Query T0606 ZP_02040151.1, Ruminococcus gnavus , 169 residues Match_columns 169 No_of_seqs 5 out of 7 Neff 2.1 Searched_HMMs 11830 Date Mon Jul 5 08:52:02 2010 Command /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/seq/T0606.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/T0606.hhr No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF00496 SBP_bac_5: Bacterial 82.9 1.2 9.8E-05 22.2 5.5 99 47-146 198-349 (372) 2 PF10029 DUF2271: Predicted pe 78.9 0.3 2.5E-05 25.5 1.3 38 25-62 62-107 (139) 3 PF09911 DUF2140: Uncharacteri 58.1 5.6 0.00047 18.4 4.6 71 5-96 8-78 (187) 4 PF07859 Abhydrolase_3: alpha/ 53.0 6.8 0.00057 17.9 4.1 42 87-129 164-205 (211) 5 PF06711 DUF1198: Protein of u 52.5 2.3 0.00019 20.5 1.4 69 5-87 4-72 (148) 6 PF07095 IgaA: Intracellular g 39.9 4.6 0.00039 18.8 1.4 105 51-158 427-549 (705) 7 PF02399 Herpes_ori_bp: Origin 34.6 13 0.0011 16.2 3.1 61 103-166 87-151 (824) 8 PF05442 Microvirus_A: Microvi 32.9 10 0.00086 16.9 2.2 91 55-151 18-109 (187) 9 PF11602 NTPase_P4: ATPase P4 30.5 12 0.001 16.5 2.3 70 8-78 164-243 (320) 10 PF01520 Amidase_3: N-acetylmu 28.6 17 0.0014 15.6 2.9 36 92-127 87-127 (175) 11 PF12262 Lipase_bact_N: Bacter 27.4 10 0.00088 16.8 1.5 20 1-20 1-21 (268) 12 PF12094 DUF3570: Protein of u 22.0 11 0.00095 16.6 0.9 75 28-105 69-149 (420) 13 PF05908 DUF867: Protein of un 21.7 23 0.002 14.8 3.4 45 78-125 91-135 (194) 14 PF03450 CO_deh_flav_C: CO deh 21.7 9.3 0.00078 17.1 0.4 43 31-73 36-91 (103) 15 PF11382 DUF3186: Protein of u 21.2 24 0.002 14.8 6.1 100 6-122 14-114 (308) No 1 >PF00496 SBP_bac_5: Bacterial extracellular solute-binding proteins, family 5 Middle; InterPro: IPR000914 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. The latter are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into Gram-positive bacteria which are surrounded by a single membrane and therefore have no periplasmic region the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homolog proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute throught the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. On the basis of sequence similarities, the vast majority of these solute-binding proteins can be grouped into eight families of clusters, which generally correlate with the nature of the solute bound. Family 5 currently includes periplasmic oligopeptide-binding proteins (oppA) of Gram-negative bacteria and homologous lipoproteins in Gram-positive bacteria (oppA, amiA or appA); periplasmic dipeptide-binding proteins of Escherichia coli (dppA) and Bacillus subtilis (dppE); periplasmic murein peptide-binding protein of E. coli (mppA); periplasmic peptide-binding proteins sapA of E. coli, Salmonella typhimurium and Haemophilus influenzae; periplasmic nickel-binding protein (nikA) of E. coli; heme-binding lipoprotein (hbpA or dppA) from H. influenzae; lipoprotein xP55 from Streptomyces lividans; and hypothetical proteins from H. influenzae (HI0213) and Rhizobium strain NGR234 symbiotic plasmid (y4tO and y4wM).; GO: 0005215 transporter activity, 0006810 transport; PDB: 1b5i_A 1rkm_A 1b3l_A 1b51_A 1b40_A 1qkb_A 1jet_A 1b0h_A 1b2h_A 1b7h_A .... Probab=82.88 E-value=1.2 Score=22.19 Aligned_cols=99 Identities=17% Similarity=0.229 Sum_probs=73.6 Q ss_pred CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHHC-------------------C--------------------- Q ss_conf 023551578741233788826789999998517123302-------------------6--------------------- Q T0606 47 AQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSIR-------------------T--------------------- 86 (169) Q Consensus 47 a~LeG~Yll~iNp~ld~~~~~~~R~~Lka~a~g~t~~~~-------------------~--------------------- 86 (169) .+-.+.+.+++|...-++.|.++|.-|.-+. ++++..+ . T Consensus 198 ~~~~~~~~l~~N~~~~~~~d~~~R~Al~~ai-dr~~i~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~d~~kA~~lL~~ 276 (372) T PF00496_consen 198 SPSPGYIYLSFNLNNPPFNDKAVRQALAYAI-DRDAIIKNILGGYGTPANSPVPPSSPGYDDYSKPYYQDPEKAKQLLEK 276 (372) T ss_dssp EEEEEEEEEEE-TTSTTTTSHHHHHHHHHHS--HHHHHHHCTTTSEEEESSSSSTTSTTGGCTTCHHHHHHHHHHHHHHH T ss_pred CCCCCEEEECCCCCCCCCCCHHHHHHHHHHC-CHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH T ss_conf 5774069960244557554745896462544-999999999732664445633456666677664334570058999997 Q ss_pred C----C--------CCEEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEECCCCC-HHHHHHHHCCCEEEEECC Q ss_conf 6----6--------4036888612672377889999999974488414301122-244443203512478613 Q T0606 87 D----T--------ELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQYSG-TMLRSRAVSGKYEAFLSE 146 (169) Q Consensus 87 ~----~--------~~~~~l~vsetdy~L~~YA~~Lc~RL~~AG~~V~lk~yS~-tMlrSravsGkYd~fla~ 146 (169) . . .+...+.+...+.....-|..+++.++++|..|+++..+. .-+..+...|+||+.+.. T Consensus 277 ag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~Gi~v~~~~~~~~~~~~~~~~~~~~d~~~~~ 349 (372) T PF00496_consen 277 AGYKKENGGGWREDKLPLILIYTSDSPPRDAIAEALAEQLKKIGIEVEVNPVDFNDDYDKRLSSGDFDLTLFG 349 (372) T ss_dssp ---BCSSEEECEBEB-EEEEEEEETSHHHHHHHHHHHHHHHH---EEEEEEE-HHHHHHHHHHTTS-SEEEEE T ss_pred CCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCEEEEEEEECHHHHHHHHHHCCCCCEEEEE T ss_conf 4887787532123332036862255620268999999986306228999985859999978766996889983 No 2 >PF10029 DUF2271: Predicted periplasmic protein (DUF2271) Probab=78.92 E-value=0.3 Score=25.55 Aligned_cols=38 Identities=24% Similarity=0.372 Sum_probs=27.5 Q ss_pred CHHHHHHHCCCCCHHHH--------HHHHHCCCCCCEEEEECCCCC Q ss_conf 62355321046700233--------432100235515787412337 Q T0606 25 PPSIIDAVTGATPKAKK--------AAQSSAQLEGSYIFCMNPLLD 62 (169) Q Consensus 25 pps~iDaltgAt~kAkk--------Aaq~~a~LeG~Yll~iNp~ld 62 (169) -...+|+|||||+++-+ ..++..-..|.|-++|--.-+ T Consensus 62 ~~~~vDgvTgAT~~~G~~~~~~~~~~~~~~~l~~g~Y~l~vEaarE 107 (139) T PF10029_consen 62 DRAPVDGVTGATRPPGKHQLSWDGTDDIGDPLIDGGYTLRVEAARE 107 (139) T ss_pred CCCCCCEECCCCCCCCCCEEEEECCCCCCCCCCCCCEEEEEEEEEE T ss_conf 5664331013777998216887654565673678747999999998 No 3 >PF09911 DUF2140: Uncharacterized protein conserved in bacteria (DUF2140) Probab=58.13 E-value=5.6 Score=18.35 Aligned_cols=71 Identities=25% Similarity=0.391 Sum_probs=44.9 Q ss_pred HHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHH Q ss_conf 88899999999875465427623553210467002334321002355157874123378882678999999851712330 Q T0606 5 LILLVVVIALIAGFGALLHSPPSIIDAVTGATPKAKKAAQSSAQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSI 84 (169) Q Consensus 5 ~i~lvvti~~lagfG~~~hSpps~iDaltgAt~kAkkAaq~~a~LeG~Yll~iNp~ld~~~~~~~R~~Lka~a~g~t~~~ 84 (169) |+++++.+++++.+++.+..|.+ . .....+.+-+|.+.|-|+. .|++|-+++-.--.-. T Consensus 8 ~~Llal~l~~~~~v~~~~~~p~~---~---------~~~~~~~~~~~~~~~~i~~---------~k~qlN~li~~YL~~~ 66 (187) T PF09911_consen 8 LILLALNLAFIAVVFFRLFQPSE---P---------EPSPSSKESSGDASFTITT---------NKKQLNALIAYYLKDY 66 (187) T ss_pred HHHHHHHHHHHHHEEEEEECCCC---C---------CCCCCCCCCCCCEEEEEEE---------CHHHHHHHHHHHHHHH T ss_conf 99999999999621357864468---7---------6565544578871899992---------7999999999999872 Q ss_pred CCCCCCEEEEEE Q ss_conf 266640368886 Q T0606 85 RTDTELSFDIYV 96 (169) Q Consensus 85 ~~~~~~~~~l~v 96 (169) .-+..++++.++ T Consensus 67 ~k~~~~~y~~~l 78 (187) T PF09911_consen 67 QKDGKIKYKFYL 78 (187) T ss_pred CCCCCCCEEEEE T ss_conf 437886459997 No 4 >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases.; InterPro: IPR013094 This catalytic domain is found in a very wide range of enzymes . ; GO: 0016787 hydrolase activity, 0008152 metabolic process; PDB: 1jkm_B 2o7v_A 2o7r_A 2zsh_A 2zsi_A 3ed1_E 3ebl_F 1vkh_A 3d7r_B 3dnm_D .... Probab=53.03 E-value=6.8 Score=17.87 Aligned_cols=42 Identities=26% Similarity=0.353 Sum_probs=34.6 Q ss_pred CCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEECCCCCH Q ss_conf 6640368886126723778899999999744884143011222 Q T0606 87 DTELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQYSGT 129 (169) Q Consensus 87 ~~~~~~~l~vsetdy~L~~YA~~Lc~RL~~AG~~V~lk~yS~t 129 (169) .+.+..-+.+++.| ++..-+.++.++|+.+|.+|++..|.+. T Consensus 164 ~~~pp~~i~~g~~D-~l~~~~~~~~~~l~~~g~~v~~~~~~g~ 205 (211) T PF07859_consen 164 AGLPPTLIVHGEDD-PLVDDSRRFAEALREAGVPVELHVYPGM 205 (211) T ss_dssp TTHHHEEEEEECCS-TTHHHHHHHHHHHHHTT-EEEEEEECTE T ss_pred CCCCCEEEEECCCC-CCHHHHHHHHHHHHHCCCCEEEEEECCC T ss_conf 69998179705898-7499999999999978998899997997 No 5 >PF06711 DUF1198: Protein of unknown function (DUF1198); InterPro: IPR009587 This family consists of several bacterial proteins of around 150 residues in length which are specific to Escherichia coli, Salmonella species and Yersinia pestis. The function of this family is unknown. Probab=52.50 E-value=2.3 Score=20.55 Aligned_cols=69 Identities=16% Similarity=0.359 Sum_probs=47.3 Q ss_pred HHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHH Q ss_conf 88899999999875465427623553210467002334321002355157874123378882678999999851712330 Q T0606 5 LILLVVVIALIAGFGALLHSPPSIIDAVTGATPKAKKAAQSSAQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSI 84 (169) Q Consensus 5 ~i~lvvti~~lagfG~~~hSpps~iDaltgAt~kAkkAaq~~a~LeG~Yll~iNp~ld~~~~~~~R~~Lka~a~g~t~~~ 84 (169) .|++++..+||+||-++ |..++||-+.-+++=|--..-|.-|+|-.|......=+.-+--|..+-+ T Consensus 4 iilAtL~VVFIvGfRVL--------------TSdtRrAi~rLs~rL~I~pv~iESMi~qmGk~~g~~Firyl~~~~e~hl 69 (148) T PF06711_consen 4 IILATLIVVFIVGFRVL--------------TSDTRRAIDRLSERLKIKPVPIESMIDQMGKRQGQEFIRYLSRGDEEHL 69 (148) T ss_pred HHHHHHHHHHHEEEEEE--------------CCCHHHHHHHHHHHHCCCEEEHHHHHHHHCCHHHHHHHHHHCCCCHHHH T ss_conf 47878899863023443--------------3644899999998619802559999999740407899999708988999 Q ss_pred CCC Q ss_conf 266 Q T0606 85 RTD 87 (169) Q Consensus 85 ~~~ 87 (169) +.. T Consensus 70 ~na 72 (148) T PF06711_consen 70 QNA 72 (148) T ss_pred HHH T ss_conf 734 No 6 >PF07095 IgaA: Intracellular growth attenuator protein IgaA; InterPro: IPR010771 This family consists of several bacterial intracellular growth attenuator (IgaA) proteins. IgaA is involved in negative control of bacterial proliferation within fibroblasts. IgaA is homologous to the Escherichia coli YrfF and Proteus mirabilis UmoB proteins. Whereas the biological function of YrfF is currently unknown, UmoB has been shown elsewhere to act as a positive regulator of FlhDC, the master regulator of flagella and swarming. FlhDC has been shown to repress cell division during P. mirabilis swarming, suggesting that UmoB could repress cell division via FlhDC. This biological function, if maintained in Salmonella enterica, could sustain a putative negative control of cell division and growth exerted by IgaA in intracellular bacteria .; GO: 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane Probab=39.91 E-value=4.6 Score=18.83 Aligned_cols=105 Identities=27% Similarity=0.279 Sum_probs=59.7 Q ss_pred CCEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHHC---CCCCCEEEEE--------EECCCCH-------HHHHHHHHHH Q ss_conf 51578741233788826789999998517123302---6664036888--------6126723-------7788999999 Q T0606 51 GSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSIR---TDTELSFDIY--------VSETDYA-------LIRYADSLCE 112 (169) Q Consensus 51 G~Yll~iNp~ld~~~~~~~R~~Lka~a~g~t~~~~---~~~~~~~~l~--------vsetdy~-------L~~YA~~Lc~ 112 (169) |-|-=-.||+-.|-| |+-++--++..-....+| +|.-++-+|. +-=+|.+ -.|.++.=|. T Consensus 427 ~IyWN~a~plp~PeS--d~iekA~aL~~tv~~QLhp~~~d~~vnp~L~~aI~KSGMiLLddF~dIVLKT~~LC~~e~~C~ 504 (705) T PF07095_consen 427 GIYWNNANPLPLPES--DTIEKAAALLQTVNRQLHPQDDDSRVNPQLASAIQKSGMILLDDFSDIVLKTQDLCSAENDCI 504 (705) T ss_pred EEEECCCCCCCCCHH--HHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCHHHH T ss_conf 021179989999637--788899999999975327677777639778999985573324307889986987722613889 Q ss_pred HHHHCCCCEEECCCCCHHHHHHHHCCCEEEEECCCCEEEHHHHHHH Q ss_conf 9974488414301122244443203512478613301202113000 Q T0606 113 RLNDAGADVQIKQYSGTMLRSRAVSGKYEAFLSESDLVSTDALENA 158 (169) Q Consensus 113 RL~~AG~~V~lk~yS~tMlrSravsGkYd~fla~~~~i~~t~l~~~ 158 (169) |||-|=.|.. ..-.=.-|+.||-+||-|---+--+-+++.+||++ T Consensus 505 RLKnALvNLg-n~kdW~tLvkrA~sGkL~G~nVLLRpvSAeaLe~L 549 (705) T PF07095_consen 505 RLKNALVNLG-NAKDWPTLVKRAQSGKLDGVNVLLRPVSAEALENL 549 (705) T ss_pred HHHHHHHCCC-CCCCHHHHHHHHHCCCCCCCEEEECCCCHHHHHHH T ss_conf 9999985468-85646999988653887783687242049999999 No 7 >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This family represents the Herpesviridae origin of replication binding protein, probably involved in DNA replication.; GO: 0003688 DNA replication origin binding, 0005524 ATP binding, 0006260 DNA replication Probab=34.63 E-value=13 Score=16.21 Aligned_cols=61 Identities=20% Similarity=0.290 Sum_probs=40.8 Q ss_pred HHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHC----CCEEEEECCCCEEEHHHHHHHHHHECCHH Q ss_conf 77889999999974488414301122244443203----51247861330120211300001010111 Q T0606 103 LIRYADSLCERLNDAGADVQIKQYSGTMLRSRAVS----GKYEAFLSESDLVSTDALENADYIILDSA 166 (169) Q Consensus 103 L~~YA~~Lc~RL~~AG~~V~lk~yS~tMlrSravs----GkYd~fla~~~~i~~t~l~~~D~lil~s~ 166 (169) ..++++.||+|++.+|.+ .-.+|++. .+..+. +++-+-+-|=.-++-+.+.+-|.+|+|-- T Consensus 87 RrSL~~~La~Rf~~a~l~-gF~~y~d~--~~~~i~~~~~~rL~vqIeSLhR~~~~~l~~yDvLILDEV 151 (824) T PF02399_consen 87 RRSLTKTLAERFKTAGLS-GFVTYLDI--TDYIIDGRPYHRLIVQIESLHRLDSSLLDNYDVLILDEV 151 (824) T ss_pred HHHHHHHHHHHHHHCCCC-CCEEEEEC--CCCEECCCCCCEEEEEEHHHHCCCHHHHCCCCEEEEEHH T ss_conf 999999999988655887-60677603--442105662243899724322257102034588997079 No 8 >PF05442 Microvirus_A: Microvirus A protein; InterPro: IPR008684 Microviral A protein is a specific endonuclease that cleaves the viral strand of supertwisted, closed circular DNA at a unique site in the A gene. The A protein also causes relaxation of supertwisted DNA and forms a complex with viral DNA that has a discontinuity in gene A of the viral strand . The C-terminal region of the sequence contains the cleavage site for A/A* protein .; GO: 0003677 DNA binding, 0004519 endonuclease activity, 0008270 zinc ion binding Probab=32.91 E-value=10 Score=16.87 Aligned_cols=91 Identities=19% Similarity=0.239 Sum_probs=54.1 Q ss_pred EEECCCCCCCCHHHHHHHHH-HHHCCCHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHH Q ss_conf 87412337888267899999-98517123302666403688861267237788999999997448841430112224444 Q T0606 55 FCMNPLLDKLSDEDIREQLK-AFVTGKTDSIRTDTELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQYSGTMLRS 133 (169) Q Consensus 55 l~iNp~ld~~~~~~~R~~Lk-a~a~g~t~~~~~~~~~~~~l~vsetdy~L~~YA~~Lc~RL~~AG~~V~lk~yS~tMlrS 133 (169) +.-.|+|----.-|.|-+|- +.+.-.+..++-+.. -+.|+- |--..|+..+-|-.|-|-+-+.|||.+..-+. T Consensus 18 laqsP~Lr~~kQ~dnRikLLeeil~~~~~gl~~d~n--gd~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 91 (187) T PF05442_consen 18 LAQSPHLRMAKQVDNRIKLLEEILYQLEKGLSEDDN--GDFWMN----PNSQLATTIAYRAHQKGHNPKFKQYPESFTLD 91 (187) T ss_pred HCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC--CCEEEC----CCHHHHHHHHHHHHHCCCCCCHHHCCCCCCHH T ss_conf 506850689998621999999999999805762568--875456----72278999999988526895132097623275 Q ss_pred HHHCCCEEEEECCCCEEE Q ss_conf 320351247861330120 Q T0606 134 RAVSGKYEAFLSESDLVS 151 (169) Q Consensus 134 ravsGkYd~fla~~~~i~ 151 (169) ..+|||-----+|+.+-. T Consensus 92 ~~~~gkpip~~apdE~~L 109 (187) T PF05442_consen 92 DIISGKPIPQNAPDELRL 109 (187) T ss_pred HHHCCCCCCCCCHHHHCC T ss_conf 665289789888045314 No 9 >PF11602 NTPase_P4: ATPase P4 of dsRNA bacteriophage phi-12; PDB: 1w4c_F 1w44_B 1w46_C 2vhu_B 2vhj_C 1w47_A 1w48_B 1w4a_C 2vhq_B 2vhc_C .... Probab=30.51 E-value=12 Score=16.49 Aligned_cols=70 Identities=20% Similarity=0.193 Sum_probs=46.6 Q ss_pred HHHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHH----------HHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHH Q ss_conf 99999999875465427623553210467002334----------32100235515787412337888267899999985 Q T0606 8 LVVVIALIAGFGALLHSPPSIIDAVTGATPKAKKA----------AQSSAQLEGSYIFCMNPLLDKLSDEDIREQLKAFV 77 (169) Q Consensus 8 lvvti~~lagfG~~~hSpps~iDaltgAt~kAkkA----------aq~~a~LeG~Yll~iNp~ld~~~~~~~R~~Lka~a 77 (169) .++-++ +.+|-++..|--+.+-+++|+..+.--- -|..+|+.-+-++.+||++|----|-.-+.-++-+ T Consensus 164 val~LA-~~~~~VvvDS~R~v~~~l~Gna~~GGISr~~~~~LTdl~~~aa~~gc~vV~~vNP~s~DeKVelV~~~~~As~ 242 (320) T PF11602_consen 164 VALHLA-ALDFRVVVDSLRNVLFRLGGNATSGGISRGAYSLLTDLGNIAASRGCSVVAVVNPMSDDEKVELVFEASMASV 242 (320) T ss_dssp -----H-HHH-SEEEE-GTTT-----------------HHHHHH---HHHH---EEEEE---SS-STTHHHHHHHHHHS- T ss_pred CHHHHH-HCCCEEEEEHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHCC T ss_conf 012343-2264278311588886512677878604789999988999998739689997489886067899998654031 Q ss_pred C Q ss_conf 1 Q T0606 78 T 78 (169) Q Consensus 78 ~ 78 (169) + T Consensus 243 ~ 243 (320) T PF11602_consen 243 T 243 (320) T ss_dssp S T ss_pred E T ss_conf 1 No 10 >PF01520 Amidase_3: N-acetylmuramoyl-L-alanine amidase; InterPro: IPR002508 The cell wall envelope of Gram-positive bacteria is a macromolecular, exoskeletal organelle that is assembled and turned over at designated sites. The cell wall also functions as a surface organelle that allows Gram-positive pathogens to interact with their environment, in particular the tissues of the infected host. All of these functions require that surface proteins and enzymes be properly targeted to the cell wall envelope. Two basic mechanisms, cell wall sorting and targeting, have been identified. Cell well sorting is the covalent attachment of surface proteins to the peptidoglycan via a C-terminal sorting signal that contains a consensus LPXTG sequence. More than 100 proteins that possess cell wall-sorting signals, including the M proteins of Streptococcus pyogenes, protein A of Staphylococcus aureus, and several internalins of Listeria monocytogenes, have been identified. Cell wall targeting involves the noncovalent attachment of proteins to the cell surface via specialised binding domains. Several of these wall-binding domains appear to interact with secondary wall polymers that are associated with the peptidoglycan, for example teichoic acids and polysaccharides. Proteins that are targeted to the cell surface include muralytic enzymes such as autolysins, lysostaphin, and phage lytic enzymes. Other examples for targeted proteins are the surface S-layer proteins of bacilli and clostridia, as well as virulence factors required for the pathogenesis of L. monocytogenes (internalin B) and Streptococcus pneumoniae (PspA) infections . Autolysin 3.5.1.28 from EC hydrolyses the link between N-acetylmuramoyl residues and L-amino acid residues in certain bacterial cell wall glycopeptides.; GO: 0008745 N-acetylmuramoyl-L-alanine amidase activity, 0009253 peptidoglycan catabolic process; PDB: 1jwq_A 3czx_C 1xov_A. Probab=28.64 E-value=17 Score=15.60 Aligned_cols=36 Identities=17% Similarity=0.277 Sum_probs=19.7 Q ss_pred EEEEE---ECCCCHHHHHHHHHHHHHHHCCC--CEEECCCC Q ss_conf 68886---12672377889999999974488--41430112 Q T0606 92 FDIYV---SETDYALIRYADSLCERLNDAGA--DVQIKQYS 127 (169) Q Consensus 92 ~~l~v---setdy~L~~YA~~Lc~RL~~AG~--~V~lk~yS 127 (169) +..|| +.....=..+|+++++.|...+. +-.+++.+ T Consensus 87 ~ev~~~~~~~~~~~s~~lA~~i~~~l~~~~~~~~rg~~~~~ 127 (175) T PF01520_consen 87 TEVYYSYNNSNSPKSKRLAERIQKELVKKGGLPNRGVKPRN 127 (175) T ss_dssp -EEEE---CGGCHHHHHHHHHHHHHHHHH--------EECT T ss_pred EEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEECC T ss_conf 18998503235088999999999999987087778830230 No 11 >PF12262 Lipase_bact_N: Bacterial virulence factor lipase N-terminal Probab=27.42 E-value=10 Score=16.82 Aligned_cols=20 Identities=45% Similarity=0.793 Sum_probs=16.4 Q ss_pred CCHHHHHHHHHHHH-HHHHHH Q ss_conf 93178889999999-987546 Q T0606 1 MKRRLILLVVVIAL-IAGFGA 20 (169) Q Consensus 1 mK~k~i~lvvti~~-lagfG~ 20 (169) ||++|+.+++.-.+ |+|-|- T Consensus 1 Mkk~~l~~~iasal~LaGCg~ 21 (268) T PF12262_consen 1 MKKKLLSLAIASALGLAGCGG 21 (268) T ss_pred CCHHHHHHHHHHHHHCCCCCC T ss_conf 943589999999975111479 No 12 >PF12094 DUF3570: Protein of unknown function (DUF3570) Probab=22.04 E-value=11 Score=16.63 Aligned_cols=75 Identities=32% Similarity=0.380 Sum_probs=37.7 Q ss_pred HHHHHCCCCCHHHHH---HHHHCCCCCCEEEEECCCCCCCCHH--HHHHHHHHHHCCCHHHHCCCCCCEEEEEEE-CCCC Q ss_conf 553210467002334---3210023551578741233788826--789999998517123302666403688861-2672 Q T0606 28 IIDAVTGATPKAKKA---AQSSAQLEGSYIFCMNPLLDKLSDE--DIREQLKAFVTGKTDSIRTDTELSFDIYVS-ETDY 101 (169) Q Consensus 28 ~iDaltgAt~kAkkA---aq~~a~LeG~Yll~iNp~ld~~~~~--~~R~~Lka~a~g~t~~~~~~~~~~~~l~vs-etdy 101 (169) .+|.+|||+|..--. +|.-..-.|..-.-++---.|+++. |+|.++-+- -+-.++....+++..++| |.|| T Consensus 69 ~~D~~TgAS~~~~~~~~~~~tft~~sg~~~y~~~sG~s~~~~tf~DtR~~~~~~---~~~~~~~~~~~s~g~~~S~E~DY 145 (420) T PF12094_consen 69 GVDSVTGASPDGADPQDQAQTFTRPSGNGPYSASSGASPLDDTFKDTRYELSAN---WTYPLSRDTTLSLGVSYSKEYDY 145 (420) T ss_pred EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCC---EEEECCCCCEEEEEEEECCCCCH T ss_conf 886411457565666544432236677876110367665444300111102332---46870678378740120222321 Q ss_pred HHHH Q ss_conf 3778 Q T0606 102 ALIR 105 (169) Q Consensus 102 ~L~~ 105 (169) -=.. T Consensus 146 ~S~g 149 (420) T PF12094_consen 146 QSLG 149 (420) T ss_pred HHCC T ss_conf 1103 No 13 >PF05908 DUF867: Protein of unknown function (DUF867); InterPro: IPR008585 This family consists of a number of bacterial and phage proteins with no known function and which are found in Bacillus species and the Lambda-like viruses. Probab=21.75 E-value=23 Score=14.85 Aligned_cols=45 Identities=24% Similarity=0.301 Sum_probs=35.0 Q ss_pred CCCHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEECC Q ss_conf 171233026664036888612672377889999999974488414301 Q T0606 78 TGKTDSIRTDTELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQ 125 (169) Q Consensus 78 ~g~t~~~~~~~~~~~~l~vsetdy~L~~YA~~Lc~RL~~AG~~V~lk~ 125 (169) ....-.+|+-....-.++|--+|..| ++.+++.|..+||.|.++. T Consensus 91 ~~~avsiHG~~~~~~~v~vGG~d~~l---~~~I~~~L~~~Gf~v~~~~ 135 (194) T PF05908_consen 91 SDYAVSIHGYKGDDETVLVGGRDREL---AEAIADALEDAGFTVELAS 135 (194) T ss_pred CCEEEEEECCCCCCCEEEECCCCHHH---HHHHHHHHHHCCCEEEECC T ss_conf 68799975535898879977888999---9999999986697799677 No 14 >PF03450 CO_deh_flav_C: CO dehydrogenase flavoprotein C-terminal domain; InterPro: IPR005107 Proteins containing this domain form structural complexes with other known families, such as IPR008274 from INTERPRO and IPR001041 from INTERPRO.; PDB: 1jrp_E 2w3s_E 2w55_A 1jro_C 2w54_E 2w3r_G 3eub_K 3bdj_B 1n5x_B 1vdv_B .... Probab=21.73 E-value=9.3 Score=17.10 Aligned_cols=43 Identities=23% Similarity=0.378 Sum_probs=26.3 Q ss_pred HHCCCCCHHHHHHHHHCCCCCCEE-------------EEECCCCCCCCHHHHHHHH Q ss_conf 210467002334321002355157-------------8741233788826789999 Q T0606 31 AVTGATPKAKKAAQSSAQLEGSYI-------------FCMNPLLDKLSDEDIREQL 73 (169) Q Consensus 31 altgAt~kAkkAaq~~a~LeG~Yl-------------l~iNp~ld~~~~~~~R~~L 73 (169) ++.|..|...|+.+.++-|.|.-+ =.++|..|.++..+.|.++ T Consensus 36 a~G~v~~~p~r~~~~E~~L~G~~~~~~~~~~a~~~~~~~~~p~~d~r~s~~YR~~l 91 (103) T PF03450_consen 36 AFGGVAPTPIRAEEAEEALIGKPLSEELIEAAAEALAEEISPISDIRGSAEYRRHL 91 (103) T ss_dssp EECSSSSSCEE-HHHHHTTTTSBSSHHHHHHHHHHHHCTTHHCTTTTCTHHHHHHH T ss_pred EEECCCCCEEEHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH T ss_conf 87668897176599887752899999999999999985389888999789999999 No 15 >PF11382 DUF3186: Protein of unknown function (DUF3186) Probab=21.23 E-value=24 Score=14.78 Aligned_cols=100 Identities=16% Similarity=0.261 Sum_probs=50.8 Q ss_pred HHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHH-HHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHH Q ss_conf 889999999987546542762355321046700233432-1002355157874123378882678999999851712330 Q T0606 6 ILLVVVIALIAGFGALLHSPPSIIDAVTGATPKAKKAAQ-SSAQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSI 84 (169) Q Consensus 6 i~lvvti~~lagfG~~~hSpps~iDaltgAt~kAkkAaq-~~a~LeG~Yll~iNp~ld~~~~~~~R~~Lka~a~g~t~~~ 84 (169) |-+++.+|.+.|||+ --|.|++.+++-...-|+-.+ ..++.+-. +. ..+.+ ..|+..--..+ T Consensus 14 VFlALAvGIvlG~~~---l~~~l~~~L~~~~~~Lr~e~~~l~~~~~~l---------~~--~~~~~---d~~~~~~a~~l 76 (308) T PF11382_consen 14 VFLALAVGIVLGAGP---LQPNLLSGLEDQVDSLREENDQLRAERNAL---------QA--QNDAA---DQFIAAVAPRL 76 (308) T ss_pred HHHHHHHHHHHCCHH---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HH--HHHHH---HHHHHHHHHHH T ss_conf 999999999822401---235566666766789999999999999999---------99--99999---99999988998 Q ss_pred CCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE Q ss_conf 26664036888612672377889999999974488414 Q T0606 85 RTDTELSFDIYVSETDYALIRYADSLCERLNDAGADVQ 122 (169) Q Consensus 85 ~~~~~~~~~l~vsetdy~L~~YA~~Lc~RL~~AG~~V~ 122 (169) -..++-..+..+-.+..+--.+.+.+-+.|++||+.|. T Consensus 77 v~g~L~g~~V~lv~~p~a~~~~~~~v~~~l~~AGa~V~ 114 (308) T PF11382_consen 77 VAGSLTGRKVALVTTPDADDDDVDAVRELLEQAGATVA 114 (308) T ss_pred HHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEE T ss_conf 73633797699998189983689999999998799257 Done!