hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            113477819.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|113477819|ref|YP_723880.1|
Accession:      [none]
Description:    hypothetical protein Tery_4419 [Trichodesmium erythraeum IMS101]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
RBD-FIP         FIP domain                                6.8       0.78   1
OstA            OstA-like protein                         4.5       0.81   1
DUF1968         Domain of unknown function (DUF1968)      3.6       0.97   1
FliX            Class II flagellar assembly regulator     2.6        1.3   1
TBCC            Tubulin binding cofactor C                2.8        1.9   1
PAP_central     Poly(A) polymerase central domain         2.3        2.5   1
Nucleoporin2    Nucleoporin autopeptidase                 1.5        2.6   1
YaeQ            YaeQ protein                              1.9        2.7   1
Bundlin         Bundlin                                   2.4        2.8   1
Tubulin_C       Tubulin/FtsZ family, C-terminal domai     2.4        3.3   1
DUF892          Protein of unknown function (DUF892)      2.6        3.7   1
PEGA            PEGA domain                               3.2        3.7   1
Chlam_PMP       Chlamydia polymorphic membrane protei     5.3        3.8   1
Filo_VP35       Filoviridae VP35                          0.8        4.1   1
P4Ha_N          Prolyl 4-Hydroxylase alpha-subunit, N     1.8        5.6   1
RecA            recA bacterial DNA recombination prot    -0.4        5.9   1
Kunitz_legume   Trypsin and protease inhibitor            1.6        6.5   1
PsaL            Photosystem I reaction centre subunit     0.9        6.5   1
Bact_transglu_N Bacterial transglutaminase-like N-ter     2.5        7.2   1
DUF1995         Domain of unknown function (DUF1995)      0.6        7.5   1
CholecysA-Rec_N Cholecystokinin A receptor, N-termina     1.5        8.9   1
TAF             TATA box binding protein associated f     1.5         10   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Filo_VP35         1/1      49    57 ..   328   336 .]     0.8      4.1
YaeQ              1/1      63    77 ..   162   176 .]     1.9      2.7
DUF892            1/1     102   119 ..   146   163 .]     2.6      3.7
P4Ha_N            1/1     148   158 ..   130   140 .]     1.8      5.6
RBD-FIP           1/1     173   187 ..    34    48 .]     6.8     0.78
DUF1968           1/1     305   311 ..     1     7 [.     3.6     0.97
PAP_central       1/1     311   921 ..    45    67 ..     2.3      2.5
Bact_transglu_N   1/1     357   372 ..    66    81 .]     2.5      7.2
FliX              1/1     363   400 ..     1    42 [.     2.6      1.3
Nucleoporin2      1/1     521   531 ..   158   168 ..     1.5      2.6
PsaL              1/1     620   647 ..    95   122 ..     0.9      6.5
TBCC              1/1     743   756 ..   107   120 .]     2.8      1.9
TAF               1/1     752   761 ..    56    66 .]     1.5       10
Tubulin_C         1/1     752   774 ..    79   106 ..     2.4      3.3
Bundlin           1/1     767   784 ..    80    97 .]     2.4      2.8
RecA              1/1     793   813 ..    57    74 ..    -0.4      5.9
Kunitz_legume     1/1     817   824 ..     1     8 [.     1.6      6.5
Chlam_PMP         1/1     818   848 ..     1    19 []     5.3      3.8
PEGA              1/1     864   878 ..     1    15 [.     3.2      3.7
DUF1995           1/1     868   881 ..   277   290 .]     0.6      7.5
CholecysA-Rec_N   1/1     876   885 ..     1    11 [.     1.5      8.9
OstA              1/1     894   916 ..   141   163 ..     4.5     0.81

Alignments of top-scoring domains:
Filo_VP35: domain 1 of 1, from 49 to 57: score 0.8, E = 4.1
                   *->dGktlgLKI<-*
                      dGkt g KI
  gi|1134778    49    DGKTSGIKI    57

YaeQ: domain 1 of 1, from 63 to 77: score 1.9, E = 2.7
                   *->wlsdddgsvevtpev<-*
                      +++d +g+v++t+++
  gi|1134778    63    MITDAGGTVALTLTE    77

DUF892: domain 1 of 1, from 102 to 119: score 2.6, E = 3.7
                   *->TdekLtelaeatvnkkae<-*
                      Tde  ++++ea++nkka
  gi|1134778   102    TDETNLQHQEAGINKKAI    119

P4Ha_N: domain 1 of 1, from 148 to 158: score 1.8, E = 5.6
                   *->kdLAkGvLnGv<-*
                      ++LA+GvL+G
  gi|1134778   148    EELANGVLPGR    158

RBD-FIP: domain 1 of 1, from 173 to 187: score 6.8, E = 0.78
                   *->LvrImEetPsILevk<-*
                      +vr++Ee+P+ L +
  gi|1134778   173    IVRVLEEHPQVLSIH    187

DUF1968: domain 1 of 1, from 305 to 311: score 3.6, E = 0.97
                   *->PAVYQLr<-*
                      PAVYQ r
  gi|1134778   305    PAVYQIR    311

PAP_central: domain 1 of 1, from 311 to 921: score 2.3, E = 2.5
                CS    HHHHHHHHHHHHHHHHHH
                RF    xxxxxxxxxxxxxxxxxx
                   *->ReeVLgkLnqlVkewVke.............................
                      Re VL+ Ln l++e+++ ++++  + +  + ++ ++     ++ +++
  gi|1134778   311    REGVLKELNPLTREFIDIgdtgiasinaaglnradnymyamervtgt 357

                CS
                RF
                   ..................................................
                   +++  + +++++ +  ++++++++++ +  + ++ +++++  ++ ++++
  gi|1134778   358 shrlvridstgtveyvtssggtssnsadaftlttansskpaagdvddkgy 407

                CS
                RF
                   ..................................................
                        +++++++ +++  + + +++++ ++++ ++  ++ + ++  ++
  gi|1134778   408 lwvvfksededsinssvyrikltdpshvstgeintiwtnvdwheiaedva 457

                CS
                RF
                   ..................................................
                     + ++++   + ++ ++  + + +    + + ++ +   ++ +++ + +
  gi|1134778   458 yvnadgkdylfgvnsvgrifeidisaaavdqdvntitqlvpdmsssvnir 507

                CS
                RF
                   ..................................................
                   + ++++++++  ++  + ++ ++ ++++ +   ++++++   ++++   +
  gi|1134778   508 dangnsttnrligdfisfdpitgversnfeaawtgsegglyvskngqayn 557

                CS
                RF
                   ..................................................
                     + ++++ +++  ++  +++++ + +++++ ++++ ++  + +  + ++
  gi|1134778   558 manfspdeqpdraaeelvsntdgqniretdgvstsdlssvfhiplidlng 607

                CS
                RF
                   ..................................................
                   +++++++ ++ + + ++ +++++  +  ++++++ +++++++++  +++
  gi|1134778   608 tetgdknlddvdydagtftegdpavdivetttgtvpnpenpsnpvfnngl 657

                CS
                RF
                   ..................................................
                     ++  + +++++ ++ +++++++  + +++  + + + ++  ++++
  gi|1134778   658 iikdyinisdpdnittatnnnnsgvvsagdrlatatvtltnaydgdellv 707

                CS
                RF
                   ..................................................
                   ++ +  ++ +++ ++ +  + +++++ ++++   + +++++++ + ++ +
  gi|1134778   708 ssatvadgasttvgsitiaragtgntagtnnialtltpttgttasvddfn 757

                CS
                RF
                   ..................................................
                      +    +++++ +++++++     ++ +++++++  ++++++++++++
  gi|1134778   758 aaikaiqfkntseapnntnrtiqfvltdadgntsdeifgpdsggrkhttt 807

                CS
                RF
                   ..................................................
                         ++ +  + +++++++ ++++ +++ +++++    ++++ + ++
  gi|1134778   808 vavqavndapvldldgnnsstatgsdykttftegggavaigdsdvsitda 857

                CS
                RF
                   ..................................................
                   ++ + ++ + + ++++++++ ++   +++ +++ + +  +++++  + ++
  gi|1134778   858 ddiniesatitlgsrpdgdtvesllvngtlpgtisagaydsstgvitltg 907

                CS          SSS-B
                RF          xxxxx
                   .........alprv<-*
                   + + +    a+ ++
  gi|1134778   908 satlsqyqaAIAQI    921

Bact_transglu_N: domain 1 of 1, from 357 to 372: score 2.5, E = 7.2
                   *->gphdeLtIeaesvVet<-*
                      + h+ ++I+++++Ve
  gi|1134778   357    TSHRLVRIDSTGTVEY    372

FliX: domain 1 of 1, from 363 to 400: score 2.6, E = 1.3
                   *->MrisGprgttaasggkakksrasGgksaFalplvaaagsase<-*
                       ri +++ ++ +++++++  ++ ++  aF+l+++++  +a++
  gi|1134778   363    -RIDSTGTVEYVTSSGGT--SSNSA-DAFTLTTANSSKPAAG    400

Nucleoporin2: domain 1 of 1, from 521 to 531: score 1.5, E = 2.6
                   *->eFisYdPetGv<-*
                      +Fis+dP+tGv
  gi|1134778   521    DFISFDPITGV    531

PsaL: domain 1 of 1, from 620 to 647: score 0.9, E = 6.5
                   *->YGvvsFqeGEPSpspalstvttpnppdd<-*
                      Y + +F+eG+P + ++++t++t  +p++
  gi|1134778   620    YDAGTFTEGDPAVDIVETTTGTVPNPEN    647

TBCC: domain 1 of 1, from 743 to 756: score 2.8, E = 1.9
                   *->LepetNnwadVdDF<-*
                      L p+t+ +a+VdDF
  gi|1134778   743    LTPTTGTTASVDDF    756

TAF: domain 1 of 1, from 752 to 761: score 1.5, E = 10
                CS    -HHHHHHH.H-
                   *->TvdDidsALLR<-*
                      +vdD++ A ++
  gi|1134778   752    SVDDFNAA-IK    761

Tubulin_C: domain 1 of 1, from 752 to 774: score 2.4, E = 3.3
                CS    -CCHHHHHHHHHHHCT-.--B-TTSEEE
                   *->slkEvneaiqrireknsdaqFVeWapii<-*
                      s +++n+ai +i+ kn+      +ap++
  gi|1134778   752    SVDDFNAAIKAIQFKNT-----SEAPNN    774

Bundlin: domain 1 of 1, from 767 to 784: score 2.4, E = 2.8
                   *->ntsAiPDnyKdakrtklt<-*
                      nts  P n  ++ + +lt
  gi|1134778   767    NTSEAPNNTNRTIQFVLT    784

RecA: domain 1 of 1, from 793 to 813: score -0.4, E = 5.9
                CS    EEEESTTSSH   HHHHHHHH
                   *->EIYGPESSGK...TTlaLhaI<-*
                      EI+GP S G +++TT+a +a+
  gi|1134778   793    EIFGPDSGGRkhtTTVAVQAV    813

Kunitz_legume: domain 1 of 1, from 817 to 824: score 1.6, E = 6.5
                CS    B-BETTSC
                   *->pVLDtdGn<-*
                      pVLD dGn
  gi|1134778   817    PVLDLDGN    824

Chlam_PMP: domain 1 of 1, from 818 to 848: score 5.3, E = 3.8
                   *->ditFsgNsa............aggGGAiyas<-*
                       ++++gN +++ ++++ +++ ++gGGA+
  gi|1134778   818    VLDLDGNNSstatgsdykttfTEGGGAVAIG    848

PEGA: domain 1 of 1, from 864 to 878: score 3.2, E = 3.7
                   *->tgtLsvsSnPsGAtV<-*
                      ++t+++ S+P G+tV
  gi|1134778   864    SATITLGSRPDGDTV    878

DUF1995: domain 1 of 1, from 868 to 881: score 0.6, E = 7.5
                   *->efeeRPtgEeidal<-*
                      ++ +RP+g++++ l
  gi|1134778   868    TLGSRPDGDTVESL    881

CholecysA-Rec_N: domain 1 of 1, from 876 to 885: score 1.5, E = 8.9
                CS    -HCHCCCCCCC
                   *->mdvvdsLlvng<-*
                       d v+sLlvng
  gi|1134778   876    -DTVESLLVNG    885

OstA: domain 1 of 1, from 894 to 916: score 4.5, E = 0.81
                   *->aeYdskkriivLtGnAvltsclp<-*
                      + Yds++ +i+LtG A+l+++++
  gi|1134778   894    GAYDSSTGVITLTGSATLSQYQA    916

//