Query T0643 3NZL, Homo sapiens, 83 residues Match_columns 83 No_of_seqs 9 out of 11 Neff 1.6 Searched_HMMs 11830 Date Thu Jul 22 14:55:53 2010 Command /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/bin/hhsearch -i /home/syshi_3/CASP9/HHsearch4Targetseq/seq/T0643.hhm -d /home/syshi_2/2008/ferredoxin/manualcheck/update/HHsearch/database/pfamA_24_hhmdb -o /home/syshi_3/CASP9/HHsearch4Targetseq/pfamAsearch/T0643.hhr No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF09048 Cro: Cro; InterPro: 58.0 2.7 0.00023 20.6 2.5 29 25-53 5-33 (59) 2 PF07205 DUF1413: Protein of u 49.2 3.9 0.00033 19.7 2.2 41 39-79 19-59 (97) 3 PF04552 Sigma54_DBD: Sigma-54 48.4 1.5 0.00013 21.9 0.0 31 29-59 46-76 (160) 4 PF01381 HTH_3: Helix-turn-hel 41.5 9.4 0.00079 17.7 3.2 31 30-60 7-37 (55) 5 PF05703 DUF828: Plant protein 27.2 9.7 0.00082 17.6 1.3 44 32-80 71-114 (242) 6 PF04218 CENP-B_N: CENP-B N-te 26.5 10 0.00086 17.5 1.3 34 23-56 13-46 (53) 7 PF08708 PriCT_1: Primase C te 24.7 21 0.0018 15.9 2.7 34 21-57 33-66 (71) 8 PF01499 Herpes_UL25: Herpesvi 21.5 24 0.002 15.5 2.5 31 43-79 139-169 (540) 9 PF07022 Phage_CI_repr: Bacter 20.7 27 0.0023 15.2 2.8 47 24-70 4-52 (66) 10 PF08673 RsbU_N: Phosphoserine 19.0 22 0.0019 15.7 1.9 12 64-75 21-32 (77) No 1 >PF09048 Cro: Cro; InterPro: IPR000655 Bacteriophage lambda encodes two repressors: the Cro repressor that acts to turn off early gene transcription during the lytic cycle, and the lambda or cI repressor that is required to maintain lysogenic growth. Together the Cro and cI repressors form a helix-turn-helix (HTH) superfamily. The lambda Cro repressor binds to DNA as a highly flexible dimer. The crystal structure of the lambda Cro repressor reveals a HTH DNA-binding protein with an alpha/beta fold that differs from other Cro family members, possibly by an evolutionary fold change . Most Cro proteins, such as P22 Cro and phage 434 Cro, have an all-alpha structure that is thought to be ancestral to lambda Cro, where the fourth and fifth helices are replaced by a beta-sheet, possibly as a result of secondary structure switching rather than by nonhomologous replacement . This entry represents the lambda-type Cro repressor with an alpha/beta topology.; GO: 0003700 transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1cop_D 2a63_A 2ovg_A 1d1m_A 6cro_A 5cro_B 1orc_A 2ecs_B 1d1l_A 3orc_A .... Probab=58.04 E-value=2.7 Score=20.61 Aligned_cols=29 Identities=31% Similarity=0.403 Sum_probs=25.8 Q ss_pred HHHHHHHHHHHHHHHHHCCHHHHHHHHHH Q ss_conf 99999986205444442330278899886 Q T0643 25 ALKDLLKDMNQSSLAKECPLSQSMISSIV 53 (83) Q Consensus 25 Alk~LLkemnQStLakecpLsQSmiSsIV 53 (83) .|.|.+.++.|++.|+.--..||-||--+ T Consensus 5 ~L~dY~~~~GQak~A~~lGV~qsAISKai 33 (59) T PF09048_consen 5 TLADYVEEHGQAKAAKALGVTQSAISKAI 33 (59) T ss_dssp EHHHHHHH--HHHHHHH----HHHHHHHH T ss_pred EHHHHHHHHHHHHHHHHCCCCHHHHHHHH T ss_conf 09999999767999998297689999999 No 2 >PF07205 DUF1413: Protein of unknown function (DUF1413); InterPro: IPR010813 This family consists of several hypothetical bacterial proteins, which seem to be specific to Staphylococcus species. Members of this family are typically around 100 residues in length. The function of this family is unknown. Probab=49.15 E-value=3.9 Score=19.72 Aligned_cols=41 Identities=29% Similarity=0.358 Sum_probs=25.0 Q ss_pred HHHCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 44233027889988613100022488889999999998753 Q T0643 39 AKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKT 79 (83) Q Consensus 39 akecpLsQSmiSsIVNstyyanvsaakCqEFGrWyk~ykk~ 79 (83) +.-.|.-+..----.|..+-.-.|++--||-||||-.|-|. T Consensus 19 ~f~lp~g~~ftf~DLn~~aNV~cst~vQq~vGRwfaYfVK~ 59 (97) T PF07205_consen 19 AFNLPEGQEFTFHDLNSRANVQCSTNVQQNVGRWFAYFVKH 59 (97) T ss_pred EEECCCCCEEEEECCCHHHCEECCHHHHHHHHHHHHHHHHH T ss_conf 64158884587500134345443688988775688898740 No 3 >PF04552 Sigma54_DBD: Sigma-54, DNA binding domain; InterPro: IPR007634 This DNA-binding domain is based on peptide fragmentation data. This domain is proximal to DNA in the promoter/holoenzyme complex. Furthermore, this region contains a putative helix-turn-helix motif. At the C terminus, there is a highly conserved region known as the RpoN box and is the signature of the sigma-54 proteins .; PDB: 2o9l_A 2ahq_A 2o8k_A. Probab=48.44 E-value=1.5 Score=21.93 Aligned_cols=31 Identities=29% Similarity=0.400 Sum_probs=22.4 Q ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHCCCCCC Q ss_conf 9986205444442330278899886131000 Q T0643 29 LLKDMNQSSLAKECPLSQSMISSIVNSTYYA 59 (83) Q Consensus 29 LLkemnQStLakecpLsQSmiSsIVNstyya 59 (83) -|+-|....+|.+.-+..|+||-+|+++|.. T Consensus 46 ~l~Pltl~~vA~~lglheSTVSRav~~Ky~~ 76 (160) T PF04552_consen 46 ALKPLTLKDVAEELGLHESTVSRAVSNKYIQ 76 (160) T ss_dssp ------------------------------- T ss_pred CCCCCCHHHHHHHHCCCHHHHHHHHCCCEEE T ss_conf 5768549999998398830577987485363 No 4 >PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould).; GO: 0043565 sequence-specific DNA binding; PDB: 2ef8_B 3f6w_A 3eus_A 1x57_A 1utx_A 2gzu_A 1rio_A 1lli_A 1lmb_3 3bdn_B .... Probab=41.45 E-value=9.4 Score=17.71 Aligned_cols=31 Identities=29% Similarity=0.342 Sum_probs=26.3 Q ss_pred HHHHHHHHHHHHCCHHHHHHHHHHCCCCCCC Q ss_conf 9862054444423302788998861310002 Q T0643 30 LKDMNQSSLAKECPLSQSMISSIVNSTYYAN 60 (83) Q Consensus 30 LkemnQStLakecpLsQSmiSsIVNstyyan 60 (83) -+.|+|..+|+.+-++++.||.+.|+..... T Consensus 7 ~~gls~~~la~~~gis~~~i~~~e~g~~~~~ 37 (55) T PF01381_consen 7 ERGLSQEELARRLGISRSTISRIENGKRNPS 37 (55) T ss_dssp HTT--HHHHHHHHTS-HHHHHHHHTTSSGSB T ss_pred HCCCCHHHHHHHCCCCHHHHHHHHCCCCCCC T ss_conf 8699999998864987878889976998999 No 5 >PF05703 DUF828: Plant protein of unknown function (DUF828); InterPro: IPR008546 This domain consists of several plant proteins of unknown function. Probab=27.21 E-value=9.7 Score=17.64 Aligned_cols=44 Identities=32% Similarity=0.438 Sum_probs=25.1 Q ss_pred HHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 6205444442330278899886131000224888899999999987531 Q T0643 32 DMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKTK 80 (83) Q Consensus 32 emnQStLakecpLsQSmiSsIVNstyyanvsaakCqEFGrWyk~ykk~k 80 (83) -|.|+.....-|++-.-+-.++.. |..+ .-.-.|||+|+.|..| T Consensus 71 ~~~~s~~~~spPi~p~~~~~~~~~-~r~~----~~~tvg~w~~~~~~kk 114 (242) T PF05703_consen 71 IMSQSSIADSPPISPRDVDDMKKI-RRSN----GGKTVGRWLKDRKEKK 114 (242) T ss_pred CCCCCCCCCCCCCCCHHHHHHHHH-HHHC----CCCCHHHHHHHHHHHH T ss_conf 335332346999880789999999-9853----6751889998888887 No 6 >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere. Within the N-terminal 125 residues, there is a DNA-binding region, which binds to a corresponding 17bp CENP-B box sequence. CENP-B dimers either bind two separate DNA molecules or alternatively, they may bind two CENP-B boxes on one DNA molecule, with the intervening stretch of DNA forming a loop structure. The CENP-B DNA-binding domain consists of two repeating domains, RP1 and RP2. This family corresponds to RP1 has been shown to consist of four helices in a helix-turn-helix structure .; GO: 0003677 DNA binding, 0000775 chromosome, pericentric region; PDB: 2elh_A 1hlv_A 1bw6_A. Probab=26.53 E-value=10 Score=17.53 Aligned_cols=34 Identities=26% Similarity=0.343 Sum_probs=27.3 Q ss_pred HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCC Q ss_conf 9999999986205444442330278899886131 Q T0643 23 RNALKDLLKDMNQSSLAKECPLSQSMISSIVNST 56 (83) Q Consensus 23 rnAlk~LLkemnQStLakecpLsQSmiSsIVNst 56 (83) ..++..+-...+++.+|++--.+.|.|+.|+.+. T Consensus 13 ~~ii~~~e~g~s~~~iAr~fgi~~sTi~~i~k~k 46 (53) T PF04218_consen 13 IEIIKRYEEGKSQREIAREFGISRSTISRILKNK 46 (53) T ss_dssp HHHHHHHHC-T-HHHHHHHHT--CCHHHHHCCTH T ss_pred HHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHH T ss_conf 9999999849989999989199888999999839 No 7 >PF08708 PriCT_1: Primase C terminal 1 (PriCT-1); InterPro: IPR014820 This alpha helical domain is found at the C-terminal of primases. Probab=24.74 E-value=21 Score=15.87 Aligned_cols=34 Identities=26% Similarity=0.272 Sum_probs=27.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCC Q ss_conf 8999999999862054444423302788998861310 Q T0643 21 TVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTY 57 (83) Q Consensus 21 tVrnAlk~LLkemnQStLakecpLsQSmiSsIVNsty 57 (83) .-..++.+++..+|+.. .-||..+-+-+|+.|-+ T Consensus 33 ~~~~~v~~~~~~~N~~~---~~PL~~~Ev~~~~~Si~ 66 (71) T PF08708_consen 33 DWLRAVYDLLHQANSNF---NPPLPDSEVKATARSIA 66 (71) T ss_pred HHHHHHHHHHHHHHHHC---CCCCCHHHHHHHHHHHH T ss_conf 79999999999999847---99979999999999998 No 8 >PF01499 Herpes_UL25: Herpesvirus UL25 family; InterPro: IPR002493 The Herpesvirus UL25 gene product is a virion component involved in virus penetration and capsid assembly. The product of the UL25 gene is required for packaging but not cleavage of replicated viral DNA . This family includes a number of Herpesvirus proteins: Epstein-Barr virus (strain B95-8) BVRF1 P03233 from SWISSPROT, Human cytomegalovirus (strain AD169) UL77 P16726 from SWISSPROT, Infectious laryngotracheitis virus (strain Thorne V882) ORF2 P23987 from SWISSPROT, and Varicella-zoster virus (strain Dumas) gene 34 P09287 from SWISSPROT.; PDB: 2f5u_A. Probab=21.51 E-value=24 Score=15.54 Aligned_cols=31 Identities=16% Similarity=0.439 Sum_probs=18.8 Q ss_pred CHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 3027889988613100022488889999999998753 Q T0643 43 PLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKT 79 (83) Q Consensus 43 pLsQSmiSsIVNstyyanvsaakCqEFGrWyk~ykk~ 79 (83) -|..-+|+++-++.--.+-| ||-||...+.+ T Consensus 139 nf~~e~l~~lY~~~~~w~~s------FG~WY~~Lq~~ 169 (540) T PF01499_consen 139 NFRVEFLATLYANRQQWLPS------FGPWYRTLQDN 169 (540) T ss_dssp -HHHHHHHHHH------------------HHHHHHHH T ss_pred CCHHHHHHHHHHHHCCCCCC------CCHHHHHHHHH T ss_conf 75699999998620467887------67799999999 No 9 >PF07022 Phage_CI_repr: Bacteriophage CI repressor helix-turn-helix domain; InterPro: IPR010744 This family consists of several phage CI repressor proteins and related bacterial sequences. The CI repressor is known to function as a transcriptional switch, determining whether transcription is lytic or lysogenic .; GO: 0003677 DNA binding, 0016564 transcription repressor activity, 0016481 negative regulation of transcription; PDB: 2fjr_A 3bd1_B. Probab=20.67 E-value=27 Score=15.23 Aligned_cols=47 Identities=21% Similarity=0.138 Sum_probs=30.1 Q ss_pred HHHHHHHHHHHHHHHHHHCCHHHHHHH-HH-HCCCCCCCCCHHHHHHHH Q ss_conf 999999986205444442330278899-88-613100022488889999 Q T0643 24 NALKDLLKDMNQSSLAKECPLSQSMIS-SI-VNSTYYANVSAAKCQEFG 70 (83) Q Consensus 24 nAlk~LLkemnQStLakecpLsQSmiS-sI-VNstyyanvsaakCqEFG 70 (83) .-+++.+.--+|..||+..-.++|.+| .- -.++.-...-..-|.+|| T Consensus 4 ~Rl~~~~g~~~~~elA~~LgIs~stvs~~~~~r~~~P~~~~i~~a~~~g 52 (66) T PF07022_consen 4 ERLKEAYGIKTDKELAEKLGISQSTVSHTWKKRNSIPFEWLIKIALETG 52 (66) T ss_dssp HHHHHH----SCHHHHCCTT--HHHHH-HHHH-----HHHHHHHHHHT- T ss_pred HHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHCCCCCHHHHHHHHHHHC T ss_conf 9999996899699999991998888556764168898999999999989 No 10 >PF08673 RsbU_N: Phosphoserine phosphatase RsbU, N-terminal domain; InterPro: IPR014787 RsbU is a phosphoserine phosphatase which acts as a positive regulator of the general stress-response factor of Gram-positive organisms, sigma-B. The phosphatase activity of RsbU is stimulated by association with the RsbT kinase. Deletions in the N-terminal domain are deleterious to the activity of RsbU . ; PDB: 2j6z_A 2j6y_D 1w53_A 2j70_A. Probab=19.04 E-value=22 Score=15.70 Aligned_cols=12 Identities=33% Similarity=0.260 Sum_probs=9.0 Q ss_pred HHHHHHHHHHHH Q ss_conf 888999999999 Q T0643 64 AKCQEFGRWYKH 75 (83) Q Consensus 64 akCqEFGrWyk~ 75 (83) .+||+|||+-.+ T Consensus 21 y~~~~fsre~ie 32 (77) T PF08673_consen 21 YKAQKFSREAIE 32 (77) T ss_dssp HHHHHHHHHHHH T ss_pred HHHHHHHHHHHH T ss_conf 999998899998 Done!