hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            113474267.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|113474267|ref|YP_720328.1|
Accession:      [none]
Description:    cadherin [Trichodesmium erythraeum IMS101]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
HemolysinCabind Hemolysin-type calcium-binding repeat   143.7    2.1e-42   8
SBBP            Beta-propeller repeat                   122.5    4.6e-35   7
Cadherin        Cadherin domain                          20.0    5.1e-05   1
TAT_ubiq        Aminotransferase ubiquitination site     16.6     0.0001   3
Fil_haemagg     Haemagluttinin repeat                    15.9    0.00075   2
FAINT           Domain of unknown function, DUF529        8.5      0.069   1
Reg_prop        Two component regulator propeller         8.8       0.73   5
PhnA            PhnA protein                              6.3          1   4
Acetate_kinase  Acetokinase family                        1.8        1.3   1
Neugrin         Neugrin                                   2.1        1.3   1
PQQ             PQQ enzyme repeat                         5.0        1.3   2
He_PIG          Putative Ig domain                        4.3          2   1
DUF2391         Putative integral membrane protein (D     1.6        2.1   1
MCD             Malonyl-CoA decarboxylase (MCD)           0.3        2.2   1
Peptidase_M66   Peptidase M66                             1.4        2.4   1
Glyco_hydro_14  Glycosyl hydrolase family 14              1.8          3   1
MOFRL           MOFRL family                              3.4        3.1   1
BDM             Putative biofilm-dependent modulation     2.1          4   1
ENOD40          ENOD40 protein                            5.2        4.1   2
Ribosomal_S8    Ribosomal protein S8                      1.2        4.2   1
OprB            Carbohydrate-selective porin, OprB fa     0.7        4.6   1
Y_Y_Y           Y_Y_Y domain                              2.6        4.6   1
Invasin_D3      Invasin, domain 3                         1.7        5.8   1
adh_short       short chain dehydrogenase                 1.5        6.1   1
DUF2581         Protein of unknown function (DUF2581)     1.7        6.1   1
Thaumatin       Thaumatin family                         -1.8        6.6   1
DUF1314         Protein of unknown function (DUF1314)     0.5        7.1   1
DUF1858         Domain of unknown function (DUF1858)      2.2        7.7   1
Fimbrial_K88    Fimbrial, major and minor subunit         0.5        7.9   1
Phage_tail_S    Phage virion morphogenesis family         0.9        8.1   1
DUF796          Protein of unknown function (DUF796)      1.4        8.4   1
KR              KR domain                                 0.5        9.3   1
Ribosomal_S5_C  Ribosomal protein S5, C-terminal doma     1.9        9.4   1
Vert_HS_TF      Vertebrate heat shock transcription f    -0.7        9.8   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Vert_HS_TF        1/1      11    24 ..   202   215 ..    -0.7      9.8
BDM               1/1      18    33 ..    77    92 .]     2.1        4
MOFRL             1/1      27    41 ..    42    60 ..     3.4      3.1
Phage_tail_S      1/1      33    53 ..   134   154 .]     0.9      8.1
DUF1858           1/1      41    54 ..     1    17 [.     2.2      7.7
DUF1314           1/1      52    64 ..   177   189 .]     0.5      7.1
DUF2581           1/1     136   149 ..     1    14 [.     1.7      6.1
SBBP              1/7     171   199 ..     1    31 [.    14.8   0.0021
Ribosomal_S8      1/1     173   185 ..   131   143 .]     1.2      4.2
PhnA              1/4     187   199 ..     1    13 [.     1.1       24
DUF796            1/1     188   209 ..    19    38 ..     1.4      8.4
Fil_haemagg       1/2     208   308 ..     1    75 []     2.5      5.4
SBBP              2/7     238   266 ..     1    31 [.    24.5    3e-06
Reg_prop          1/5     245   268 ..     1    23 []     1.3       55
PhnA              2/4     254   266 ..     1    13 [.     1.0       27
adh_short         1/1     260   270 ..     1    11 [.     1.5      6.1
KR                1/1     260   270 ..     1    11 [.     0.5      9.3
ENOD40            1/2     303   313 ..     1    12 []     2.7       18
Ribosomal_S5_C    1/1     305   318 ..    39    52 ..     1.9      9.4
SBBP              3/7     305   342 ..     1    39 []    17.5  0.00033
OprB              1/1     311   343 ..   443   468 .]     0.7      4.6
Reg_prop          2/5     313   338 ..     1    23 []     0.0  1.2e+02
PhnA              3/4     323   335 ..     1    13 [.     0.3       40
Glyco_hydro_14    1/1     354   366 ..   422   434 .]     1.8        3
PQQ               1/2     355   388 ..     1    37 []     3.8      3.1
TAT_ubiq          1/3     359   376 ..     1    18 [.     6.4     0.21
ENOD40            2/2     371   381 ..     1    12 []     2.4       23
SBBP              4/7     373   401 ..     1    31 [.    13.0   0.0069
Peptidase_M66     1/1     379   394 ..   192   207 ..     1.4      2.4
MCD               1/1     412   428 ..     1    22 [.     0.3      2.2
Fil_haemagg       2/2     418   504 ..     1    75 []    13.4   0.0039
TAT_ubiq          2/3     423   444 ..     1    22 [.     4.2      1.1
Neugrin           1/1     430   440 ..   212   222 .]     2.1      1.3
SBBP              5/7     437   465 ..     1    31 [.    26.5  7.7e-07
Reg_prop          3/5     444   467 ..     1    23 []     4.1       11
PhnA              4/4     453   465 ..     1    13 [.     3.9      4.5
Thaumatin         1/1     473   490 ..    86   103 ..    -1.8      6.6
TAT_ubiq          3/3     487   510 ..     1    24 [.     6.0     0.29
PQQ               2/2     488   516 ..     9    37 .]     1.2       19
SBBP              6/7     501   530 ..     1    32 [.    22.5  1.2e-05
Reg_prop          4/5     508   532 ..     1    23 []     2.0       37
Invasin_D3        1/1     527   537 ..    68    78 ..     1.7      5.8
FAINT             1/1     534   595 ..     1   116 []     8.5    0.069
Reg_prop          5/5     548   568 ..     1    20 [.     1.2       59
SBBP              7/7     575   597 ..    16    39 .]     3.7        4
Fimbrial_K88      1/1     592   600 ..     1     9 [.     0.5      7.9
Cadherin          1/1     633   721 ..     1   107 []    20.0  5.1e-05
He_PIG            1/1     673   709 ..    31    61 .]     4.3        2
Y_Y_Y             1/1     697   721 ..    42    69 .]     2.6      4.6
HemolysinCabind   1/8     725   742 ..     1    18 []    18.6  0.00018
DUF2391           1/1     730   737 ..     1     8 [.     1.6      2.1
HemolysinCabind   2/8     743   760 ..     1    18 []    21.9  1.8e-05
HemolysinCabind   3/8     761   778 ..     1    18 []    14.2   0.0038
HemolysinCabind   4/8     779   796 ..     1    18 []    20.2  5.8e-05
HemolysinCabind   5/8     797   814 ..     1    18 []    13.6   0.0058
HemolysinCabind   6/8     815   832 ..     1    18 []    22.0  1.7e-05
HemolysinCabind   7/8     833   850 ..     1    18 []    17.7  0.00033
HemolysinCabind   8/8     851   868 ..     1    18 []    15.4   0.0017
Acetate_kinase    1/1     916   924 ..   389   397 .]     1.8      1.3

Alignments of top-scoring domains:
Vert_HS_TF: domain 1 of 1, from 11 to 24: score -0.7, E = 9.8
                   *->IDsnLedLQamLSg<-*
                      ID + e+ Q++L+g
  gi|1134742    11    IDASVENYQQLLNG    24

BDM: domain 1 of 1, from 18 to 33: score 2.1, E = 4
                   *->YqqtinYvvsGqHPtL<-*
                      Yqq +n v+ G  P L
  gi|1134742    18    YQQLLNGVIPGVKPFL    33

MOFRL: domain 1 of 1, from 27 to 41: score 3.4, E = 3.1
                CS    .T-TTE...EEEEEETTS-
                   *->lgaegisDFlfLsadTDGI<-*
                      +g++++    +L++dTDGI
  gi|1134742    27    PGVKPF----LLGGDTDGI    41

Phage_tail_S: domain 1 of 1, from 33 to 53: score 0.9, E = 8.1
                   *->lLGltkqDeqmIeeiIlkhls<-*
                      lLG + ++ q I +i++kh +
  gi|1134742    33    LLGGDTDGIQQIGDILQKHPE    53

DUF1858: domain 1 of 1, from 41 to 54: score 2.2, E = 7.7
                   *->IdkdttvgdLveryPet<-*
                      I   + +gd++ ++Pet
  gi|1134742    41    I---QQIGDILQKHPET    54

DUF1314: domain 1 of 1, from 52 to 64: score 0.5, E = 7.1
                   *->PtvsnsrilakGS<-*
                      P + + +i+++GS
  gi|1134742    52    PETDTLHIISHGS    64

DUF2581: domain 1 of 1, from 136 to 149: score 1.7, E = 6.1
                   *->skpWeLevrPhftp<-*
                      + +WeLevr+  t+
  gi|1134742   136    GGNWELEVRTGQTK    149

SBBP: domain 1 of 7, from 171 to 199: score 14.8, E = 0.0021
                   *->qWstqlGPgpgasifgngIavDsnGNiYvtG<-*
                      +W++ +G  +++ +++++I++Ds GN+ v+G
  gi|1134742   171    EWAKHIG--GQGLTYVYRITTDSIGNVLVAG    199

Ribosomal_S8: domain 1 of 1, from 173 to 185: score 1.2, E = 4.2
                CS    HCT--EEEEEEE-
                   *->kkgvGGElLcyVw<-*
                      +k++GG+ L yV+
  gi|1134742   173    AKHIGGQGLTYVY    185

PhnA: domain 1 of 4, from 187 to 199: score 1.1, E = 24
                   *->ivkDsnGnlLadG<-*
                      i+ Ds Gn+L  G
  gi|1134742   187    ITTDSIGNVLVAG    199

DUF796: domain 1 of 1, from 188 to 209: score 1.4, E = 8.4
                   *->T.DSIGesqdag.HeDeIevls<-*
                      T+DSIG++++ag + D I++ +
  gi|1134742   188    TtDSIGNVLVAGvFDDNIDIDG    209

Fil_haemagg: domain 1 of 2, from 208 to 308: score 2.5, E = 5.4
                CS    EEESSEEEETT                       TT--EE-SEEEEE
                   *->vaaGaltlnaa.......................alggldlnnggtl
                      +  G+++ + ++++++++    + +++++    ++ gg  +  + t+
  gi|1134742   208    DGDGNNDFTSNkdsstrdayvakfdsngnwiwakQIGGRGSEDIKTI 254

                CS E-STT-EEEE-S-EEESSE..................   .EEEEESS-E
                   sagggltltaagllnnggtliaggdlllaagalrngg...dltltaaGdL
                    ++   ++  ag +    ++++ g+ + +++ ++++++  ++ l++ G+L
  gi|1134742   255 TTDSSGNVLVAGGFGGNIDIDGDGNNDFSSNNDSSNNdafAAKLDSNGNL 304

                CS EEEE
                   dnsg<-*
                    ++
  gi|1134742   305 VWAK    308

SBBP: domain 2 of 7, from 238 to 266: score 24.5, E = 3e-06
                   *->qWstqlGPgpgasifgngIavDsnGNiYvtG<-*
                      +W++q+G g+g  +  + I++Ds+GN+ v+G
  gi|1134742   238    IWAKQIG-GRGSED-IKTITTDSSGNVLVAG    266

Reg_prop: domain 1 of 5, from 245 to 268: score 1.3, E = 55
                   *->slpgg.vtfalledsdGrlWigt.n<-*
                      +  ++++  ++ +ds G+++++++
  gi|1134742   245    GRGSEdIK-TITTDSSGNVLVAGgF    268

PhnA: domain 2 of 4, from 254 to 266: score 1.0, E = 27
                   *->ivkDsnGnlLadG<-*
                      i+ Ds Gn+L  G
  gi|1134742   254    ITTDSSGNVLVAG    266

adh_short: domain 1 of 1, from 260 to 270: score 1.5, E = 6.1
                CS    EEEEECTTSSH
                   *->GTvLiTGGtGG<-*
                      G vL+ GG GG
  gi|1134742   260    GNVLVAGGFGG    270

KR: domain 1 of 1, from 260 to 270: score 0.5, E = 9.3
                   *->GtYLvTGGlGG<-*
                      G +Lv+GG+GG
  gi|1134742   260    GNVLVAGGFGG    270

ENOD40: domain 1 of 2, from 303 to 313: score 2.7, E = 18
                   *->melcWqksiHGs<-*
                       +l W k i Gs
  gi|1134742   303    -NLVWAKQIGGS    313

Ribosomal_S5_C: domain 1 of 1, from 305 to 318: score 1.9, E = 9.4
                CS    EEEEE-S.--SHHH
                   *->iltksyGkSrnpiN<-*
                      +++k++G S++++N
  gi|1134742   305    VWAKQIGGSVTTGN    318

SBBP: domain 3 of 7, from 305 to 342: score 17.5, E = 0.00033
                   *->qWstqlGP..gpgasifgngIavDsnGNiYvtGstngnnfe<-*
                      +W++q+G++ ++g+  + +gI +Ds+GN+ v+G+  g n++
  gi|1134742   305    VWAKQIGGsvTTGN--YISGIITDSSGNALVAGTFKG-NID    342

OprB: domain 1 of 1, from 311 to 343: score 0.7, E = 4.6
                   *->ggnypnpn.......sdndnalvlGTLrttftF<-*
                      gg ++++n  ++  ++  +nalv+GT++ +++
  gi|1134742   311    GGSVTTGNyisgiitDSSGNALVAGTFKGNIDI    343

Reg_prop: domain 2 of 5, from 313 to 338: score 0.0, E = 1.2e+02
                   *->slpgg.vtfalledsdG.rlWigt.n<-*
                      s++ g++++ + +ds G+ l +gt +
  gi|1134742   313    SVTTGnYISGIITDSSGnALVAGTfK    338

PhnA: domain 3 of 4, from 323 to 335: score 0.3, E = 40
                   *->ivkDsnGnlLadG<-*
                      i+ Ds Gn L  G
  gi|1134742   323    IITDSSGNALVAG    335

Glyco_hydro_14: domain 1 of 1, from 354 to 366: score 1.8, E = 3
                CS    T....-HHHHHHH
                   *->nsdGsntselseF<-*
                      n+dGsn s  ++F
  gi|1134742   354    NNDGSNDSYVAKF    366

PQQ: domain 1 of 2, from 355 to 388: score 3.8, E = 3.1
                CS    TEEEEETTTSEEEEEETTTTSEEEEEESSSGGGS GEE
                   *->gvvyvgtadGylyAlDakTGkvlWkfktggpvds.pvt<-*
                      ++   g+ d y+  +D ++G+++W +++gg   +++
  gi|1134742   355    ND---GSNDSYVAKFD-SNGNLVWAKRIGGSNGNsSGA    388

TAT_ubiq: domain 1 of 3, from 359 to 376: score 6.4, E = 0.21
                   *->mdsYlIqmngngsLvknk<-*
                      +dsY+ + ++ng+Lv  k
  gi|1134742   359    NDSYVAKFDSNGNLVWAK    376

ENOD40: domain 2 of 2, from 371 to 381: score 2.4, E = 23
                   *->melcWqksiHGs<-*
                       +l W k i Gs
  gi|1134742   371    -NLVWAKRIGGS    381

SBBP: domain 4 of 7, from 373 to 401: score 13.0, E = 0.0069
                   *->qWstqlGPgpgasifgngIavDsnGNiYvtG<-*
                      +W++++G g++++     I++Ds+ N+ v+G
  gi|1134742   373    VWAKRIG-GSNGNS-SGAITIDSSDNVLVAG    401

Peptidase_M66: domain 1 of 1, from 379 to 394: score 1.4, E = 2.4
                   *->GGsGGGssGivTldas<-*
                      GGs G+ssG++T+d+s
  gi|1134742   379    GGSNGNSSGAITIDSS    394

MCD: domain 1 of 1, from 412 to 428: score 0.3, E = 2.2
                   *->mLvekFgsdkekLdqAIdkYRA<-*
                      +++ +F+s+ e+     d Y A
  gi|1134742   412    DGNNNFTSNGEA-----DSYVA    428

Fil_haemagg: domain 2 of 2, from 418 to 504: score 13.4, E = 0.0039
                CS    EEESSEEEETT            TT--EE-SEEEEEE-STT-EEEE-
                   *->vaaGaltlnaa............alggldlnnggtlsagggltltaa
                      ++ G  +  +a+ +++++    +++g++ ++ + ++ ++ + ++  +
  gi|1134742   418    TSNGEADSYVAkfdsngnfvwakQFGSIRADYINSITTDSNGNVLVG 464

                CS S-EEESSE...................EEEEESS-EEEEE
                   gllnnggtliaggdlllaagalrnggdltltaaGdLdnsg<-*
                   gl+n   ++++ g+ + +++++++g  + l++ G+L ++
  gi|1134742   465 GLFNSYIDIDGDGNNDFTSISDIDGYVAKLDSNGNLVWAK    504

TAT_ubiq: domain 2 of 3, from 423 to 444: score 4.2, E = 1.1
                   *->mdsYlIqmngngsLvknkvnGs<-*
                       dsY+ + ++ng+ v  k  Gs
  gi|1134742   423    ADSYVAKFDSNGNFVWAKQFGS    444

Neugrin: domain 1 of 1, from 430 to 440: score 2.1, E = 1.3
                   *->FDsnGnFLYRi<-*
                      FDsnGnF++
  gi|1134742   430    FDSNGNFVWAK    440

SBBP: domain 5 of 7, from 437 to 465: score 26.5, E = 7.7e-07
                   *->qWstqlGPgpgasifgngIavDsnGNiYvtG<-*
                      +W++q+G   +a ++ n+I++DsnGN+ v+G
  gi|1134742   437    VWAKQFG-SIRA-DYINSITTDSNGNVLVGG    465

Reg_prop: domain 3 of 5, from 444 to 467: score 4.1, E = 11
                   *->slpgg.vtfalledsdGrlWigt.n<-*
                      s+    ++ ++ +ds+G++++g+
  gi|1134742   444    SIRADyIN-SITTDSNGNVLVGGlF    467

PhnA: domain 4 of 4, from 453 to 465: score 3.9, E = 4.5
                   *->ivkDsnGnlLadG<-*
                      i+ DsnGn+L  G
  gi|1134742   453    ITTDSNGNVLVGG    465

Thaumatin: domain 1 of 1, from 473 to 490: score -1.8, E = 6.6
                CS    EEET.TEEEEEEE-TT-B
                   *->LngfsnkDFyDISlvDGF<-*
                      ++g++n DF  IS +DG+
  gi|1134742   473    IDGDGNNDFTSISDIDGY    490

TAT_ubiq: domain 3 of 3, from 487 to 510: score 6.0, E = 0.29
                   *->mdsYlIqmngngsLvknkvnGstl<-*
                       d Y+ + ++ng+Lv  k  Gs l
  gi|1134742   487    IDGYVAKLDSNGNLVWAKQFGSSL    510

PQQ: domain 2 of 2, from 488 to 516: score 1.2, E = 19
                CS    TSEEEEEETTTTSEEEEEESSSGGGS GEE
                   *->dGylyAlDakTGkvlWkfktggpvds.pvt<-*
                      dGy+  lD ++G+++W ++ g+   +
  gi|1134742   488    DGYVAKLD-SNGNLVWAKQFGSSLGGvVRS    516

SBBP: domain 6 of 7, from 501 to 530: score 22.5, E = 1.2e-05
                   *->qWstqlGPgpgasifgngIavDsnGNiYvtGs<-*
                      +W++q+G  +++ + ++++++Ds+GN+ v+G+
  gi|1134742   501    VWAKQFG-SSLGGV-VRSLTTDSSGNVLVVGN    530

Reg_prop: domain 4 of 5, from 508 to 532: score 2.0, E = 37
                   *->slpgg.vtfalledsdG.rlWigt.n<-*
                      s  gg v+ +l +ds G++l +g+
  gi|1134742   508    SSLGGvVR-SLTTDSSGnVLVVGNfS    532

Invasin_D3: domain 1 of 1, from 527 to 537: score 1.7, E = 5.8
                CS    EE-SS-EEEEE
                   *->VVGNsvGDVdI<-*
                      VVGN  GDVdI
  gi|1134742   527    VVGNFSGDVDI    537

FAINT: domain 1 of 1, from 534 to 595: score 8.5, E = 0.069
                   *->tLDlnnsessnkksstdefdyikvhlslsngvnyktytpksgykrfs
                       +D+++  +++++               sng++++t+t+k
  gi|1134742   534    DVDIDGDGNNDFT---------------SNGNGNHTFTAK------- 558

                   kVnkdtvNiSqygneglitsgdtviWeskdgeelskvvvvylkdkkkvlv
                              y+++      ++++W  k + + +++++++++++
  gi|1134742   559 -----------YDSN------GNLVWV-KHNLHNAYTITTDSSGN----- 585

                   nslNpkskylvlllinnsk<-*
                            ++++ + n++
  gi|1134742   586 ---------VLMVSDFNGN    595

Reg_prop: domain 5 of 5, from 548 to 568: score 1.2, E = 59
                   *->slpgg.vtfalledsdG.rlWi<-*
                      +++g++ + +  +ds+G+ +W+
  gi|1134742   548    NGNGNhTF-TAKYDSNGnLVWV    568

SBBP: domain 7 of 7, from 575 to 597: score 3.7, E = 4
                   *->gngIavDsnGNiYvtGstngnnfe<-*
                      ++ I++Ds+GN+  + + ng n++
  gi|1134742   575    AYTITTDSSGNVLMVSDFNG-NID    597

Fimbrial_K88: domain 1 of 1, from 592 to 600: score 0.5, E = 7.9
                   *->fnGeidiGG<-*
                      fnG+idi G
  gi|1134742   592    FNGNIDIDG    600

Cadherin: domain 1 of 1, from 633 to 721: score 20.0, E = 5.1e-05
                CS    --EEE-SS...S---EEEEE---S..-TTTT----------S   S-
                   *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnp...gg
                       + ++ En++ +t+++++  tD+D    +    +Ys+++g  ++++g
  gi|1134742   633    SNNTIDENVAANTPIGNLSSTDPD----TGDTFTYSLVSGAGdtdNG 675

                CS ---B-TTSSEEE..E---S---S.....S-B--EEE----.........S
                   wFrIdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasgggp
                   +F I     +    ++++ + D+E    + Y++ ve tDa+
  gi|1134742   676 TFNISG--DE----LTIKSSPDYENK--PSYSIRVETTDAA--------- 708

                CS ---EEEE--EEE-
                   plsstatvtitVl<-*
                   + +   ++ti+V
  gi|1134742   709 GETYQKELTINVN    721

He_PIG: domain 1 of 1, from 673 to 709: score 4.3, E = 2
                   *->dsstGritGt.......PtptvqpGsytftvtatdgsg<-*
                      d+ t +i+G++ + +++P++   p sy+++v  td++g
  gi|1134742   673    DNGTFNISGDeltikssPDYENKP-SYSIRVETTDAAG    709

Y_Y_Y: domain 1 of 1, from 697 to 721: score 2.6, E = 4.6
                   *->kYtikvkakdkdgnwsyddiasltftvl<-*
                      +Y i+v+++d  g++ +   ++lt++v+
  gi|1134742   697    SYSIRVETTDAAGETYQ---KELTINVN    721

HemolysinCabind: domain 1 of 8, from 725 to 742: score 18.6, E = 0.00018
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+ GnD+L+G+a +D +
  gi|1134742   725    DGNSGNDILRGTAAADSI    742

DUF2391: domain 1 of 1, from 730 to 737: score 1.6, E = 2.1
                   *->ndlaRGtA<-*
                      nd++RGtA
  gi|1134742   730    NDILRGTA    737

HemolysinCabind: domain 2 of 8, from 743 to 760: score 21.9, E = 1.8e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      yG +G+D LyG +GnD++
  gi|1134742   743    YGLEGRDKLYGKGGNDII    760

HemolysinCabind: domain 3 of 8, from 761 to 778: score 14.2, E = 0.0038
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GGa  D+  G++G+D+l
  gi|1134742   761    SGGADSDIVKGDSGDDQL    778

HemolysinCabind: domain 4 of 8, from 779 to 796: score 20.2, E = 5.8e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G++G+D+LyGg GnD++
  gi|1134742   779    NGDDGRDRLYGGTGNDII    796

HemolysinCabind: domain 5 of 8, from 797 to 814: score 13.6, E = 0.0058
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG+  D+  G++G+D+l
  gi|1134742   797    SGGEDKDIVKGDSGDDQL    814

HemolysinCabind: domain 6 of 8, from 815 to 832: score 22.0, E = 1.7e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+aG D+LyGg GnD+l
  gi|1134742   815    NGDAGPDRLYGGTGNDIL    832

HemolysinCabind: domain 7 of 8, from 833 to 850: score 17.7, E = 0.00033
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG+GnD LyG +G+D l
  gi|1134742   833    LGGDGNDLLYGQGGDDEL    850

HemolysinCabind: domain 8 of 8, from 851 to 868: score 15.4, E = 0.0017
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG G D+LyG +G Dt+
  gi|1134742   851    NGGPGMDRLYGSDGIDTF    868

Acetate_kinase: domain 1 of 1, from 916 to 924: score 1.8, E = 1.3
                CS    --HHHHHHH
                   *->TNEElaIAr<-*
                      T+EElaI+
  gi|1134742   916    TGEELAIVL    924

//