLL-GEKFIHESGIIHRDLKPANCLLNQDCSVKI 172 (429) Q Consensus 97 ~~~~~~~~~~~ylVmE~~~--~~-L~~~i~~~~~l~~~~~~~i~~Qll~-aL~yLH~~~IiHRDiKPeNILi~~~~~iKl 172 (429) . -+|||||.+ |. +.. +.. ...+....++.+++. .+.-+|+.||||.||-+.|||++.+ .+.+ T Consensus 80 --~-------~~ivME~I~~~G~~~~~-l~~---~~~~~~~~~~~~il~~~~~~l~~~giVHGDLs~~NILv~~~-~v~i 145 (186) T PF01163_consen 80 --R-------NVIVMEYIGEDGVPLPR-LKD---IDLEEPEELYEQILEEMRKLLHKAGIVHGDLSEYNILVSED-KVYI 145 (186) T ss_dssp --T-------TEEEEE----TTS--EE-CCC------S-HHHHHHHHHHHHHHHHHCS-EEESS-STTSEEE-SS-SEEE T ss_pred --C-------CEEEEEEECCCCCCHHH-HHH---CCHHHHHHHHHHHHHHHHHHHHHCCCEECCCCHHHEEEECC-CEEE T ss_conf --8-------89999850556520357-653---67478999999999999999998893726897322885728-2299 Q ss_pred ECCCEEECC Q ss_conf 145200024 Q T0597 173 CDFGLARTI 181 (429) Q Consensus 173 ~DFGla~~~ 181 (429) +|||.|... T Consensus 146 IDf~qav~~ 154 (186) T PF01163_consen 146 IDFGQAVES 154 (186) T ss_dssp ---TTEEET T ss_pred EECCCCCCC T ss_conf 989866006 No 5 >PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.; InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation .; PDB: 1j7u_A 1l8t_A 1j7l_A 2b0q_A 2bkk_A 3h8p_A 1j7i_A 1nd4_B 3dxp_A 3csv_A .... Probab=98.46 E-value=2.1e-06 Score=54.80 Aligned_cols=138 Identities=20% Similarity=0.226 Sum_probs=77.8 Q ss_pred EEEEEECCCEEEEEEEECCCCCEEEEEEECCHHCCHHHHHHHHHHHHHHHHCC-C-CCEEEEEEEEECCCCCCCCEEEEE Q ss_conf 98764146607999898779978999985521148789999999999998659-9-856999988864887755437897 Q T0597 33 KHLIGRGSYGYVYLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRLK-S-DYIIRLHDLIIPEDLLKFDELYIV 110 (429) Q Consensus 33 ~~~LG~G~fg~V~~a~d~~~~~~vAiK~i~~~~~~~~~~~~~~rEi~il~~l~-H-pnIv~l~~~~~~~~~~~~~~~ylV 110 (429) ++.|+.|..+.||++.... + .+++|..... ....++.+|+.+++.+. + -.+.+++..-...... ...|++ T Consensus 2 ~~~l~~G~~n~~~~v~~~~-~-~~vlk~~~~~----~~~~~~~~e~~~~~~l~~~g~~vP~v~~~~~~~~~~--~~~~~l 73 (238) T PF01636_consen 2 LTPLSGGFSNRVYRVETDD-G-RYVLKVPRPP----WPAARLEREAAILRHLAQHGIPVPRVLAFDTSDEFS--GFPFVL 73 (238) T ss_dssp EEEE---SSSEEEEEEESS---EEEEEEE-SC----SSHHHHHHHHHHHHHHHHTTSGS--EEEEETCCEEC--TTEEEE T ss_pred CCCCCCCCEECEEEEEECC-C-EEEEEEECCC----CCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC--CEECCE T ss_conf 7557999862589999799-5-5999990876----899899999999999996599868898831576544--000003 Q ss_pred EHHHCC-CHHH---------HH-------HC---C--CC--CC------------------------HHHHHHHHHHHHH Q ss_conf 030127-6257---------86-------36---8--98--89------------------------8999999999999 Q T0597 111 LEIADS-DLKK---------LF-------KT---P--IF--LT------------------------EQHVKTILYNLLL 142 (429) Q Consensus 111 mE~~~~-~L~~---------~i-------~~---~--~~--l~------------------------~~~~~~i~~Qll~ 142 (429) ||+.++ .+.. ++ .. - .. +. ......+..+++. T Consensus 74 ~~~i~g~~~~~~~~~~~~~~~~~~~~~~l~~lh~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 153 (238) T PF01636_consen 74 MEWIPGRPLDDELSPAQRDELARQLGRALAALHQIPPPFDPFPGWPRPYLERLAQLESATAAWVASELPELQELRQRLLQ 153 (238) T ss_dssp EE-ECTTBHCCCCTTTHHHHHHHHHHHHHHHHHHSHCTTHHHHHHHHHHHHHHHHHHHCHHCHSHCCTHHHHHHHHHHHH T ss_pred ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH T ss_conf 34755412221112101467788899999864443003566321000005666542331102343544346789999998 Q ss_pred HHHHHH----HCCCCCCCCCHHHEEEC-CCCCEEEECCCEE Q ss_conf 999998----46733234561232207-9987666145200 Q T0597 143 GEKFIH----ESGIIHRDLKPANCLLN-QDCSVKICDFGLA 178 (429) Q Consensus 143 aL~yLH----~~~IiHRDiKPeNILi~-~~~~iKl~DFGla 178 (429) .+..+- ...++|.|+.|.|||++ .++.+-|+||+.+ T Consensus 154 ~~~~~~~~~~~~~l~HgD~~~~Nvl~~~~~~~v~iiD~~~~ 194 (238) T PF01636_consen 154 WLAALLPSNDPPVLIHGDLHPGNVLVDPDGGRVGIIDWEDA 194 (238) T ss_dssp HHHHHHHSCSSECEB-S--SGGGEEE-SSTCEBEE--GTT- T ss_pred HHHHCCCCCCCEEEEEECCCCCCEEEECCCCEEEEEECCCC T ss_conf 76520146798089980478874527515670799985106 No 6 >PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY). The waaY, waaQ, and waaP genes are located in the central operon of the waa (formerly rfa) locus on the chromosome of Escherichia coli. This locus contains genes whose products are involved in the assembly of the core region of the lipopolysaccharide molecule. WaaY is the enzyme that phosphorylates HepII in this system .; GO: 0009244 lipopolysaccharide core region biosynthetic process Probab=98.23 E-value=3.7e-06 Score=53.35 Aligned_cols=140 Identities=17% Similarity=0.237 Sum_probs=87.1 Q ss_pred ECCCCEEEEEEEEECCCEEEEEEEECCCCCEEEEEEECCHH-CCHHHHHH------HHHHHHHHHHCCCCCEEEEEEEEE Q ss_conf 41774079987641466079998987799789999855211-48789999------999999998659985699998886 Q T0597 25 KVPDNYEIKHLIGRGSYGYVYLAYDKNANKNVAIKKVNRMF-EDLIDCKR------ILREITILNRLKSDYIIRLHDLII 97 (429) Q Consensus 25 ~i~~~Y~i~~~LG~G~fg~V~~a~d~~~~~~vAiK~i~~~~-~~~~~~~~------~~rEi~il~~l~HpnIv~l~~~~~ 97 (429) -+..+|...+.+-.+.+..|-+.. ..+..+.+|+-.... ..+..... ..+.+.-+.++.....-.+.+.|. T Consensus 28 ~l~~~~~~~kv~~~~~~~~V~lIe--id~~kyIlK~~r~~~~r~er~~~sf~kg~~~~~li~~~~r~~~~g~~~~~d~y~ 105 (229) T PF06176_consen 28 ILNNNIKTKKVLKNIKRNYVSLIE--IDGKKYILKEFREKDKRPERKIKSFVKGDYYSRLIYNTDRVINEGFTETNDPYL 105 (229) T ss_pred HHHCCCEEEECCCCCCCCEEEEEE--ECCCEEEEECCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHCHHHCCCHHH T ss_conf 971773588610168753799999--769458995565101208999999961588999999998886623312033474 Q ss_pred CCCCCCC---CEEEEEEHHHCC-CHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHEEECCCCCEEEE Q ss_conf 4887755---437897030127-625786368988989999999999999999984673323456123220799876661 Q T0597 98 PEDLLKF---DELYIVLEIADS-DLKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLLNQDCSVKIC 173 (429) Q Consensus 98 ~~~~~~~---~~~ylVmE~~~~-~L~~~i~~~~~l~~~~~~~i~~Qll~aL~yLH~~~IiHRDiKPeNILi~~~~~iKl~ 173 (429) ......+ ...+++|||++| .|.+... +++. ..-+|...+.-+|+.|++|.|+.|.|+|++ ++.++++ T Consensus 106 vaekk~~~~~~~~~lI~EYIeG~~L~d~~~----i~~~----~~~~I~e~I~~lH~~G~~~GD~h~gNFlvs-~~~irII 176 (229) T PF06176_consen 106 VAEKKHLRFIVSYILIIEYIEGEELNDNLD----INED----NKQKIVEEIKELHKHGMYSGDIHPGNFLVS-NNKIRII 176 (229) T ss_pred HHHHHHCCEEEEEEEEEEEECCCCCCCCCC----CCHH----HHHHHHHHHHHHHHCCCCCCCCCCCCEEEE-CCCEEEE T ss_conf 464651560117999998635841545433----4477----899999999999974887799986646870-8948999 Q ss_pred CC Q ss_conf 45 Q T0597 174 DF 175 (429) Q Consensus 174 DF 175 (429) |. T Consensus 177 D~ 178 (229) T PF06176_consen 177 DL 178 (229) T ss_pred EC T ss_conf 87 No 7 >PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL Probab=98.16 E-value=2e-05 Score=48.89 Aligned_cols=130 Identities=22% Similarity=0.315 Sum_probs=84.4 Q ss_pred EEEEECCCEEEEEEEECCCCCEEEEEEECCHH--------------CCHHHHHHHHHHHHHHHHCC------CCCEEEEE Q ss_conf 87641466079998987799789999855211--------------48789999999999998659------98569999 Q T0597 34 HLIGRGSYGYVYLAYDKNANKNVAIKKVNRMF--------------EDLIDCKRILREITILNRLK------SDYIIRLH 93 (429) Q Consensus 34 ~~LG~G~fg~V~~a~d~~~~~~vAiK~i~~~~--------------~~~~~~~~~~rEi~il~~l~------HpnIv~l~ 93 (429) ..||+|+.=.||.-- ......||++.... .........++|+.--..+. +..|.+++ T Consensus 7 ~~l~~G~~R~cy~HP---~d~~~~IKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~y~~l~~~~~~~~~~i~r~~ 83 (199) T PF10707_consen 7 DLLASGGQRYCYAHP---DDPDKCIKVLRPENYADRRPFKRFMKRFRPRGRYRQTRRELKYYRRLMKRRGVDWSPIPRFY 83 (199) T ss_pred CEECCCCCEEEEECC---CCCCEEEEEECCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCEE T ss_conf 400579963698789---99882899965101233344304777742333047899999999997502699744466177 Q ss_pred EEEECCCCCCCCEEEEEEHHH-C------CCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHEEECC Q ss_conf 888648877554378970301-2------762578636898898999999999999999998467332345612322079 Q T0597 94 DLIIPEDLLKFDELYIVLEIA-D------SDLKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLLNQ 166 (429) Q Consensus 94 ~~~~~~~~~~~~~~ylVmE~~-~------~~L~~~i~~~~~l~~~~~~~i~~Qll~aL~yLH~~~IiHRDiKPeNILi~~ 166 (429) +..+++.. +-+|+|.. + .+|.++++.+ .++. ..+. .|-.-.+||-..+|+.+|++|.||++.. T Consensus 84 G~veT~~G-----~Glv~e~i~d~dG~~s~TL~~~l~~~-~~~~-~~~~---~L~~f~~~l~~~~Iv~~dl~~~NIv~~~ 153 (199) T PF10707_consen 84 GFVETDLG-----LGLVFELIRDFDGNPSPTLDDYLKRG-LLDA-ALRQ---ALDEFKRYLLDNHIVARDLNPHNIVYQR 153 (199) T ss_pred EEEECCCC-----EEEEEEEEECCCCCCCCCHHHHHHCC-CCCH-HHHH---HHHHHHHHHHHCCEEECCCCCCCEEEEE T ss_conf 89986883-----27999987889989074399999738-8459-9999---9999999999769765678836589996 Q ss_pred C--C--CEEEEC-CC Q ss_conf 9--8--766614-52 Q T0597 167 D--C--SVKICD-FG 176 (429) Q Consensus 167 ~--~--~iKl~D-FG 176 (429) . + .+.|+| || T Consensus 154 ~~~~~~~~vlIDG~G 168 (199) T PF10707_consen 154 RSEGEFRLVLIDGLG 168 (199) T ss_pred CCCCCEEEEEEECCC T ss_conf 589961799992899 No 8 >PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly. ; GO: 0004672 protein kinase activity, 0005524 ATP binding Probab=97.24 E-value=7.2e-05 Score=45.40 Aligned_cols=74 Identities=22% Similarity=0.281 Sum_probs=44.4 Q ss_pred EEEHHHCCC---HHHHHH-CCCCCC-HHHHHHHHHHHHHHHH---HH-HHCCCCCCCCCHHHEEECC-CC---------- Q ss_conf 970301276---257863-689889-8999999999999999---99-8467332345612322079-98---------- Q T0597 109 IVLEIADSD---LKKLFK-TPIFLT-EQHVKTILYNLLLGEK---FI-HESGIIHRDLKPANCLLNQ-DC---------- 168 (429) Q Consensus 109 lVmE~~~~~---L~~~i~-~~~~l~-~~~~~~i~~Qll~aL~---yL-H~~~IiHRDiKPeNILi~~-~~---------- 168 (429) |||+++-++ +..-.. ..|..+ .+.+|+++.|++.-.- -| -..+-+|-||||+|||+-. +. T Consensus 248 IIfPLA~cSadki~~~~~~e~GF~s~~~YikfifLQiaLLyikIYelp~c~nF~H~DLKPdNILiFds~~~i~I~~~~~~ 327 (434) T PF05445_consen 248 IIFPLARCSADKITESNAAELGFKSNVEYIKFIFLQIALLYIKIYELPCCTNFLHVDLKPDNILIFDSKEPIRIKFGNRT 327 (434) T ss_pred EEEEHHHCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHEEEECCCCCCEEEECCCCCCCEEEECCCCCEEEEECCEE T ss_conf 99853431310068888876385038999999999999987011027873003552567672799569875589987816 Q ss_pred -------CEEEECCCEEECCC Q ss_conf -------76661452000247 Q T0597 169 -------SVKICDFGLARTIN 182 (429) Q Consensus 169 -------~iKl~DFGla~~~~ 182 (429) ..+|.||.+|+..+ T Consensus 328 ~vF~Epi~~~LnDFDfSqi~~ 348 (434) T PF05445_consen 328 YVFKEPIRCCLNDFDFSQIAN 348 (434) T ss_pred EEECCHHHHHHCCCCHHHHCC T ss_conf 994340543322357888704 No 9 >PF07387 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR009973 This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length. The function of this family is unknown. Probab=96.11 E-value=0.015 Score=31.21 Aligned_cols=98 Identities=16% Similarity=0.164 Sum_probs=60.6 Q ss_pred EEEECCHHCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCEEEEEEHHHCCCHHHHHHCCCCCCHHHHHHHH Q ss_conf 99855211487899999999999986599856999988864887755437897030127625786368988989999999 Q T0597 58 IKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLHDLIIPEDLLKFDELYIVLEIADSDLKKLFKTPIFLTEQHVKTIL 137 (429) Q Consensus 58 iK~i~~~~~~~~~~~~~~rEi~il~~l~HpnIv~l~~~~~~~~~~~~~~~ylVmE~~~~~L~~~i~~~~~l~~~~~~~i~ 137 (429) +|+|...-....+ +-..++.+++.++. .|+++.+ +.+ ...-++.|.|-. ...+... . . T Consensus 90 lKKi~slp~~~~~-~~y~nky~v~Armh--GilrL~N---Dn~----~~yGvIlE~Cy~--------~~i~~~N---~-i 147 (308) T PF07387_consen 90 LKKIRSLPCCIND-ALYFNKYRVFARMH--GILRLKN---DNN----YKYGVILERCYK--------IKINFSN---F-I 147 (308) T ss_pred HHHCCCCCCCCCH-HHHHHHHHHHHHHH--HEEEEEC---CCC----CEEEEEEEECCC--------CCCCHHH---H-H T ss_conf 5231678742304-45400466887753--1057503---788----315788752357--------5410368---8-8 Q ss_pred HHHHHHHHHHHH--CCCCCCCCCHHHEEECCCCCEEEECCCE Q ss_conf 999999999984--6733234561232207998766614520 Q T0597 138 YNLLLGEKFIHE--SGIIHRDLKPANCLLNQDCSVKICDFGL 177 (429) Q Consensus 138 ~Qll~aL~yLH~--~~IiHRDiKPeNILi~~~~~iKl~DFGl 177 (429) .-=+.+|.-.|+ .+.+|.|-.|+||+-|..|.+||.|=+. T Consensus 148 ~agi~~L~~fH~~~~~~lHGD~np~NiM~D~~G~lKlVDP~~ 189 (308) T PF07387_consen 148 TAGIKDLMDFHSENQHCLHGDCNPDNIMCDKFGYLKLVDPVC 189 (308) T ss_pred HHHHHHHHHHHCCCCCEECCCCCHHHEEECCCCCEEECCHHH T ss_conf 876778888623689703377786665336889778607356 No 10 >PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) catalyses the committed step in the synthesis of phosphatidylcholine by the CDP-choline pathway .; PDB: 3dxq_A 3c5i_C 3fi8_A 2qg7_E 1nw1_B 2ig7_A 3feg_A 2cko_B 3f2r_A 3g15_B .... Probab=94.62 E-value=0.014 Score=31.40 Aligned_cols=29 Identities=41% Similarity=0.628 Sum_probs=25.7 Q ss_pred CCCCCCCCCHHHEEE-CCCCCEEEECCCEE Q ss_conf 673323456123220-79987666145200 Q T0597 150 SGIIHRDLKPANCLL-NQDCSVKICDFGLA 178 (429) Q Consensus 150 ~~IiHRDiKPeNILi-~~~~~iKl~DFGla 178 (429) .-.+|.||-|.|||+ +.++.++++||-.| T Consensus 143 ~v~cHnDl~~~Nil~~~~~~~i~lIDfEYa 172 (211) T PF01633_consen 143 LVFCHNDLLPGNILIDNEDGKIKLIDFEYA 172 (211) T ss_dssp EEEE-S--SGGGEEETSSSSCEEE--GTT- T ss_pred EEEEECCCCCCEEEEECCCCCEEEEEEECC T ss_conf 797505787450878468995899951215 No 11 >PF07914 DUF1679: Protein of unknown function (DUF1679); InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in zinc finger-C4 and HLH domain-containing kinases. In fact, one member of this family (Q9GUC1 from SWISSPROT) is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (IPR000536 from INTERPRO, IPR008946 from INTERPRO, and IPR001628 from INTERPRO). Probab=93.44 E-value=0.16 Score=24.84 Aligned_cols=118 Identities=17% Similarity=0.265 Sum_probs=65.8 Q ss_pred EECCCEEEEEEEE--------CCCCCEEEEEEECCH----------------HCCHHHHH------H--HHHHHHH---H Q ss_conf 4146607999898--------779978999985521----------------14878999------9--9999999---9 Q T0597 37 GRGSYGYVYLAYD--------KNANKNVAIKKVNRM----------------FEDLIDCK------R--ILREITI---L 81 (429) Q Consensus 37 G~G~fg~V~~a~d--------~~~~~~vAiK~i~~~----------------~~~~~~~~------~--~~rEi~i---l 81 (429) |.|-.|.|.++.- ..--..+|||+.+.. +......+ + --||+.. + T Consensus 44 ~~GFmS~I~lVe~dW~~~~~~~~LP~kf~lKI~S~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~HNrEV~~Ykil 123 (414) T PF07914_consen 44 GKGFMSRIALVEPDWTNVEPDKNLPKKFALKISSQLHLKALSEKMKFKGSNKFEEEKELKEFEKVLRELHNREVNFYKIL 123 (414) T ss_pred CCCHHHEEEEEECCEECCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 75524526898425011576767986189981333559999999751267788846899998999999888999999999 Q ss_pred HHCCCCCEEEEEEEEECCCCCCCC--EEEEEEHHHCCC-HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCC Q ss_conf 865998569999888648877554--378970301276-25786368988989999999999999999984673323456 Q T0597 82 NRLKSDYIIRLHDLIIPEDLLKFD--ELYIVLEIADSD-LKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLK 158 (429) Q Consensus 82 ~~l~HpnIv~l~~~~~~~~~~~~~--~~ylVmE~~~~~-L~~~i~~~~~l~~~~~~~i~~Qll~aL~yLH~~~IiHRDiK 158 (429) .+.+||++.--. +|........+ .=||+|||.++- -.+.+ ..++.+++. +++.||+.+|..++-+.|=. T Consensus 124 ~k~n~p~ip~pK-vY~~kkfd~en~~KG~IimE~ve~v~~~~~~---~~~~~~ql~----~il~~iA~f~a~s~~ls~Ee 195 (414) T PF07914_consen 124 EKFNHPNIPYPK-VYFLKKFDDENKTKGFIIMEYVENVHVRHMY---ENFKADQLI----PILKAIATFHALSLKLSEEE 195 (414) T ss_pred HHCCCCCCCCCC-EEEECCCCCCCCCCCEEEEEECCCCEEEECC---CCCCHHHHH----HHHHHHHHHHHHHCCCCHHH T ss_conf 834688998753-5651136777877778999825896686055---898999999----99999999998565588888 Q ss_pred HHHE Q ss_conf 1232 Q T0597 159 PANC 162 (429) Q Consensus 159 PeNI 162 (429) ...+ T Consensus 196 ~~~~ 199 (414) T PF07914_consen 196 KKSA 199 (414) T ss_pred HHHC T ss_conf 7643 No 12 >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast and AarF from Escherichia coli . These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and E. coli AarF is required for ubiquinone production . It has been suggested that members of the ABC1 family are novel chaperonins . These proteins are unrelated to the ABC transporter proteins. Probab=93.42 E-value=0.026 Score=29.64 Aligned_cols=45 Identities=22% Similarity=0.165 Sum_probs=31.6 Q ss_pred EEEEECCCEEEEEEEECCCCCEEEEEEECCHHCCHHHHHHHHHHHHHHHHC Q ss_conf 876414660799989877997899998552114878999999999999865 Q T0597 34 HLIGRGSYGYVYLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRL 84 (429) Q Consensus 34 ~~LG~G~fg~V~~a~d~~~~~~vAiK~i~~~~~~~~~~~~~~rEi~il~~l 84 (429) ..||.||-|+|++|+ ..+|+.||||+.... -...+...+.+|+.+ T Consensus 17 ~PlAsASIaQVHrA~-L~~g~~VaVKVqrP~-----i~~~i~~Dl~~l~~~ 61 (119) T PF03109_consen 17 EPLASASIAQVHRAT-LKDGREVAVKVQRPG-----IEEQIEADLAILRWL 61 (119) T ss_pred CHHHHHHHHHEEEEE-ECCCCEEEEEEECCC-----HHHHHHHHHHHHHHH T ss_conf 314454064614558-646640678776668-----899999999999999 No 13 >PF02958 DUF227: Domain of unknown function (DUF227); InterPro: IPR004119 This family includes proteins of unknown function. All known members of this group are proteins from drosophila and Caenorhabditis elegans. Probab=92.94 E-value=0.081 Score=26.63 Aligned_cols=117 Identities=15% Similarity=0.053 Sum_probs=61.5 Q ss_pred EECCCEEEEEEEECC----CC----CEEEEEEECCHHCCH---HHHHHHHHHHHHHHHCC----------CCC---EEEE Q ss_conf 414660799989877----99----789999855211487---89999999999998659----------985---6999 Q T0597 37 GRGSYGYVYLAYDKN----AN----KNVAIKKVNRMFEDL---IDCKRILREITILNRLK----------SDY---IIRL 92 (429) Q Consensus 37 G~G~fg~V~~a~d~~----~~----~~vAiK~i~~~~~~~---~~~~~~~rEi~il~~l~----------Hpn---Iv~l 92 (429) |.|-.|.+|++.=.. ++ ..+.||......... ....-+.+|+.+.+.+- ... ..+. T Consensus 2 Gd~y~s~~~R~~v~~~~~~~~~~~~~slivK~~p~~~~~~~~~~~~~~f~~E~~~Y~~ilP~l~~~~~~~~~~~~~~P~c 81 (293) T PF02958_consen 2 GDNYMSDMYRVTVEYELEDDGTEQPLSLIVKSPPDNPERREFFRKLGSFRREINFYREILPELEKLLKEAGEEFKFFPRC 81 (293) T ss_pred CCCEEEEEEEEEEEEEECCCCCEEEEEEEEEECCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCE T ss_conf 98706899999999997478975899999996899878898865333889999999999999999988558772363778 Q ss_pred EEEEECCCCCCCCEEEEEEHHHCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHE Q ss_conf 9888648877554378970301276257863689889899999999999999999846733234561232 Q T0597 93 HDLIIPEDLLKFDELYIVLEIADSDLKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANC 162 (429) Q Consensus 93 ~~~~~~~~~~~~~~~ylVmE~~~~~L~~~i~~~~~l~~~~~~~i~~Qll~aL~yLH~~~IiHRDiKPeNI 162 (429) +.+- ... ..-+||||=+...-+........++.++++ .++.+|+-+|......+..+|+.+ T Consensus 82 y~~~--~~~---~~~~lvlEDL~~~gy~~~~~~~~l~~~~~~----~~l~~LA~~HA~s~~~~~~~~~~~ 142 (293) T PF02958_consen 82 YYAS--SDP---EDDVLVLEDLTPRGYRMGDRRSGLDLEQVR----LVLKKLAKFHAASWALEEQNPELF 142 (293) T ss_pred EEEE--CCC---CCEEEEEECCCCCCCCCCCCCCCCCHHHHH----HHHHHHHHHHHHHHHHHHHCCCHH T ss_conf 8750--578---841899867750467556768999999999----999999999888899998785307 No 14 >PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR005581 This family includes eukaryotic fructosamine-3-kinase enzymes which may initiate a process leading to the deglycation of fructoselysine and of glycated proteins and in the phosphorylation of 1-deoxy-1-morpholinofructose, fructoselysine, fructoseglycine, fructose and glycated lysozyme. The family also includes bacterial members that have not been characterised but probably have a similar or identical function.; GO: 0016301 kinase activity; PDB: 3f7w_A. Probab=90.43 E-value=0.2 Score=24.21 Aligned_cols=73 Identities=15% Similarity=0.112 Sum_probs=44.2 Q ss_pred EEEEEECCCEEEEEEEECCCCCEEEEEEECCHHCCHHHHHHHHHHHHHHHHCCC--C-CEEEEEEEEECCCCCCCCEEEE Q ss_conf 987641466079998987799789999855211487899999999999986599--8-5699998886488775543789 Q T0597 33 KHLIGRGSYGYVYLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRLKS--D-YIIRLHDLIIPEDLLKFDELYI 109 (429) Q Consensus 33 ~~~LG~G~fg~V~~a~d~~~~~~vAiK~i~~~~~~~~~~~~~~rEi~il~~l~H--p-nIv~l~~~~~~~~~~~~~~~yl 109 (429) .+.+|-|..+.+|+.. .+++.+-+|.-... ....+.-|..-|+.|.. + .+.+.+.+....+ .-|+ T Consensus 22 ~~~v~gG~i~~~~~~~--~~~~~~FvK~~~~~-----~~~~f~~Ea~gL~~L~~~~~~~vP~v~~~g~~~~-----~~~L 89 (288) T PF03881_consen 22 AEPVSGGDINEAYRLE--TDGGRYFVKTNSPD-----PAGMFEGEAEGLKALAETNPIRVPEVIAWGETDD-----DSFL 89 (288) T ss_dssp ----------------------EEEEEE-------------HHHHH-------------S--B---B---------TTEE T ss_pred CCCCCCCCCCCCCCCC--CCCCCEEEEECCCC-----CHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCC-----CCEE T ss_conf 1111111111123333--79962799957843-----2899999999999998339998885899831356-----5379 Q ss_pred EEHHHCCC Q ss_conf 70301276 Q T0597 110 VLEIADSD 117 (429) Q Consensus 110 VmE~~~~~ 117 (429) |||+.+.+ T Consensus 90 vle~l~~~ 97 (288) T PF03881_consen 90 VLEFLDMG 97 (288) T ss_dssp EEE----- T ss_pred EEEEECCC T ss_conf 89872488 No 15 >PF04655 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic resistance kinase; InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties . Aminoglycoside phosphotransferases achieve inactivation of these enzymes by phosphorylation, utilising ATP. Likewise, hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0006468 protein amino acid phosphorylation, 0019748 secondary metabolic process Probab=82.94 E-value=0.94 Score=20.08 Aligned_cols=74 Identities=16% Similarity=0.021 Sum_probs=48.3 Q ss_pred EEEEECCCEEEEEEEECCCCCEEEEEEECCHHCCHHHHHHHHHHH---HHHHHCCCCCEEEEEEEEECCCCCCCCEEEEE Q ss_conf 876414660799989877997899998552114878999999999---99986599856999988864887755437897 Q T0597 34 HLIGRGSYGYVYLAYDKNANKNVAIKKVNRMFEDLIDCKRILREI---TILNRLKSDYIIRLHDLIIPEDLLKFDELYIV 110 (429) Q Consensus 34 ~~LG~G~fg~V~~a~d~~~~~~vAiK~i~~~~~~~~~~~~~~rEi---~il~~l~HpnIv~l~~~~~~~~~~~~~~~ylV 110 (429) ...-.|..|.|+.++ +.+|...++|+-..... ...|. ..|+..+....|++++.=.. .--+. T Consensus 8 g~~~~g~~s~V~pV~-~~dG~pAvLKl~~p~~~-------~~~E~~g~~~Lr~w~G~GaVrll~~d~~-------~~AlL 72 (253) T PF04655_consen 8 GPPAHGHSSLVLPVR-RADGTPAVLKLAPPHDE-------AEEERRGEAALRWWDGRGAVRLLAHDPD-------RGALL 72 (253) T ss_pred CCCCCCCEEEEEEEE-CCCCCEEEEEECCCCCC-------CHHHHHHHHHHHHCCCCCEEEEECCCCC-------CCHHH T ss_conf 876788505899998-78999588981278654-------2045677899983289875864101043-------22699 Q ss_pred EHHH-CC-CHHHHH Q ss_conf 0301-27-625786 Q T0597 111 LEIA-DS-DLKKLF 122 (429) Q Consensus 111 mE~~-~~-~L~~~i 122 (429) ||.+ ++ +|.++- T Consensus 73 LErl~~~~~L~~~~ 86 (253) T PF04655_consen 73 LERLDPGRSLADLP 86 (253) T ss_pred HHHCCCCCCHHHHH T ss_conf 98705998777863 No 16 >PF12260 PIP49_C: Pancreatitis induced protein 49 C terminal Probab=70.95 E-value=2.1 Score=17.96 Aligned_cols=94 Identities=17% Similarity=0.199 Sum_probs=54.5 Q ss_pred HHHHHHHHHCCCC-CEEEEEEEEECCCCCCCCEEEEEEHHHC-CCHHH-----HHHC----------CCC--CCHHHHHH Q ss_conf 9999999865998-5699998886488775543789703012-76257-----8636----------898--89899999 Q T0597 75 LREITILNRLKSD-YIIRLHDLIIPEDLLKFDELYIVLEIAD-SDLKK-----LFKT----------PIF--LTEQHVKT 135 (429) Q Consensus 75 ~rEi~il~~l~Hp-nIv~l~~~~~~~~~~~~~~~ylVmE~~~-~~L~~-----~i~~----------~~~--l~~~~~~~ 135 (429) .+|..++..++.. +.-++++. -.++| |+|+.+ ++++. +++. .+. -++..-.. T Consensus 12 ~nE~ll~~~lq~~eh~PkllG~--------CG~lY-~tE~v~~~~~~~~~lp~~~~~~~p~~~~~~~~q~~~p~Wp~raK 82 (205) T PF12260_consen 12 QNEYLLMVLLQEKEHFPKLLGS--------CGDLY-VTEYVPHGSLYGLSLPWILESFIPSGLRRSMDQWFTPSWPRRAK 82 (205) T ss_pred CCHHHHHHHHCCCCCCHHHHCC--------CCCHH-EEECCCCCCCCCCCCCHHHHHCCCHHHHHHHHHHCCCCCHHHHH T ss_conf 1489999996232315577625--------52330-04044653101434523665405235555678762776048999 Q ss_pred HHHHHHHHHHHHHH---CCCCCCCCCHHHEEECCCCCEEEECCCE Q ss_conf 99999999999984---6733234561232207998766614520 Q T0597 136 ILYNLLLGEKFIHE---SGIIHRDLKPANCLLNQDCSVKICDFGL 177 (429) Q Consensus 136 i~~Qll~aL~yLH~---~~IiHRDiKPeNILi~~~~~iKl~DFGl 177 (429) |+..++.=|..+-. ....+.|++|+|+=++.+..+|.+|--. T Consensus 83 Iai~iLe~veelf~~~~g~l~mCDv~~~nfG~t~~~~lK~~D~~~ 127 (205) T PF12260_consen 83 IAIGILEFVEELFHGSYGPLQMCDVSPGNFGYTDDYRLKYIDLDM 127 (205) T ss_pred HHHHHHHHHHHHHCCCCCCEEEECCCCHHCCCCCCCCEEEEEHHH T ss_conf 999999999998168877766743540103456887668875656 No 17 >PF10140 essB: Predicted membrane protein essB Probab=57.63 E-value=3.7 Score=16.41 Aligned_cols=93 Identities=17% Similarity=0.289 Sum_probs=54.4 Q ss_pred HHHHHHHHHCCCCCEEEEEEEEECCCCCCCCEEEEEEHHHC--CCHHHHHHCCCCCCHHHHHHHHHHHHHHHHH-HHHCC Q ss_conf 99999998659985699998886488775543789703012--7625786368988989999999999999999-98467 Q T0597 75 LREITILNRLKSDYIIRLHDLIIPEDLLKFDELYIVLEIAD--SDLKKLFKTPIFLTEQHVKTILYNLLLGEKF-IHESG 151 (429) Q Consensus 75 ~rEi~il~~l~HpnIv~l~~~~~~~~~~~~~~~ylVmE~~~--~~L~~~i~~~~~l~~~~~~~i~~Qll~aL~y-LH~~~ 151 (429) .+|..+|+. .||..++. .+-+.+ +.+.+..+.-+ .++..+ ..++.....+++.+ +.+|+- +|+ T Consensus 12 ~~e~~lL~~-~~~~f~~~-~I~e~e-----D~~~~~y~~~~~~~sf~~i----kk~~~~~klr~a~n-i~~l~~~~~~-- 77 (359) T PF10140_consen 12 LRELNLLKQ-ESPLFLPV-EIEETE-----DEVVFTYQLPPKMKSFEEI----KKLDKNEKLRLALN-IGALDEHLNS-- 77 (359) T ss_pred HHHHHHHHC-CCCCCCCC-EEEECC-----CEEEEEEECCCCCCCHHHH----HHCCHHHHHHHHHH-HHHHHHHHCC-- T ss_conf 899998736-67666774-366506-----4699999657134778988----63569899999998-9999997516-- Q ss_pred CCCCCCCHHHEEECCCCCEEEECCCEEECC Q ss_conf 332345612322079987666145200024 Q T0597 152 IIHRDLKPANCLLNQDCSVKICDFGLARTI 181 (429) Q Consensus 152 IiHRDiKPeNILi~~~~~iKl~DFGla~~~ 181 (429) =+|==|.|+||+++.++.++++=.|+-..+ T Consensus 78 r~tf~L~PeNL~f~~~~~p~~~hRGi~~~l 107 (359) T PF10140_consen 78 RYTFFLHPENLVFDKNLMPKIIHRGIKEIL 107 (359) T ss_pred EEEEEECCCCEEECCCCCEEEEECCCCCCC T ss_conf 212897040158848998687641665668 No 18 >PF00454 PI3_PI4_kinase: Phosphatidylinositol 3- and 4-kinase; InterPro: IPR000403 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. The enzymes fall into two broad classes, characterised with respect to substrate specificity: serine/threonine specific and tyrosine specific . Protein kinase function has been evolutionarily conserved from Escherichia coli to Homo sapiens. Protein kinases play a role in a mulititude of cellular processes, including division, proliferation, apoptosis, and differentiation . Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved , leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases . Phosphatidylinositol 3-kinase (PI3-kinase) (2.7.1.137 from EC) is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. The three products of PI3-kinase - PI-3-P, PI-3,4-P(2) and PI-3,4,5-P(3) function as secondary messengers in cell signalling. Phosphatidylinositol 4-kinase (PI4-kinase) (2.7.1.67 from EC) is an enzyme that acts on phosphatidylinositol (PI) in the first committed step in the production of the secondary messenger inositol-1'4'5'-trisphosphate. This domain is also present in a wide range of protein kinases, involved in diverse cellular functions, such as control of cell growth, regulation of cell cycle progression, a DNA damage checkpoint, recombination, and maintenance of telomere length. Despite significant homology to lipid kinases, no lipid kinase activity has been demonstrated for any of the PIK-related kinases . The PI3- and PI4-kinases share a well conserved domain at their C-terminal section; this domain seems to be distantly related to the catalytic domain of protein kinases , . The catalytic domain of PI3K has the typical bilobal structure that is seen in other ATP-dependent kinases, with a small N-terminal lobe and a large C-terminal lobe. The core of this domain is the most conserved region of the PI3Ks. The ATP cofactor binds in the crevice formed by the N-and C-terminal lobes, a loop between two strands provides a hydrophobic pocket for binding of the adenine moiety, and a lysine residue interacts with the alpha-phosphate. In contrast to protein kinases, the PI3K loop which interacts with the phosphates of the ATP and is known as the glycine-rich or P-loop, contains no glycine residues. Instead, contact with the ATP -phosphate is maintained through the side chain of a conserved serine residue. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 1e7v_A 1e8x_A 1e7u_A 1e90_A 1e8w_A 3dbs_A 3cst_A 3ene_A 2chw_A 3dpd_A .... Probab=56.58 E-value=1.6 Score=18.64 Aligned_cols=25 Identities=32% Similarity=0.514 Sum_probs=21.6 Q ss_pred CCCCCHHHEEE-CCCCCEEEECCCEE Q ss_conf 23456123220-79987666145200 Q T0597 154 HRDLKPANCLL-NQDCSVKICDFGLA 178 (429) Q Consensus 154 HRDiKPeNILi-~~~~~iKl~DFGla 178 (429) =.|=.|+|||+ ..+|++-=+|||.+ T Consensus 138 lgDRh~~NIli~~~~G~v~hIDfg~~ 163 (235) T PF00454_consen 138 LGDRHPGNILIDDKTGHVVHIDFGFC 163 (235) T ss_dssp -----GGGEEE-E----EEE-----T T ss_pred CCCCCCCCEEEECCCCEEEEEECHHH T ss_conf 79999550899426777999864886 No 19 >PF02816 Alpha_kinase: Alpha-kinase family; InterPro: IPR004166 Proteins containing this domain consist of a novel group of eukaryotic protein kinase catalytic domains, which have no detectable similarity to conventional kinases. Proteins include myosin heavy chain kinases , and Elongation Factor-2 kinase and a bifunctional ion channel .; GO: 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0006468 protein amino acid phosphorylation; PDB: 1iaj_A 1ia9_B 1iah_A. Probab=56.40 E-value=3.9 Score=16.28 Aligned_cols=124 Identities=11% Similarity=0.156 Sum_probs=61.9 Q ss_pred EECCCEEEEEEEEC---CCCCEEEEEEECCHHCCHHHHHHHHHHHHH-------HH----HC----CCCCEEEEEE---E Q ss_conf 41466079998987---799789999855211487899999999999-------98----65----9985699998---8 Q T0597 37 GRGSYGYVYLAYDK---NANKNVAIKKVNRMFEDLIDCKRILREITI-------LN----RL----KSDYIIRLHD---L 95 (429) Q Consensus 37 G~G~fg~V~~a~d~---~~~~~vAiK~i~~~~~~~~~~~~~~rEi~i-------l~----~l----~HpnIv~l~~---~ 95 (429) |+|++=.||++++. ..++.+.+|.-........ ......|+.. ++ .+ ..+.-+.++. + T Consensus 2 a~G~~r~~f~~~~~~~~~~~~~~V~K~~~~~~~~~~-~~~~~~~~~~q~~a~~~a~~Fn~~~~~~~~~~~~i~f~~~~~v 80 (188) T PF02816_consen 2 AKGAMRKAFRMKDTPGEKSGQRYVAKRFKKIISDVN-EEYYFQECKSQMIAQELAEKFNKELRKNNNFPPNISFLPCYLV 80 (188) T ss_dssp -----EEEEEEEEEGSS----EEEEEEE-HH-TSHH-HHHHHHHHHHHHHHHHHHHHHHHHS---TT-----EE--EEEE T ss_pred CCCCEEEEEEEEECCCCCCCCEEEEEEECCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEE T ss_conf 988479999999934777797899998266665145-9999999999999999999998764113488876169620189 Q ss_pred EECCCCCCCCEEEEEEHHHCCCHHHHHHCCCCC--CHHHHHHHHHHHHHHHHHHHHCC-CCCCCCCHHH Q ss_conf 864887755437897030127625786368988--98999999999999999998467-3323456123 Q T0597 96 IIPEDLLKFDELYIVLEIADSDLKKLFKTPIFL--TEQHVKTILYNLLLGEKFIHESG-IIHRDLKPAN 161 (429) Q Consensus 96 ~~~~~~~~~~~~ylVmE~~~~~L~~~i~~~~~l--~~~~~~~i~~Qll~aL~yLH~~~-IiHRDiKPeN 161 (429) ++.++.......|+|-++.+++...+-.+.+.. .......-+.|-++=-.|.++.| .+..||.--+ T Consensus 81 ~~~~~~~~~~~~~~vE~~l~g~f~Kyn~n~g~~~~~~~~~~~~~~~aFSHfty~~S~g~~lv~DlQG~~ 149 (188) T PF02816_consen 81 YELEDPSPGKQYFLVEPFLEGEFVKYNSNDGWVENDDSDEVNQFLQAFSHFTYHRSGGQLLVCDLQGVG 149 (188) T ss_dssp EES--------EEEEEE--------SB-----B-----SHHHHHHHHHHHHHHHHT---EEEE--B--- T ss_pred EEECCCCCEEEEEEEEECCCCCEEEECCCCCCCCCCCCCHHHHHHHHHEEEEEEEECCEEEEEEEEECC T ss_conf 997688750679998201368606652688744444302699996662336825559879999988558 No 20 >PF05858 BIV_Env: Bovine immunodeficiency virus surface protein (SU); InterPro: IPR008411 The bovine lentivirus also known as the bovine immunodeficiency-like virus (Bovine immunodeficiency virus) has conserved and hypervariable regions in the surface envelope gene .; GO: 0016021 integral to membrane, 0030120 vesicle coat Probab=27.56 E-value=11 Score=13.43 Aligned_cols=17 Identities=29% Similarity=0.386 Sum_probs=7.2 Q ss_pred HHHHHHCCCCCEEEEEE Q ss_conf 99998659985699998 Q T0597 78 ITILNRLKSDYIIRLHD 94 (429) Q Consensus 78 i~il~~l~HpnIv~l~~ 94 (429) |-.|++-+.++|..-.| T Consensus 163 il~mrrsn~~~ilaard 179 (548) T PF05858_consen 163 ILAMRRSNSEGILAARD 179 (548) T ss_pred HEEEECCCCCCCEEECC T ss_conf 42552268655232201 No 21 >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR000780 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order . Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI ), shared by other AdoMet-Mtases , is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments , although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases , , , . The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences . Flagellated bacteria swim towards favourable chemicals and away from deleterious ones. Sensing of chemoeffector gradients involves chemotaxis receptors, transmembrane (TM) proteins that detect stimuli through their periplasmic domains and transduce the signals via their cytoplasmic domains , . Signalling outputs from these receptors are influenced both by the binding of the chemoeffector ligand to their periplasmic domains and by methylation of specific glutamate residues on their cytoplasmic domains. Methylation is catalysed by CheR, an S-adenosylmethionine-dependent methyltransferase , which reversibly methylates specific glutamate residues within a coiled coil region, to form gamma-glutamyl methyl ester residues , . The structure of the Salmonella typhimurium chemotaxis receptor methyltransferase CheR, bound to S-adenosylhomocysteine, has been determined to a resolution of 2.0 A . The structure reveals CheR to be a two-domain protein, with a smaller N-terminal helical domain linked via a single polypeptide connection to a larger C-terminal alpha/beta domain. The C-terminal domain has the characteristics of a nucleotide-binding fold, with an insertion of a small anti-parallel beta-sheet subdomain. The S-adenosylhomocysteine-binding site is formed mainly by the large domain, with contributions from residues within the N-terminal domain and the linker region .; GO: 0008757 S-adenosylmethionine-dependent methyltransferase activity; PDB: 1bc5_A 1af7_A. Probab=20.48 E-value=5.6 Score=15.29 Aligned_cols=12 Identities=42% Similarity=1.093 Sum_probs=8.3 Q ss_pred CCHHHHHHHHHH Q ss_conf 701322357899 Q T0597 235 TNSIDIWSTGCI 246 (429) Q Consensus 235 ~~~~DiWSlG~i 246 (429) +...=|||.||- T Consensus 30 ~~~lriwsagCs 41 (196) T PF01739_consen 30 GRPLRIWSAGCS 41 (196) T ss_dssp ---EEEEETT-- T ss_pred CCCEEEEECCCC T ss_conf 996689976778 Done!