Query T0618 3NRH, Bacteroides fragilis, 182 residues Match_columns 182 No_of_seqs 52 out of 54 Neff 4.7 Searched_HMMs 11830 Date Thu Jul 22 15:02:27 2010 Command /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/seq/T0618.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/T0618.hhr No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF01756 ACOX: Acyl-CoA oxidas 63.8 3.6 0.0003 18.0 9.2 120 4-127 36-161 (186) 2 PF03249 TSA: Type specific an 61.0 4 0.00034 17.7 6.8 79 69-160 225-321 (525) 3 PF03500 Cellsynth_D: Cellulos 38.3 9.3 0.00078 15.6 2.7 61 16-97 4-65 (144) 4 PF06248 Zw10: Centromere/kine 35.4 10 0.00089 15.3 7.1 90 5-99 90-182 (595) 5 PF06871 TraH_2: TraH_2; Inte 32.6 11 0.0009 15.2 2.3 80 67-151 47-142 (206) 6 PF02616 ScpA_ScpB: ScpA/B pro 25.1 16 0.0013 14.2 6.9 48 13-63 11-62 (242) 7 PF10784 Plasmid_stab_B: Plasm 17.5 23 0.0019 13.3 3.2 32 19-50 14-45 (72) 8 PF11568 Med29: Mediator compl 17.3 23 0.002 13.2 3.1 49 5-55 50-98 (148) 9 PF00351 Biopterin_H: Biopteri 14.1 28 0.0024 12.8 3.6 25 74-98 67-93 (332) 10 PF07108 PipA: PipA protein; 14.0 28 0.0024 12.7 2.1 37 63-99 70-106 (228) No 1 >PF01756 ACOX: Acyl-CoA oxidase; InterPro: IPR002655 This is a group of Acyl-CoA oxidases (1.3.3.6 from EC). Acyl-coA oxidase converts acyl-CoA into trans-2-enoyl-CoA .; GO: 0003997 acyl-CoA oxidase activity, 0006635 fatty acid beta-oxidation, 0005777 peroxisome; PDB: 1w07_A 2fon_C 1is2_A 2ddh_A. Probab=63.75 E-value=3.6 Score=18.05 Aligned_cols=120 Identities=16% Similarity=0.259 Sum_probs=84.0 Q ss_pred CCCCCCCHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHH Q ss_conf 5332124308999999999999998------7863106889999999999999888860464568876654447857899 Q T0618 4 ESQVIFDKNVIEFVTVAAEFCAFLE------RAESMKRSTFVDTTLKILPLLYLKASMLPKCEMIGDESPETYVTEEIYE 77 (182) Q Consensus 4 ~s~~~~~~~~~eFv~vA~efC~~vE------~~~~~~r~d~v~~a~~~Lp~Ly~~~s~LP~~e~~~d~~~e~~v~ee~y~ 77 (182) +....++....+.+.+|+-+|.++. ++. ......+..++..|..||+-..+... .++.-..-.++.++-. T Consensus 36 ~~~~awn~~~~~l~~~a~ah~~~~~l~~F~~~i~-~~~~~~~~~vL~~L~~LyaL~~i~~~---~g~fl~~g~ls~~q~~ 111 (186) T PF01756_consen 36 SPFEAWNDSSVELVRAAKAHCEYFVLESFLEAIE-SCSDPEIKEVLQKLCDLYALSIIEED---SGDFLEHGYLSPEQAK 111 (186) T ss_dssp SSHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTT-G-SSHHHHHHHHHHHHHHHHHHHHHT------TGGGTSS-CHHHH T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCCCHHHHHHHHHHHHHHHHHHHHHH---HHHHHHCCCCCHHHHH T ss_conf 9899999999999999999999999999999987-05986899999999999939999986---5999872889999999 Q ss_pred HHHHHHHHHCCCCCHHHHHHCHHHCCCCCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 99999987514410244541400036775420246664899999999899 Q T0618 78 VLRINLASILAEKDDYLEVFLPDMAYSDEPIKKNISEDLADIYQDIKDFI 127 (182) Q Consensus 78 ~lr~~la~lL~~~d~Y~evf~p~~~~sd~~~~~~iSdDLaDIy~dL~~gL 127 (182) .++..+..+++..-.....+..-...+|......|.--=.+||..|-+.. T Consensus 112 ~i~~~i~~L~~~lrp~Av~LVDAF~~~D~~L~S~LG~~DG~vYe~l~~~a 161 (186) T PF01756_consen 112 AIRSAINELCAELRPNAVALVDAFDFPDFFLNSALGRYDGDVYENLYEWA 161 (186) T ss_dssp HHHHHHHHHHHHHGGGHHHHHHTT---TTTHT---------HHHHHHHHH T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCHHHHHHHHHH T ss_conf 99999999999986789988772389989983702464756999999999 No 2 >PF03249 TSA: Type specific antigen; InterPro: IPR004933 There are several antigenic variants in Rickettsia tsutsugamushi, and a type-specific antigen (TSA) of 56-kilodaltons located on the rickettsial surface is responsible for the variation , . TSA proteins are probably integral membrane proteins. ; GO: 0016021 integral to membrane Probab=61.00 E-value=4 Score=17.75 Aligned_cols=79 Identities=24% Similarity=0.391 Sum_probs=58.0 Q ss_pred CCCCHHHHHHHHHHHHHHCCCCCHHHHHHCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH------------------ Q ss_conf 44785789999999987514410244541400036775420246664899999999899998------------------ Q T0618 69 TYVTEEIYEVLRINLASILAEKDDYLEVFLPDMAYSDEPIKKNISEDLADIYQDIKDFIFVF------------------ 130 (182) Q Consensus 69 ~~v~ee~y~~lr~~la~lL~~~d~Y~evf~p~~~~sd~~~~~~iSdDLaDIy~dL~~gL~~~------------------ 130 (182) ...++++|+.+-.+++.| +.. ..+|..|+. -|||-.+-||.|++-|-..- T Consensus 225 ~IldH~qWR~~Vvgital-------sna----nkps~s~vK-vLSdKI~qIY~DikpFA~iagi~vp~~~LpnSAsveQI 292 (525) T PF03249_consen 225 NILDHDQWRHLVVGITAL-------SNA----NKPSVSPVK-VLSDKITQIYSDIKPFADIAGIEVPDTPLPNSASVEQI 292 (525) T ss_pred CCCCHHHHHHHHHHHHHH-------HCC----CCCCCCCCH-HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHH T ss_conf 523668887888879987-------517----899888410-25667899987404555640776899889983129999 Q ss_pred HCCCCCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 501333368999999997887489999999 Q T0618 131 QLGLNETMNDSLAICQENFGLLWGQKLVNT 160 (182) Q Consensus 131 ~~g~~~~~~eALw~w~~sf~~~WG~hl~~a 160 (182) +.-.- ..|+.|-..++||.-+-|..-.|- T Consensus 293 Q~Kmq-ELnd~LeelResfdG~i~NAFanq 321 (525) T PF03249_consen 293 QNKMQ-ELNDVLEELRESFDGYIGNAFANQ 321 (525) T ss_pred HHHHH-HHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999-999999999986544677877655 No 3 >PF03500 Cellsynth_D: Cellulose synthase subunit D; InterPro: IPR003922 An operon encoding 4 proteins required for bacterial cellulose biosynthesis (bcs) in Acetobacter xylinum has been isolated via genetic complementation with strains lacking cellulose synthase activity . Nucleotide sequence analysis showed the cellulose synthase operon to consist of 4 genes, designated bcsA, bcsB, bcsC and bcsD, all of which are required for maximal bacterial cellulose synthesis in A. xylinum. The calculated molecular mass of the protein encoded by bcsD is 17.3kDa . The function of BcsD is unknown.; GO: 0006011 UDP-glucose metabolic process, 0016020 membrane; PDB: 2z9e_E 2z9f_C. Probab=38.25 E-value=9.3 Score=15.61 Aligned_cols=61 Identities=21% Similarity=0.226 Sum_probs=38.4 Q ss_pred HH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHH Q ss_conf 99-99999999998786310688999999999999988886046456887665444785789999999987514410244 Q T0618 16 FV-TVAAEFCAFLERAESMKRSTFVDTTLKILPLLYLKASMLPKCEMIGDESPETYVTEEIYEVLRINLASILAEKDDYL 94 (182) Q Consensus 16 Fv-~vA~efC~~vE~~~~~~r~d~v~~a~~~Lp~Ly~~~s~LP~~e~~~d~~~e~~v~ee~y~~lr~~la~lL~~~d~Y~ 94 (182) |+ +++.|||+-+.. ..++.|++++-.-++ ..--||++++ +++ +..+|..+++.+++=. T Consensus 4 fl~aLa~E~~~q~g~---~~~~~lLrriG~r~A----~~~PLp~c~T---------v~e-----Le~~iN~vl~~~~WG~ 62 (144) T PF03500_consen 4 FLQALAWEIEDQAGI---DELRQLLRRIGRRFA----ARHPLPPCET---------VDE-----LEAAINAVLARFDWGF 62 (144) T ss_dssp HHHHHHHHHHHH------HHHHHHHHH------------B-----SS---------HHH-----HHHHHHHHHHH----- T ss_pred HHHHHHHHHHHHCCH---HHHHHHHHHHHHHHH----HHCCCCCCCC---------HHH-----HHHHHHHHHHHCCCCE T ss_conf 999999999972299---999999999999999----7479988876---------999-----9999999998788745 Q ss_pred HHH Q ss_conf 541 Q T0618 95 EVF 97 (182) Q Consensus 95 evf 97 (182) -.. T Consensus 63 V~l 65 (144) T PF03500_consen 63 VTL 65 (144) T ss_dssp EEE T ss_pred EEE T ss_conf 984 No 4 >PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zw10 and rough deal proteins are both required for correct metaphase check-pointing during mitosis ,. These proteins bind to the centromere/kinetochore .; GO: 0007067 mitosis, 0000775 chromosome, pericentric region, 0005634 nucleus Probab=35.43 E-value=10 Score=15.29 Aligned_cols=90 Identities=23% Similarity=0.188 Sum_probs=43.9 Q ss_pred CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCH---HHHHHHHH Q ss_conf 332124308999999999999998786310688999999999999988886046456887665444785---78999999 Q T0618 5 SQVIFDKNVIEFVTVAAEFCAFLERAESMKRSTFVDTTLKILPLLYLKASMLPKCEMIGDESPETYVTE---EIYEVLRI 81 (182) Q Consensus 5 s~~~~~~~~~eFv~vA~efC~~vE~~~~~~r~d~v~~a~~~Lp~Ly~~~s~LP~~e~~~d~~~e~~v~e---e~y~~lr~ 81 (182) +|.-+...+.++++-..++|..++.++....+.-...++..|-.+......+.... ++++.|=+ ..|..+|. T Consensus 90 ~EL~~~~~vl~~le~i~~i~~~L~~~~~al~~~~~~~Aa~~Le~~~~~L~~~~~~~-----~~~~~v~~~L~~e~~~lr~ 164 (595) T PF06248_consen 90 RELAFNEQVLEVLESIQKIDQLLDEVEEALKEGDYLEAADLLEELEKLLKGLKDEK-----FTELNVLKLLKEEYSVLRQ 164 (595) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCC-----CCCCHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999987614879999999999999986157666-----5534499999999999999 Q ss_pred HHHHHCCCCCHHHHHHCH Q ss_conf 998751441024454140 Q T0618 82 NLASILAEKDDYLEVFLP 99 (182) Q Consensus 82 ~la~lL~~~d~Y~evf~p 99 (182) +|...|+..=...-+|++ T Consensus 165 ~L~~~L~~~w~~lv~~~~ 182 (595) T PF06248_consen 165 NLQYQLRERWDRLVQVDK 182 (595) T ss_pred HHHHHHHHHHHHHEEECC T ss_conf 999999999986525667 No 5 >PF06871 TraH_2: TraH_2; InterPro: IPR010680 This family consists of several TraH proteins, which seem to be specific to Agrobacterium and Rhizobium species. This protein is thought to be involved in conjugal transfer but its function is unknown. This family does not appear to be related to IPR010927 from INTERPRO. Probab=32.63 E-value=11 Score=15.24 Aligned_cols=80 Identities=11% Similarity=0.179 Sum_probs=52.0 Q ss_pred CCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH---------HCCCC-- Q ss_conf 5444785789999999987514410244541400036775420246664899999999899998---------50133-- Q T0618 67 PETYVTEEIYEVLRINLASILAEKDDYLEVFLPDMAYSDEPIKKNISEDLADIYQDIKDFIFVF---------QLGLN-- 135 (182) Q Consensus 67 ~e~~v~ee~y~~lr~~la~lL~~~d~Y~evf~p~~~~sd~~~~~~iSdDLaDIy~dL~~gL~~~---------~~g~~-- 135 (182) |.+...+|.-..+|+.+..-.=. .=+.-|... =+..-.+.|.-||.|-+.-|+-|-++| |-|+- T Consensus 47 Pkp~tpdeAm~lir~yvG~avVR--VGiTQyPAG---vGv~da~qLk~DlvdaC~NlRmGTalFAKV~RIV~KWYGnPt~ 121 (206) T PF06871_consen 47 PKPKTPDEAMALIRQYVGQAVVR--VGITQYPAG---VGVVDASQLKPDLVDACENLRMGTALFAKVYRIVTKWYGNPTS 121 (206) T ss_pred CCCCCHHHHHHHHHHHCCCEEEE--EEEEECCCC---CCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC T ss_conf 59999799999999860845899--750343665---5645677758057778764314578999999975553279760 Q ss_pred -----CCHHHHHHHHHHHHHH Q ss_conf -----3368999999997887 Q T0618 136 -----ETMNDSLAICQENFGL 151 (182) Q Consensus 136 -----~~~~eALw~w~~sf~~ 151 (182) +.+.||++-|+.+|+. T Consensus 122 ~dvlPq~fdDai~AW~TG~FE 142 (206) T PF06871_consen 122 KDVLPQVFDDAIYAWKTGYFE 142 (206) T ss_pred HHHHHHHHHHHHHHHHCCEEC T ss_conf 134378888889876405043 No 6 >PF02616 ScpA_ScpB: ScpA/B protein; InterPro: IPR003768 This family represents ScpA, which along with ScpB (IPR005234 from INTERPRO) interacts with SMC in vivo forming a complex that is required for chromosome condensation and segregation , . The SMC-Scp complex appears to be similar to the MukB-MukE-Muk-F complex in Escherichia coli , where MukB (IPR007406 from INTERPRO) is the homologue of SMC. ScpA and ScpB have little sequence similarity to MukE (IPR007385 from INTERPRO) or MukF (IPR005582 from INTERPRO), they are predicted to be structurally similar, being predominantly alpha-helical with coiled coil regions. In general scpA and scpB form an operon in most bacterial genomes. Flanking genes are highly variable suggesting that the operon has moved throughout evolution. Bacteria containing an smc gene also contain scpA or scpB but not necessarily both. An exception is found in Deinococcus radiodurans, which contains scpB but neither smc nor scpA. In the archaea the gene order SMC-ScpA is conserved in nearly all species, as is the very short distance between the two genes, indicating co-transcription of the both in different archaeal genera and arguing that interaction of the gene products is not confined to the homologues in Bacillus subtilis. It would seem probable that, in light of all the studies, SMC, ScpA and ScpB proteins or homologues act together in chromosome condensation and segregation in all prokaryotes . Probab=25.14 E-value=16 Score=14.23 Aligned_cols=48 Identities=25% Similarity=0.418 Sum_probs=32.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHH-HCCCCCCC Q ss_conf 8999999999999998786310---688999999999999988886-04645688 Q T0618 13 VIEFVTVAAEFCAFLERAESMK---RSTFVDTTLKILPLLYLKASM-LPKCEMIG 63 (182) Q Consensus 13 ~~eFv~vA~efC~~vE~~~~~~---r~d~v~~a~~~Lp~Ly~~~s~-LP~~e~~~ 63 (182) -+.-++|++||=..++...... .++|+-.|+ -+++.|... ||..+.+. T Consensus 11 dI~I~~ItdqYL~yi~~~~~ldL~~asefLvmAa---~Ll~iKS~~LLP~~~~~e 62 (242) T PF02616_consen 11 DIPIAEITDQYLEYIEQMKELDLEIASEFLVMAA---TLLEIKSRMLLPKEEEEE 62 (242) T ss_pred HCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH---HHHHHHHHHHCCCCCCCC T ss_conf 6889999999999999866448799999999999---999999998589985432 No 7 >PF10784 Plasmid_stab_B: Plasmid stability protein; PDB: 2jd3_A. Probab=17.52 E-value=23 Score=13.28 Aligned_cols=32 Identities=25% Similarity=0.230 Sum_probs=24.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999987863106889999999999999 Q T0618 19 VAAEFCAFLERAESMKRSTFVDTTLKILPLLY 50 (182) Q Consensus 19 vA~efC~~vE~~~~~~r~d~v~~a~~~Lp~Ly 50 (182) --+.-|.++|++....|++|.+.++-.=..|| T Consensus 14 ~d~~a~~~ies~p~~eRg~~~R~all~GlAl~ 45 (72) T PF10784_consen 14 SDREACATIESLPQKERGRFQRAALLAGLALH 45 (72) T ss_dssp HHHHHHHHHHTS-GGG---HHHHHHH---HHH T ss_pred CHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH T ss_conf 03789999983599887799999999889998 No 8 >PF11568 Med29: Mediator complex subunit 29 Probab=17.31 E-value=23 Score=13.25 Aligned_cols=49 Identities=20% Similarity=0.209 Sum_probs=32.1 Q ss_pred CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 332124308999999999999998786310688999999999999988886 Q T0618 5 SQVIFDKNVIEFVTVAAEFCAFLERAESMKRSTFVDTTLKILPLLYLKASM 55 (182) Q Consensus 5 s~~~~~~~~~eFv~vA~efC~~vE~~~~~~r~d~v~~a~~~Lp~Ly~~~s~ 55 (182) ..+-|++++.||--+++|..--+-.+-+.-.+ ...+.+++|......+. T Consensus 50 ~~~rfdK~LEdFya~CDQiEl~Lkta~ec~~Q--~~~S~kylP~~V~~~~~ 98 (148) T PF11568_consen 50 PVPRFDKNLEDFYAICDQIELNLKTAIECMQQ--SQSSQKYLPGPVPPNRV 98 (148) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHCCCCCCCCCCC T ss_conf 28889999999999999999999999999999--87530038875663457 No 9 >PF00351 Biopterin_H: Biopterin-dependent aromatic amino acid hydroxylase; InterPro: IPR001273 Phenylalanine, tyrosine and tryptophan hydroxylases constitute a family of tetrahydrobiopterin-dependent aromatic amino acid hydroxylases, all of which are rate-limiting catalysts for important metabolic pathways . The proteins are structurally and functionally related, each containing iron, and catalysing ring hydroxylation of aromatic amino acids, using tetra-hydrobiopterin (BH4) as a substrate. All are regulated by phosphorylation at serines in their N-termini. It has been suggested that the proteins each contain a conserved C-terminal catalytic (C) domain and an unrelated N-terminal regulatory (R) domain. It is possible that the R domains arose from genes that were recruited from different sources to combine with the common gene for the catalytic core. Thus, by combining with the same C domain, the proteins acquired the unique regulatory properties of the separate R domains. A variety of enzymes belong to this family that includes, phenylalanine-4-hydroxylase from Chromobacterium violaceum where it is copper-dependent; it is iron-dependent in Pseudomonas aeruginosa, phenylalanine-4-hydroxylase catalyzes the conversion of phenylalanine to tyrosine. In humans, deficiencies are the cause of phenylketonuria, the most common inborn error of amino acid metabolism , tryptophan 5-hydroxylase catalyzes the rate-limiting step in serotonin biosynthesis: the conversion of tryptophan to 3-hydroxy-anthranilate and tyrosine 3-hydroxylase catalyzes the rate limiting step in catecholamine biosynthesis: the conversion of tyrosine to 3,4-dihydroxy-L-phenylalanine.; GO: 0004497 monooxygenase activity, 0005506 iron ion binding, 0009072 aromatic amino acid family metabolic process; PDB: 3e2t_A 1mlw_A 1ltu_A 1ltz_A 1ltv_A 2phm_A 1phz_A 1mmt_A 4pah_A 3pah_A .... Probab=14.12 E-value=28 Score=12.75 Aligned_cols=25 Identities=20% Similarity=0.276 Sum_probs=14.5 Q ss_pred HHHHHHHHHHHHHCCC--CCHHHHHHC Q ss_conf 7899999999875144--102445414 Q T0618 74 EIYEVLRINLASILAE--KDDYLEVFL 98 (182) Q Consensus 74 e~y~~lr~~la~lL~~--~d~Y~evf~ 98 (182) ..|..|++++..++.. .+.|++.|. T Consensus 67 ~tW~~l~~r~~~l~~~~Ac~eyl~gl~ 93 (332) T PF00351_consen 67 ATWRTLYRRQMELLPTHACKEYLEGLE 93 (332) T ss_dssp HHHHHHHHHHHHHHHHHB-HHHHHHHH T ss_pred HHHHHHHHHHHHHHHCHHHHHHHHHHH T ss_conf 999999999998874543299999999 No 10 >PF07108 PipA: PipA protein; InterPro: IPR010777 This family consists of several Salmonella PipA (pathogenicity island-encoded protein A) and related phage sequences. PipA is thought to contribute to enteric but not to systemic salmonellosis . Probab=14.01 E-value=28 Score=12.74 Aligned_cols=37 Identities=27% Similarity=0.423 Sum_probs=24.9 Q ss_pred CCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHCH Q ss_conf 8766544478578999999998751441024454140 Q T0618 63 GDESPETYVTEEIYEVLRINLASILAEKDDYLEVFLP 99 (182) Q Consensus 63 ~d~~~e~~v~ee~y~~lr~~la~lL~~~d~Y~evf~p 99 (182) +.-.|...+|.+.|..+|++|.+.|..--.-++.|-- T Consensus 70 ggidpd~eiddd~y~ecy~~ls~il~~aytqs~tfrr 106 (228) T PF07108_consen 70 GGIDPDIEIDDDIYDECYQELSSILEDAYTQSETFRR 106 (228) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHH T ss_conf 8899885247223899999999999987740088999 Done!