Query T0598 3NJC, Bacillus subtilis, 161 residues Match_columns 161 No_of_seqs 58 out of 60 Neff 3.9 Searched_HMMs 11830 Date Mon Jul 5 09:00:21 2010 Command /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/seq/T0598.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/T0598.hhr No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF10702 DUF2507: Protein of u 100.0 0 0 368.2 12.5 124 24-147 1-124 (124) 2 PF03639 Glyco_hydro_81: Glyco 68.8 1.3 0.00011 21.7 2.6 38 23-60 345-387 (695) 3 PF10833 DUF2572: Protein of u 35.5 5.7 0.00049 17.9 1.3 50 2-55 97-148 (221) 4 PF11069 DUF2870: Protein of u 23.8 3.5 0.0003 19.1 -1.4 17 46-62 3-19 (98) 5 PF09074 Mer2: Mer2; InterPro 19.8 8.8 0.00074 16.8 -0.1 36 39-74 26-62 (193) 6 PF11510 FA_FANCE: Fanconi Ana 19.8 24 0.002 14.2 3.1 52 26-77 88-142 (263) 7 PF01916 DS: Deoxyhypusine syn 18.8 25 0.0021 14.1 2.1 46 23-74 141-193 (299) 8 PF06762 DUF1222: Protein of u 15.2 16 0.0014 15.2 0.4 10 83-92 253-262 (384) 9 PF09865 DUF2092: Predicted pe 12.1 37 0.0032 13.0 1.7 63 97-159 9-71 (214) 10 PF06874 FBPase_2: Firmicute f 11.9 11 0.00095 16.1 -1.2 35 88-128 307-341 (640) No 1 >PF10702 DUF2507: Protein of unknown function (DUF2507) Probab=100.00 E-value=0 Score=368.19 Aligned_cols=124 Identities=60% Similarity=1.065 Sum_probs=122.7 Q ss_pred HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCEEEEEECCCEEEEEECCHHHHHHHHC Q ss_conf 57899999865366404766413457757887535855644689999860687136753145426888738578989750 Q T0598 24 AYAYGLIREIVLPDMLGQDYSSMMYWAGKHLARKFPLESWEEFPAFFEEAGWGTLTNVSAKKQELEFELEGPIISNRLKH 103 (161) Q Consensus 24 ~Fg~~LlRd~lLP~lLG~d~~~ILYWAGK~LARkfPl~s~edl~~FF~~AgwG~Lsl~kek~~e~~feLsG~~v~~Rl~~ 103 (161) +|||+||||.|||+|||+|+++|||||||+||||||++|.||++.||++||||+|+++|+|+++++|+|+||+|+.|+++ T Consensus 1 ~fg~~LlRd~lLp~iLG~d~~~ILYWaGK~LARk~pl~s~edl~~FF~~agwG~L~i~kek~~~~~~eLsG~~v~~Rl~~ 80 (124) T PF10702_consen 1 YFGYELLRDILLPEILGKDTDHILYWAGKRLARKFPLESLEDLIAFFEQAGWGTLSIVKEKRQEQQFELSGPIVSNRLAS 80 (124) T ss_pred CCHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHCCCCCHHHHHHHHHHCCCCEEEEEEECCCEEEEEECCCHHHHHHHC T ss_conf 91799999846788738988745243007788509964688899999983984568853136427999769389867630 Q ss_pred CCCCCEEEHHHHHHHHHHHHHCCEEEEEEEECCCCCEEEEEEEE Q ss_conf 48984442123799999988183001200011356768999987 Q T0598 104 QKEPCFQLEAGFIAEQIQLMNDQIAESYEQVKKRADKVVLTVKW 147 (161) Q Consensus 104 ~~~~~F~LEAGFlAeqiq~q~~~vtEa~~~~~kk~~~V~i~V~~ 147 (161) +++|||+|||||||||||+|++++|||++++++|+++|+|+|+| T Consensus 81 ~~~~~F~LEAGFlAe~iq~q~~~~aEa~~~~~~~~~~V~i~V~w 124 (124) T PF10702_consen 81 NDEPSFQLEAGFLAEQIQQQKGVVAEAYEEIKKKKKKVQITVKW 124 (124) T ss_pred CCCCCEEEEHHHHHHHHHHHHCCEEEEEEEECCCCCEEEEEEEC T ss_conf 79986776057999999998697278988650668759999979 No 2 >PF03639 Glyco_hydro_81: Glycosyl hydrolase family 81 ; InterPro: IPR005200 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families , , . This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site . Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. This is a family of eukaryotic beta-1,3-glucanases belonging to glycoside hydrolase family 81 (GH81 from CAZY). Probab=68.80 E-value=1.3 Score=21.66 Aligned_cols=38 Identities=26% Similarity=0.244 Sum_probs=25.3 Q ss_pred CHHHHHHHHHHHHHHHCCCCCCC-----HHHHHHHHHHHHCCC Q ss_conf 05789999986536640476641-----345775788753585 Q T0598 23 NAYAYGLIREIVLPDMLGQDYSS-----MMYWAGKHLARKFPL 60 (161) Q Consensus 23 ~~Fg~~LlRd~lLP~lLG~d~~~-----ILYWAGK~LARkfPl 60 (161) +.=....|++.+..++=++.... =+||.||.|||-=-+ T Consensus 345 s~~~~~~i~~a~~~e~~~~~~~~~~~~ds~Y~~GK~l~k~A~l 387 (695) T PF03639_consen 345 SEEALQAIVSAANKELNQDISSQITNLDSMYFSGKALAKYARL 387 (695) T ss_pred CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHH T ss_conf 9999999999999886013434555567766117899999999 No 3 >PF10833 DUF2572: Protein of unknown function (DUF2572) Probab=35.49 E-value=5.7 Score=17.87 Aligned_cols=50 Identities=20% Similarity=0.490 Sum_probs=29.7 Q ss_pred CCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHH--HHHHCCCCCCCHHHHHHHHHH Q ss_conf 988521134533445654031057899999865--366404766413457757887 Q T0598 2 AGDPMKSKFEASIDNLKEIEMNAYAYGLIREIV--LPDMLGQDYSSMMYWAGKHLA 55 (161) Q Consensus 2 ~~~~mk~~~~~~~~~~~~~~~~~Fg~~LlRd~l--LP~lLG~d~~~ILYWAGK~LA 55 (161) ++-|-|.+|+..++++-+.+. .++.|..+ +|..+-.+.+..+||.-+.-+ T Consensus 97 k~kPtK~~~~~~lsd~l~~e~----~~if~~~~~~lp~~~~~eq~pklyw~~~~~~ 148 (221) T PF10833_consen 97 KKKPTKKKYIGQLSDYLNLEN----LEIFQHHFASLPRILSSEQAPKLYWVDKNQI 148 (221) T ss_pred CCCCCCHHHHHHHHHHHHHHH----HHHHHHHHCCCCCCCCCCCCCEEEEEECCCH T ss_conf 049961167889999980665----8888876404887644466876999815725 No 4 >PF11069 DUF2870: Protein of unknown function (DUF2870) Probab=23.79 E-value=3.5 Score=19.14 Aligned_cols=17 Identities=41% Similarity=0.802 Sum_probs=12.9 Q ss_pred HHHHHHHHHHHHCCCCC Q ss_conf 34577578875358556 Q T0598 46 MMYWAGKHLARKFPLES 62 (161) Q Consensus 46 ILYWAGK~LARkfPl~s 62 (161) -|.||||.|.|-=.|.+ T Consensus 3 ~LW~aGK~l~~~k~l~d 19 (98) T PF11069_consen 3 QLWWAGKELQRGKKLSD 19 (98) T ss_pred EEEECCCCCCCCCCHHH T ss_conf 58852630248862888 No 5 >PF09074 Mer2: Mer2; InterPro: IPR015159 Mer2 (Rec107) forms part of a complex that is required for meiotic double strand DNA break formation. Mer2 increases in abundance and is phosphorylated during the prophase phase of cell division . Blocking double strand break formation results in delayed dephosphorylation and dissociation of Mer2 from the chromosome . Probab=19.83 E-value=8.8 Score=16.78 Aligned_cols=36 Identities=22% Similarity=0.347 Sum_probs=21.7 Q ss_pred CCCCCCCHHHHHHHHHHHHCCC-CCHHHHHHHHHHCC Q ss_conf 0476641345775788753585-56446899998606 Q T0598 39 LGQDYSSMMYWAGKHLARKFPL-ESWEEFPAFFEEAG 74 (161) Q Consensus 39 LG~d~~~ILYWAGK~LARkfPl-~s~edl~~FF~~Ag 74 (161) |++-..-||-||||-=---..| +..+.|+.||+++. T Consensus 26 l~eaDkqileWAgkLELESidLrEk~d~Li~~L~~~~ 62 (193) T PF09074_consen 26 LEEADKQILEWAGKLELESIDLREKSDKLINVLNEMC 62 (193) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 6468899999987744346238888999999999989 No 6 >PF11510 FA_FANCE: Fanconi Anaemia group E protein FANCE; PDB: 2ilr_A. Probab=19.77 E-value=24 Score=14.22 Aligned_cols=52 Identities=21% Similarity=0.406 Sum_probs=42.0 Q ss_pred HHHHHHHHHHHHHCC--CCCCCHHHHHHHHHHHHCCCCCHHHHHHH-HHHCCCCC Q ss_conf 899999865366404--76641345775788753585564468999-98606871 Q T0598 26 AYGLIREIVLPDMLG--QDYSSMMYWAGKHLARKFPLESWEEFPAF-FEEAGWGT 77 (161) Q Consensus 26 g~~LlRd~lLP~lLG--~d~~~ILYWAGK~LARkfPl~s~edl~~F-F~~AgwG~ 77 (161) +..++|-.+||-|++ +-.+.+|--|=.+.+++||-...+.+... -.+.|.|. T Consensus 88 ~~~f~~~~lLPkll~l~e~ASR~L~sa~~sfck~~p~~~~~all~PlL~~~~~g~ 142 (263) T PF11510_consen 88 ACVFLRSLLLPKLLSLNEPASRVLVSAVISFCKRYPRPACEALLLPLLQKPGIGN 142 (263) T ss_dssp HHHHHHHHH---TTT-SS---HHHHHHHHHHHHHSHHHHHHHHHHHHHH------ T ss_pred HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCC T ss_conf 9999999988887315896017999999999986889999999999981699982 No 7 >PF01916 DS: Deoxyhypusine synthase; InterPro: IPR002773 Eukaryotic initiation factor 5A (eIF-5A) contains an unusual amino acid, hypusine [N epsilon-(4-aminobutyl-2-hydroxy)lysine]. The first step in the post-translational formation of hypusine is catalysed by the enzyme deoxyhypusine synthase (DS) 2.5.1.46 from EC. The enzyme catalyses the following reaction:Spermidine + [eIF-5A]-lysine = 1,3-diaminopropane + [eIF-5A]-deoxyhypusine The modified version of eIF-5A, and DS, are required for eukaryotic cell proliferation . The structure is known for this enzyme in complex with its NAD^+ cofactor.; GO: 0008612 hypusine biosynthetic process from peptidyl-lysine; PDB: 1rqd_B 1rlz_A 1dhs_A 1roz_A. Probab=18.75 E-value=25 Score=14.08 Aligned_cols=46 Identities=24% Similarity=0.395 Sum_probs=27.4 Q ss_pred CHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCC-------CCHHHHHHHHHHCC Q ss_conf 05789999986536640476641345775788753585-------56446899998606 Q T0598 23 NAYAYGLIREIVLPDMLGQDYSSMMYWAGKHLARKFPL-------ESWEEFPAFFEEAG 74 (161) Q Consensus 23 ~~Fg~~LlRd~lLP~lLG~d~~~ILYWAGK~LARkfPl-------~s~edl~~FF~~Ag 74 (161) +.+..++++... .-|. +.++|||||=|+ .-|+ .|+-+...|+.+.+ T Consensus 141 ~~s~~e~i~~lG--~~i~-~e~Sil~~Ay~~---~VPVf~Pa~tDssiG~~l~~~~~~~ 193 (299) T PF01916_consen 141 HWSPSEFIYELG--KEIN-DEDSILYWAYKN---NVPVFCPAITDSSIGDMLWFHSQKN 193 (299) T ss_dssp ---HHHHHHH------S---TT-HHHHHHHT---T--EE-TTTT------HHHHHHHH- T ss_pred EECHHHHHHHHH--HHCC-CCCCHHHHHHHC---CCCEECCCCCHHHHHHHHHHHHHHC T ss_conf 687999999997--3548-988299999985---9988868855366999999998736 No 8 >PF06762 DUF1222: Protein of unknown function (DUF1222); InterPro: IPR009613 This family, which includes bacterial and eukaryotic members, represents a conserved region located towards the C-terminal end of a number of hypothetical proteins of unknown function. These are possibly integral membrane proteins. Probab=15.17 E-value=16 Score=15.18 Aligned_cols=10 Identities=20% Similarity=0.159 Sum_probs=3.5 Q ss_pred ECCCEEEEEE Q ss_conf 1454268887 Q T0598 83 AKKQELEFEL 92 (161) Q Consensus 83 ek~~e~~feL 92 (161) ..|.|.+.|= T Consensus 253 ~~R~EiIiEG 262 (384) T PF06762_consen 253 RGRPEIIIEG 262 (384) T ss_pred CCCEEEEEEE T ss_conf 9850899985 No 9 >PF09865 DUF2092: Predicted periplasmic protein (DUF2092) Probab=12.10 E-value=37 Score=13.03 Aligned_cols=63 Identities=19% Similarity=0.086 Sum_probs=0.0 Q ss_pred HHHHHHCCCCCCEEEHHHHHHHHHHHHHCCEEEEEEEECCCCCEEEEEEEECCCCCCCCCCCC Q ss_conf 898975048984442123799999988183001200011356768999987787762021124 Q T0598 97 ISNRLKHQKEPCFQLEAGFIAEQIQLMNDQIAESYEQVKKRADKVVLTVKWDMKDPVLEHHHH 159 (161) Q Consensus 97 v~~Rl~~~~~~~F~LEAGFlAeqiq~q~~~vtEa~~~~~kk~~~V~i~V~~D~kd~i~~~~~~ 159 (161) ++.++...+.=+|+..+.+=.-+-..|+-..+......-+|+++++++++-|..+........ T Consensus 9 m~~~L~~~k~fsf~~~~~~d~v~~~gqklq~~~~~~v~v~RPdklrv~~~gd~~~~~~~yDGk 71 (214) T PF09865_consen 9 MSDYLAAQKSFSFTADVTYDVVLPSGQKLQYTSSGTVWVQRPDKLRVDYRGDGRDREFYYDGK 71 (214) T ss_pred HHHHHHHCCEEEEEEEEECCEECCCCCEEEEEEEEEEEEECCCEEEEEEECCCCCEEEEECCC T ss_conf 999986473789999953210168997688888999998469828999956884106998897 No 10 >PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate . This is an essential reaction in the process of gluconeogenesis, the process by which non-carbohydrate precursors are converted to glucose, and hence this enzyme is found almost universally. Enzyme activity can be regulated by a number of different mechanisms including AMP inhibition, cylic AMP-dependent phosphorylation and light-dependent-activation. This entry represents a group of fructose 1,6-bisphosphatases found within the Firmicutes (low GC Gram-positive bacteria) which do not show any significant sequence similarity to the enzymes from other organisms. The Bacillus subtilis enzyme is inhibited by AMP, though this can be overcome by phosphoenolpyruvate, and is dependent on Mn(2+) , . Mutants lacking this enzyme are apparently still able to grow on gluconeogenic growth substrates such as malate and glycerol. Probab=11.95 E-value=11 Score=16.14 Aligned_cols=35 Identities=29% Similarity=0.631 Sum_probs=0.0 Q ss_pred EEEEECCHHHHHHHHCCCCCCEEEHHHHHHHHHHHHHCCEE Q ss_conf 68887385789897504898444212379999998818300 Q T0598 88 LEFELEGPIISNRLKHQKEPCFQLEAGFIAEQIQLMNDQIA 128 (161) Q Consensus 88 ~~feLsG~~v~~Rl~~~~~~~F~LEAGFlAeqiq~q~~~vt 128 (161) ++|.|.|+++.+ .|+|++|---|-..|-..+|+++ T Consensus 307 IQFKLEgqlI~R------~Pef~Me~RllL~kId~~~gti~ 341 (640) T PF06874_consen 307 IQFKLEGQLIKR------RPEFGMEDRLLLDKIDYEKGTIT 341 (640) T ss_pred HHHHHHHHHHHH------CCCCCCCHHHHHHHCCCCCCEEE T ss_conf 999872898966------98878631046665175479899 Done!