hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            116057063.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|116057063|emb|CAL51490.1|
Accession:      [none]
Description:    COG0457: FOG: TPR repeat (ISS) [Ostreococcus tauri]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
TPR_2           Tetratricopeptide repeat                123.9    5.2e-34   8
TPR_1           Tetratricopeptide repeat                105.6    5.7e-29   7
GCC2_GCC3       GCC2 and GCC3                            80.0    2.9e-23   6
NCD3G           Nine Cysteines Domain of family 3 GPC    44.1    1.1e-13   6
TNFR_c6         TNFR/NGFR cysteine-rich region           26.2    7.5e-07   6
TPR_4           Tetratricopeptide repeat                 14.3     0.0077   6
Siva            Cd27 binding protein (Siva)               5.1      0.074   1
NifQ            NifQ                                      6.0        0.2   1
IGFBP           Insulin-like growth factor binding pr     4.3        1.2   1
Hydrophobin_2   Fungal hydrophobin                        5.1        1.2   1
CRAM_rpt        Cysteine-rich, acidic integral membra     2.9        1.4   1
DUF1897         Domain of unknown function (DUF1897)      4.8        1.6   1
Coatomer_E      Coatomer epsilon subunit                  2.4        1.7   1
POTRA_1         POTRA domain, FtsQ-type                   4.3        1.8   1
MAP65_ASE1      Microtubule associated protein (MAP65     1.5        1.9   1
DUF1711         Fungal protein of unknown function (D     2.2        1.9   1
Phage_GPD       Phage late control gene D protein (GP     2.2        2.2   1
XPA_C           XPA protein C-terminus                    3.3        2.2   1
ThiS            ThiS family                               1.5        2.4   1
2HCT            2-hydroxycarboxylate transporter fami     1.0        2.7   1
TIM-br_sig_trns TIM-barrel signal transduction protei     2.1        3.4   1
RinB            Transcriptional activator RinB            2.9        3.4   1
Hormone_5       Neurohypophysial hormones, C-terminal     3.0        3.9   1
DUF2396         Protein of unknown function (DUF2396)     1.0        3.9   1
Myco_19_kDa     Mycobacterium 19 kDa lipoprotein anti     1.6        4.1   1
META            META domain                               3.3        4.2   1
Cu-oxidase_2    Multicopper oxidase                       1.8        4.3   1
PTS_IIA         PTS system, Lactose/Cellobiose specif     2.2        4.3   1
TmoB            Toluene-4-monooxygenase system protei     1.8        4.4   1
Furin-like      Furin-like cysteine rich region           0.4        4.5   1
PAP2            PAP2 superfamily                          2.1        4.6   1
FabA            FabA-like domain                          2.4        4.7   1
EndIII_4Fe-2S   Iron-sulfur binding domain of endonuc     4.0        4.7   1
C6              C6 domain                                 2.1        4.8   1
Extensin_2      Extensin-like region                      0.3        4.8   1
DUF1480         Protein of unknown function (DUF1480)     1.1        4.8   1
DUF914          Eukaryotic protein of unknown functio     0.2          5   1
Cellulase       Cellulase (glycosyl hydrolase family      0.1          5   1
MCC-bdg_PDZ     PDZ domain of MCC-2 bdg protein for U     3.0        5.1   1
Herpes_alk_exo  Herpesvirus alkaline exonuclease          0.4        5.1   1
SSXT            SSXT protein (N-terminal region)          1.8        5.6   1
DUF1359         Protein of unknown function (DUF1359)     1.9        5.6   1
dCMP_cyt_deam_2 Cytidine and deoxycytidylate deaminas     1.3        5.7   1
Sel1            Sel1 repeat                               2.7        6.2   1
Glug            The GLUG motif                            2.6        6.4   1
Dickkopf_N      Dickkopf N-terminal cysteine-rich reg     1.9        6.5   1
CysG_dimeriser  Sirohaem synthase dimerisation region     2.6        6.6   1
BPL_C           Biotin protein ligase C terminal doma     2.8        6.8   1
UAF_Rrn10       UAF complex subunit Rrn10                 1.4        6.8   1
Xol-1_N         Switch protein XOL-1, N-terminal          0.4          7   1
Fer2_2          [2Fe-2S] binding domain                   1.1        7.1   1
BTAD            Bacterial transcriptional activator d     1.4        7.8   1
OKR_DC_1        Orn/Lys/Arg decarboxylase, major doma    -0.9        7.8   1
DUF1998         Domain of unknown function (DUF1998)      0.6        7.8   1
HMG-CoA_red     Hydroxymethylglutaryl-coenzyme A redu    -2.3        8.1   1
Chlam_OMP3      Chlamydia cysteine-rich outer membran     0.1          9   1
Peptidase_S31   Pestivirus NS3 polyprotein peptidase     -1.1        9.2   1
DUF309          Domain of unknown function (DUF309)       2.2        9.5   1
GIIM            Group II intron, maturase-specific do     1.6        9.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
BPL_C             1/1       8    21 ..    37    50 .]     2.8      6.8
TNFR_c6           1/6      13    32 ..     1    27 [.     2.9      6.2
GCC2_GCC3         1/6      16    34 ..     1    19 [.     6.2     0.55
TNFR_c6           2/6      46    63 ..     1    19 [.     2.2       10
Furin-like        1/1      66    82 ..     1    17 [.     0.4      4.5
NCD3G             1/6      79    99 ..    31    52 ..     2.1      5.4
TNFR_c6           3/6      80    99 ..     1    27 [.     5.0      1.5
GCC2_GCC3         2/6      83   107 ..     1    25 [.    11.3    0.016
CRAM_rpt          1/1     102   115 ..    11    24 .]     2.9      1.4
TNFR_c6           4/6     114   130 ..     1    19 [.     4.4      2.2
GCC2_GCC3         3/6     117   167 ..     1    50 []    27.9  1.5e-07
NCD3G             2/6     126   156 ..    28    55 .]     8.7    0.037
Chlam_OMP3        1/1     144   167 ..    23    46 ..     0.1        9
Hydrophobin_2     1/1     149   157 ..     1     9 [.     5.1      1.2
Fer2_2            1/1     157   168 ..     1    12 [.     1.1      7.1
EndIII_4Fe-2S     1/1     166   176 ..     7    17 .]     4.0      4.7
Cu-oxidase_2      1/1     223   286 ..     1    59 [.     1.8      4.3
MCC-bdg_PDZ       1/1     242   255 ..     1    15 [.     3.0      5.1
FabA              1/1     260   276 ..   124   142 .]     2.4      4.7
ThiS              1/1     295   303 ..    83    91 .]     1.5      2.4
NCD3G             3/6     338   365 ..    30    55 .]     6.9     0.14
Dickkopf_N        1/1     339   359 ..     7    28 ..     1.9      6.5
TNFR_c6           5/6     340   356 ..    22    42 .]     2.5      8.1
GCC2_GCC3         4/6     343   393 ..     1    50 []    16.4  0.00045
Siva              1/1     356   381 ..   150   175 .]     5.1    0.074
TNFR_c6           6/6     359   376 ..     1    19 [.     9.3    0.077
NCD3G             4/6     372   399 ..    28    55 .]     5.8     0.34
GCC2_GCC3         5/6     396   427 ..     1    31 [.    15.5  0.00086
NCD3G             5/6     406   433 ..    28    55 .]    16.7  9.7e-05
C6                1/1     407   420 ..     1    14 [.     2.1      4.8
NifQ              1/1     422   437 ..   163   176 .]     6.0      0.2
GCC2_GCC3         6/6     430   448 ..    17    37 ..     2.6      6.6
NCD3G             6/6     437   450 ..    42    55 .]     3.9      1.4
IGFBP             1/1     441   466 ..     1    35 [.     4.3      1.2
Cellulase         1/1     451   475 ..   323   347 ..     0.1        5
Extensin_2        1/1     483   493 ..    50    60 .]     0.3      4.8
2HCT              1/1     508   521 ..     1    14 [.     1.0      2.7
DUF309            1/1     553   565 ..     1    13 [.     2.2      9.5
DUF1897           1/1     563   580 ..    20    38 .]     4.8      1.6
Phage_GPD         1/1     572   595 ..   124   150 ..     2.2      2.2
TPR_1             1/7     585   618 ..     1    34 []     1.5       25
TPR_2             1/8     585   618 ..     1    34 []     9.2     0.18
TPR_4             1/6     585   610 ..     1    26 []     2.7       14
TPR_4             2/6     618   642 ..     1    25 [.     0.8       46
TPR_1             2/7     624   651 ..     7    34 .]    13.7   0.0082
TPR_2             2/8     624   649 ..     7    32 ..    12.4    0.023
TPR_1             3/7     652   685 ..     1    34 []    23.4  1.4e-05
TPR_2             3/8     652   685 ..     1    34 []    27.0  1.9e-06
Coatomer_E        1/1     661   692 ..   214   245 ..     2.4      1.7
CysG_dimeriser    1/1     665   684 ..    45    64 .]     2.6      6.6
UAF_Rrn10         1/1     679   692 ..     1    14 [.     1.4      6.8
TPR_1             4/7     686   719 ..     1    34 []     9.6     0.13
TPR_2             4/8     686   719 ..     1    34 []    14.8   0.0051
TPR_4             3/6     686   711 ..     1    26 []     0.6       55
HMG-CoA_red       1/1     707   721 ..    12    26 ..    -2.3      8.1
TPR_1             5/7     720   753 ..     1    34 []    23.4  1.5e-05
TPR_2             5/8     720   753 ..     1    34 []    25.0  6.9e-06
TPR_4             4/6     720   745 ..     1    26 []     0.3       65
TPR_1             6/7     754   787 ..     1    34 []    14.1   0.0066
TPR_2             6/8     754   787 ..     1    34 []    15.8   0.0026
TPR_4             5/6     754   771 ..     1    18 [.     1.5       30
TPR_2             7/8     788   821 ..     1    34 []     0.3       58
OKR_DC_1          1/1     812   828 ..   177   193 ..    -0.9      7.8
Sel1              1/1     822   848 ..     1    44 [.     2.7      6.2
TPR_1             7/7     822   855 ..     1    34 []    19.9  0.00014
TPR_2             8/8     822   855 ..     1    34 []    19.4  0.00025
TPR_4             6/6     822   847 ..     1    26 []     8.4     0.34
SSXT              1/1     833   846 ..    41    54 ..     1.8      5.6
BTAD              1/1     836   851 ..   112   127 ..     1.4      7.8
RinB              1/1     876   900 ..    33    57 .]     2.9      3.4
DUF1998           1/1     888   904 ..     1    17 [.     0.6      7.8
MAP65_ASE1        1/1     911   927 ..   714   730 .]     1.5      1.9
XPA_C             1/1     937   948 ..     1    12 [.     3.3      2.2
Hormone_5         1/1     966   974 ..    71    79 .]     3.0      3.9
PTS_IIA           1/1     989  1006 ..    34    51 ..     2.2      4.3
DUF914            1/1    1081  1098 ..   321   338 .]     0.2        5
Xol-1_N           1/1    1082  1099 ..   147   164 .]     0.4        7
Myco_19_kDa       1/1    1086  1094 ..   157   165 .]     1.6      4.1
DUF2396           1/1    1087  1116 ..     1    32 [.     1.0      3.9
META              1/1    1094  1114 ..    85   105 .]     3.3      4.2
PAP2              1/1    1110  1143 ..     1    32 [.     2.1      4.6
Peptidase_S31     1/1    1117  1139 ..   147   166 ..    -1.1      9.2
Herpes_alk_exo    1/1    1123  1145 ..   557   580 .]     0.4      5.1
dCMP_cyt_deam_2   1/1    1163  1178 ..   127   142 .]     1.3      5.7
DUF1359           1/1    1255  1266 ..    93   104 .]     1.9      5.6
POTRA_1           1/1    1278  1287 ..    65    74 .]     4.3      1.8
TIM-br_sig_trns   1/1    1300  1317 ..     1    18 [.     2.1      3.4
GIIM              1/1    1303  1314 ..     1    13 [.     1.6      9.9
DUF1480           1/1    1339  1355 ..    12    29 ..     1.1      4.8
DUF1711           1/1    1355  1380 ..   268   292 .]     2.2      1.9
Glug              1/1    1358  1375 ..    19    38 .]     2.6      6.4
TmoB              1/1    1416  1429 ..     1    15 [.     1.8      4.4

Alignments of top-scoring domains:
BPL_C: domain 1 of 1, from 8 to 21: score 2.8, E = 6.8
                CS    TSEEEE-SSS-EEE
                   *->dgiriiisGdislr<-*
                      ++ir++isG++s++
  gi|1160570     8    SSIRDCISGTFSVG    21

TNFR_c6: domain 1 of 6, from 13 to 32: score 2.9, E = 6.2
                CS    CCTTTEEEE TSSSSSEEEEESBTTGGT
                   *->CeegvtYtd.enhvpqClsCskCepemG<-*
                      C  g t++ + ++ +    C++C+p  G
  gi|1160570    13    CISG-TFSVgNAT-S----CTECSP--G    32

GCC2_GCC3: domain 1 of 6, from 16 to 34: score 6.2, E = 0.55
                   *->GtysnsglktCepCprGtY<-*
                      Gt+s ++   C+ C  G Y
  gi|1160570    16    GTFSVGNATSCTECSPGRY    34

TNFR_c6: domain 2 of 6, from 46 to 63: score 2.2, E = 10
                CS    CCTTTEEEE TSSSSSEEEE
                   *->CeegvtYtd.enhvpqClsC<-*
                      C+ g +Y+ + +  + C++C
  gi|1160570    46    CALG-FYSYgGAV-SACTRC    63

Furin-like: domain 1 of 1, from 66 to 82: score 0.4, E = 4.5
                   *->nkeCgdvCpgtmekchs<-*
                      +keC+dv   + ++c++
  gi|1160570    66    GKECPDVTGSRNADCDP    82

NCD3G: domain 1 of 6, from 79 to 99: score 2.1, E = 5.4
                   *->pCpegeisnttDsttCtpCpeg<-*
                      +C++g++s   + ttCt Cp+g
  gi|1160570    79    DCDPGTFSA-GGQTTCTFCPPG    99

TNFR_c6: domain 3 of 6, from 80 to 99: score 5.0, E = 1.5
                CS    CCTTTEEEETSSSSSEEEEESBTTGGT
                   *->CeegvtYtdenhvpqClsCskCepemG<-*
                      C++g t+++ ++  +C   + C+p  G
  gi|1160570    80    CDPG-TFSAGGQ-TTC---TFCPP--G    99

GCC2_GCC3: domain 2 of 6, from 83 to 107: score 11.3, E = 0.016
                   *->GtysnsglktCepCprGtYqpeegq<-*
                      Gt+s +g+ tC+ Cp G + +e ++
  gi|1160570    83    GTFSAGGQTTCTFCPPGRFCNETDS    107

CRAM_rpt: domain 1 of 1, from 102 to 115: score 2.9, E = 1.4
                   *->CnEtDDCditGDCn<-*
                      CnEtD      DC
  gi|1160570   102    CNETDSAAAQYDCA    115

TNFR_c6: domain 4 of 6, from 114 to 130: score 4.4, E = 2.2
                CS    CCTTTEEEE TSSSSSEEEE
                   *->CeegvtYtd.enhvpqClsC<-*
                      C+ g tY++++    +C++C
  gi|1160570   114    CAAG-TYSEgKQ--ITCTPC    130

GCC2_GCC3: domain 3 of 6, from 117 to 167: score 27.9, E = 1.5e-07
                   *->GtysnsglktCepCprGtYqpeegqd...sCipCPpgknttTkstGa
                      Gtys + + tC+pC  Gt+   +  ++++ C+pCP+g  ++   +Ga
  gi|1160570   117    GTYSEGKQITCTPCAAGTFGIIIAAVtpsDCNPCPSG--MYSTVEGA 161

                   tsesdC<-*
                   +s + C
  gi|1160570   162 SSDDAC    167

NCD3G: domain 2 of 6, from 126 to 156: score 8.7, E = 0.037
                   *->dCipCpege....isnttDsttCtpCpegqWs<-*
                      +C+pC++g+ +  i   t s  C pCp g++s
  gi|1160570   126    TCTPCAAGTfgiiIAAVTPS-DCNPCPSGMYS    156

Chlam_OMP3: domain 1 of 1, from 144 to 167: score 0.1, E = 9
                   *->PksCnPCesikKKdvdkgCssnaC<-*
                      P++CnPC s     v+++ s +aC
  gi|1160570   144    PSDCNPCPSGMYSTVEGASSDDAC    167

Hydrophobin_2: domain 1 of 1, from 149 to 157: score 5.1, E = 1.2
                CS    -S-SSTT-E
                   *->vCPsGLYSn<-*
                      +CPsG YS+
  gi|1160570   149    PCPSGMYST    157

Fer2_2: domain 1 of 1, from 157 to 168: score 1.1, E = 7.1
                CS    -HHHCSBTTC--
                   *->TiEGLaedgeLh<-*
                      T+EG ++d++ h
  gi|1160570   157    TVEGASSDDACH    168

EndIII_4Fe-2S: domain 1 of 1, from 166 to 176: score 4.0, E = 4.7
                CS    -GGG-TTTTT-
                   *->kCeeCpladlC<-*
                      +C+ Cp+   C
  gi|1160570   166    ACHLCPVDTEC    176

Cu-oxidase_2: domain 1 of 1, from 223 to 286: score 1.8, E = 4.3
                CS    B-S-SCGHCHHHEE E EEEEEE E-TTTTCCEEETTB-TCCTT-C
                   *->dtppkvptllqitg.m.rydwsi.gneatsigingqdndmnrpdnn.
                      ++p ++p+  ++  +    +  ++ +e+ts++   +      ++n++
  gi|1160570   223    PPPAPPPLNETVSApKiSLRLQGnIEEWTSANESAFQIGIASALNDg 269

                CS GCT CCEEEEEECTSCC
                   ppl.gtnvitlpngdrv<-*
                    +  ++++i ++ g+++
  gi|1160570   270 TVAaDVEIISVKSGSVI    286

MCC-bdg_PDZ: domain 1 of 1, from 242 to 255: score 3.0, E = 5.1
                   *->ekLkgriEeLksfnr<-*
                       +L+g+iEe  s+n+
  gi|1160570   242    -RLQGNIEEWTSANE    255

FabA: domain 1 of 1, from 260 to 276: score 2.4, E = 4.7
                   *->igiadgralVDGklvyeAe<-*
                      igia   al DG +++++e
  gi|1160570   260    IGIAS--ALNDGTVAADVE    276

ThiS: domain 1 of 1, from 295 to 303: score 1.5, E = 2.4
                CS    EEEEE----
                   *->aiiPpVgGG<-*
                      a +Pp+ GG
  gi|1160570   295    AMLPPMYGG    303

NCD3G: domain 3 of 6, from 338 to 365: score 6.9, E = 0.14
                   *->ipCpegeisntt.Dst.tCtpCpegqWs<-*
                      ++C++g+++ ++++s + C+ C +g +s
  gi|1160570   338    VDCAPGSYVFSSsGSNrVCKLCSLGKYS    365

Dickkopf_N: domain 1 of 1, from 339 to 359: score 1.9, E = 6.5
                   *->DCgtdeYChssrqgkslvClpC<-*
                      DC+++ Y +ss++ +  vC  C
  gi|1160570   339    DCAPGSYVFSSSGSNR-VCKLC    359

TNFR_c6: domain 5 of 6, from 340 to 356: score 2.5, E = 8.1
                CS    BTTGGTEEEEE-SBTTB--EE
                   *->CepemGqvlvspCtatqnTvC<-*
                      C p  G+++ s   + +n+vC
  gi|1160570   340    CAP--GSYVFS--SSGSNRVC    356

GCC2_GCC3: domain 4 of 6, from 343 to 393: score 16.4, E = 0.00045
                   *->Gtysnsgl...ktCepCprGtYqpeegqdsCipCPpgknttTkstGa
                      G y  s+++++  C +C  G Y +  +   C +C +g  t T ++G+
  gi|1160570   343    GSYVFSSSgsnRVCKLCSLGKYSSVTNAPQCTSCAGG--TATPYQGS 387

                   tsesdC<-*
                   ++   C
  gi|1160570   388 SACANC    393

Siva: domain 1 of 1, from 356 to 381: score 5.1, E = 0.074
                   *->CvLCGLvDyaDdyEKvLCtsCAmFEa<-*
                      C LC L  y+       CtsCA   a
  gi|1160570   356    CKLCSLGKYSSVTNAPQCTSCAGGTA    381

TNFR_c6: domain 6 of 6, from 359 to 376: score 9.3, E = 0.077
                CS    CCTTTEEEE TSSSSSEEEE
                   *->CeegvtYtd.enhvpqClsC<-*
                      C+ g  Y++ +n  pqC+sC
  gi|1160570   359    CSLG-KYSSvTNA-PQCTSC    376

NCD3G: domain 4 of 6, from 372 to 399: score 5.8, E = 0.34
                   *->dCipCpegeisnttDsttCtpCpegqWs<-*
                      +C+ C++g+     +s  C  C +g  +
  gi|1160570   372    QCTSCAGGTATPYQGSSACANCAPGTVA    399

GCC2_GCC3: domain 5 of 6, from 396 to 427: score 15.5, E = 0.00086
                   *->Gtysnsgl.ktCepCprGtYqpeegqdsCipC<-*
                      Gt  ++ ++++C++CprGt qp +g  sC  C
  gi|1160570   396    GTVAPNPGsSECSLCPRGTIQPASGEMSCTQC    427

NCD3G: domain 5 of 6, from 406 to 433: score 16.7, E = 9.7e-05
                   *->dCipCpegeisnttDsttCtpCpegqWs<-*
                      +C  Cp g+i+  +++ +Ct C + + +
  gi|1160570   406    ECSLCPRGTIQPASGEMSCTQCQDNYFA    433

C6: domain 1 of 1, from 407 to 420: score 2.1, E = 4.8
                   *->CtsCtnlpitsvsg<-*
                      C+ C++++i+  sg
  gi|1160570   407    CSLCPRGTIQPASG    420

NifQ: domain 1 of 1, from 422 to 437: score 6.0, E = 0.2
                   *->PSCdeCdE..feaCFG<-*
                      +SC++C ++ f+++FG
  gi|1160570   422    MSCTQCQDnyFASAFG    437

GCC2_GCC3: domain 6 of 6, from 430 to 448: score 2.6, E = 6.6
                   *->GtYqpeegqdsCipCPpgknt<-*
                      +++ +  g+ sC pCP+g  +
  gi|1160570   430    NYFASAFGSISCAPCPAG--F    448

NCD3G: domain 6 of 6, from 437 to 450: score 3.9, E = 1.4
                   *->DsttCtpCpegqWs<-*
                      +s++C pCp g+ s
  gi|1160570   437    GSISCAPCPAGFVS    450

IGFBP: domain 1 of 1, from 441 to 466: score 4.3, E = 1.2
                CS    XX.....XXXXXXXXXXXXXX....XXXXXXXXXX
                   *->CprPCGGpCpaerlarCpPgPaPpaecaelvredG<-*
                      C+     pCpa+ +++ p+     +++ ++ r+dG
  gi|1160570   441    CA-----PCPAGFVSGAPA----WVGETAGMRADG    466

Cellulase: domain 1 of 1, from 451 to 475: score 0.1, E = 5
                CS    TSEEEEEEEESSBTTTBSHHHHHHH
                   *->GipvfiGEfGgsnasgnggvdvkwa<-*
                      G+p+++GE++g+ a+g   v v++a
  gi|1160570   451    GAPAWVGETAGMRADGVLSVEVQEA    475

Extensin_2: domain 1 of 1, from 483 to 493: score 0.3, E = 4.8
                   *->PpyvYksPPPP<-*
                      P  +Y  PPPP
  gi|1160570   483    PDGTYDLPPPP    493

2HCT: domain 1 of 1, from 508 to 521: score 1.0, E = 2.7
                   *->kIggIpLPlYAfla<-*
                       +ggI+L +Y++++
  gi|1160570   508    TVGGISLSVYTLFL    521

DUF309: domain 1 of 1, from 553 to 565: score 2.2, E = 9.5
                CS    --HHHHHHHHHTT
                   *->ealreaveLFnag<-*
                      e lr+a+++F++g
  gi|1160570   553    EDLRFAIDCFRRG    565

DUF1897: domain 1 of 1, from 563 to 580: score 4.8, E = 1.6
                   *->rqiGahdeAeaiekqikak<-*
                      r+ Ga d Aea+ ++i+++
  gi|1160570   563    RR-GAVDDAEAVCSRIAER    580

Phage_GPD: domain 1 of 1, from 572 to 595: score 2.2, E = 2.2
                   *->avlstIAarhgLtpavapaLagvkIdh<-*
                      av+s+IA r+ L    a+aL+g+ I++
  gi|1160570   572    AVCSRIAERNHLS---ADALQGLGIAR    595

TPR_1: domain 1 of 7, from 585 to 618: score 1.5, E = 25
                CS    HHHHHHHHHHHHHTTHHHHHHHHHHHHHHHSTTH
                   *->aeayynlGnaylklgkydeAieayekALeldPnn<-*
                      a+a+  lG a    g+++ A ++  + + +  +
  gi|1160570   585    ADALQGLGIARACAGDLEYAHAFAHRSVNIASTS    618

TPR_2: domain 1 of 8, from 585 to 618: score 9.2, E = 0.18
                CS    HHHHHHHHHHHHHTT-HHHHHHHHHHHHHH-TT-
                   *->aealynlGlayyklgdyeeAleayekAleldPnn<-*
                      a+al  lG a + +gd+e A+++  +++ ++ +
  gi|1160570   585    ADALQGLGIARACAGDLEYAHAFAHRSVNIASTS    618

TPR_4: domain 1 of 6, from 585 to 610: score 2.7, E = 14
                   *->arallaLArallalGdlaeArallrr<-*
                      a al +L+ a + +Gdl+ A a ++r
  gi|1160570   585    ADALQGLGIARACAGDLEYAHAFAHR    610

TPR_4: domain 2 of 6, from 618 to 642: score 0.8, E = 46
                   *->arallaLArallalGdlaeArallr<-*
                       + ++ LA  +l +G+ + A al++
  gi|1160570   618    SQRQITLANIYLSQGHTEKAIALFD    642

TPR_1: domain 2 of 7, from 624 to 651: score 13.7, E = 0.0082
                CS    HHHHHHHTTHHHHHHHHHHHHHHHSTTH
                   *->lGnaylklgkydeAieayekALeldPnn<-*
                      l+n+yl++g  ++Ai+ ++ A++ dP
  gi|1160570   624    LANIYLSQGHTEKAIALFDIAIRRDPVS    651

TPR_2: domain 2 of 8, from 624 to 649: score 12.4, E = 0.023
                CS    HHHHHHHTT-HHHHHHHHHHHHHH-T
                   *->lGlayyklgdyeeAleayekAleldP<-*
                      l+++y+ +g+ e+A+++++ A++ dP
  gi|1160570   624    LANIYLSQGHTEKAIALFDIAIRRDP    649

TPR_1: domain 3 of 7, from 652 to 685: score 23.4, E = 1.4e-05
                CS    HHHHHHHHHHHHHTTHHHHHHHHHHHHHHHSTTH
                   *->aeayynlGnaylklgkydeAieayekALeldPnn<-*
                      a  ++n+Gna++  g++  A   y  AL+ +P++
  gi|1160570   652    AIGHFNIGNAHFMSGDWASARTSYLAALDREPHY    685

TPR_2: domain 3 of 8, from 652 to 685: score 27.0, E = 1.9e-06
                CS    HHHHHHHHHHHHHTT-HHHHHHHHHHHHHH-TT-
                   *->aealynlGlayyklgdyeeAleayekAleldPnn<-*
                      a +++n+G+a++  gd++ A+  y +Al+ +P +
  gi|1160570   652    AIGHFNIGNAHFMSGDWASARTSYLAALDREPHY    685

Coatomer_E: domain 1 of 1, from 661 to 692: score 2.4, E = 1.7
                   *->chmllgryeEAeslLkeALdkdakdpEtLiNl<-*
                      +h   g+++ A ++ + ALd+ + ++ +L Nl
  gi|1160570   661    AHFMSGDWASARTSYLAALDREPHYYKALYNL    692

CysG_dimeriser: domain 1 of 1, from 665 to 684: score 2.6, E = 6.6
                   *->aGdeeeAealleqaLagaaa<-*
                      +Gd++ A++   +aL+ ++
  gi|1160570   665    SGDWASARTSYLAALDREPH    684

UAF_Rrn10: domain 1 of 1, from 679 to 692: score 1.4, E = 6.8
                   *->MdRNPPvrealyNl<-*
                      +dR P  + alyNl
  gi|1160570   679    LDREPHYYKALYNL    692

TPR_1: domain 4 of 7, from 686 to 719: score 9.6, E = 0.13
                CS    HHHHHHHHHHHHHTTHHHHHHHHHHHHHHHSTTH
                   *->aeayynlGnaylklgkydeAieayekALeldPnn<-*
                      ++a+ynl++++   g   eA +  ++A+e+++++
  gi|1160570   686    YKALYNLAMLLDVTGFIAEAKDTMKRAVEIRRSD    719

TPR_2: domain 4 of 8, from 686 to 719: score 14.8, E = 0.0051
                CS    HHHHHHHHHHHHHTT-HHHHHHHHHHHHHH-TT-
                   *->aealynlGlayyklgdyeeAleayekAleldPnn<-*
                       +alynl++++   g  +eA++ +++A+e+   +
  gi|1160570   686    YKALYNLAMLLDVTGFIAEAKDTMKRAVEIRRSD    719

TPR_4: domain 3 of 6, from 686 to 711: score 0.6, E = 55
                   *->arallaLArallalGdlaeArallrr<-*
                        al++LA +l   G  aeA +++ r
  gi|1160570   686    YKALYNLAMLLDVTGFIAEAKDTMKR    711

HMG-CoA_red: domain 1 of 1, from 707 to 721: score -2.3, E = 8.1
                   *->gDpeRAVeiRReils<-*
                      ++ +RAVeiRR +++
  gi|1160570   707    DTMKRAVEIRRSDVR    721

TPR_1: domain 5 of 7, from 720 to 753: score 23.4, E = 1.5e-05
                CS    HHHHHHHHHHHHHTTHHHHHHHHHHHHHHHSTTH
                   *->aeayynlGnaylklgkydeAieayekALeldPnn<-*
                      ++  y +G++y klg++++A+e ++ AL +d ++
  gi|1160570   720    VRGVYAMGLLYVKLGQWKKAEEQFKNALLIDDKH    753

TPR_2: domain 5 of 8, from 720 to 753: score 25.0, E = 6.9e-06
                CS    HHHHHHHHHHHHHTT-HHHHHHHHHHHHHH-TT-
                   *->aealynlGlayyklgdyeeAleayekAleldPnn<-*
                      +++ y++Gl+y klg++++A+e ++ Al +d ++
  gi|1160570   720    VRGVYAMGLLYVKLGQWKKAEEQFKNALLIDDKH    753

TPR_4: domain 4 of 6, from 720 to 745: score 0.3, E = 65
                   *->arallaLArallalGdlaeArallrr<-*
                      +r  +a++ ++  lG++  A++ +
  gi|1160570   720    VRGVYAMGLLYVKLGQWKKAEEQFKN    745

TPR_1: domain 6 of 7, from 754 to 787: score 14.1, E = 0.0066
                CS    HHHHHHHHHHHHHTTHHHHHHHHHHHHHHHSTTH
                   *->aeayynlGnaylklgkydeAieayekALeldPnn<-*
                      a  +  lGn+ +++g+++ A + y  ALe d +n
  gi|1160570   754    AMSHVKLGNLAFRRGEFEFAGALYLNALESDSTN    787

TPR_2: domain 6 of 8, from 754 to 787: score 15.8, E = 0.0026
                CS    HHHHHHHHHHHHHTT-HHHHHHHHHHHHHH-TT-
                   *->aealynlGlayyklgdyeeAleayekAleldPnn<-*
                      a  +  lG++++++g++e A ++y  Ale d +n
  gi|1160570   754    AMSHVKLGNLAFRRGEFEFAGALYLNALESDSTN    787

TPR_4: domain 5 of 6, from 754 to 771: score 1.5, E = 30
                   *->arallaLArallalGdla<-*
                      a +++ L+ +++++G+++
  gi|1160570   754    AMSHVKLGNLAFRRGEFE    771

TPR_2: domain 7 of 8, from 788 to 821: score 0.3, E = 58
                CS    HHHHHHHHHHHHHTT-HHHHHHHHHHHHHH-TT-
                   *->aealynlGlayyklgdyeeAleayekAleldPnn<-*
                      +eal n++++ + +g        ++ A+ ++P++
  gi|1160570   788    VEALTNIAMLDWCKGLSNASNSQLRLAITINPTY    821

OKR_DC_1: domain 1 of 1, from 812 to 828: score -0.9, E = 7.8
                CS    EEEEESB-TTSEEE-HH
                   *->rLaVitNgTYDGviYNa<-*
                      rLa+ +N+TY+  +YN+
  gi|1160570   812    RLAITINPTYYPALYNL    828

Sel1: domain 1 of 1, from 822 to 848: score 2.7, E = 6.2
                CS    H HHHHHHH.HHH...HT-....S.S--...-.HHH.HHHHHHHH
                   *->a.AqynLGrmlyylylnGlgggeGvvpkdrtdDyekeAlkwyekA<-
                       +A+ynL++     + +G+      v     d   +  l++y++A
  gi|1160570   822    YpALYNLAV---TRLSQGR------V-----D---E-CLRYYQRA   848

                CS
                   *

  gi|1160570     -   -

TPR_1: domain 7 of 7, from 822 to 855: score 19.9, E = 0.00014
                CS    HHHHHHHHHHHHHTTHHHHHHHHHHHHHHHSTTH
                   *->aeayynlGnaylklgkydeAieayekALeldPnn<-*
                      + a+ynl+++ l++g+ de + +y++A +   +
  gi|1160570   822    YPALYNLAVTRLSQGRVDECLRYYQRAKACCGDS    855

TPR_2: domain 8 of 8, from 822 to 855: score 19.4, E = 0.00025
                CS    HHHHHHHHHHHHHTT-HHHHHHHHHHHHHH-TT-
                   *->aealynlGlayyklgdyeeAleayekAleldPnn<-*
                        alynl++  + +g+ +e l++y++A +   +
  gi|1160570   822    YPALYNLAVTRLSQGRVDECLRYYQRAKACCGDS    855

TPR_4: domain 6 of 6, from 822 to 847: score 8.4, E = 0.34
                   *->arallaLArallalGdlaeArallrr<-*
                        al++LA   l +G+ +e+++  +r
  gi|1160570   822    YPALYNLAVTRLSQGRVDECLRYYQR    847

SSXT: domain 1 of 1, from 833 to 846: score 1.8, E = 5.6
                   *->qnkGrAdECiqYQq<-*
                      +++Gr dEC +Y q
  gi|1160570   833    LSQGRVDECLRYYQ    846

BTAD: domain 1 of 1, from 836 to 851: score 1.4, E = 7.8
                CS    T-HHHHHHHHHHHHHH
                   *->GrraeALrvYrrlrrr<-*
                      Gr +e+Lr+Y+r + +
  gi|1160570   836    GRVDECLRYYQRAKAC    851

RinB: domain 1 of 1, from 876 to 900: score 2.9, E = 3.4
                   *->DDvEaPsDfeklsdqsdllRAEvse<-*
                      DD E+P +f   + + +l++  vs+
  gi|1160570   876    DDEEVPMEFTTTAAEHQLMKIAVSK    900

DUF1998: domain 1 of 1, from 888 to 904: score 0.6, E = 7.8
                   *->aleHALisllplflgcd<-*
                      a+eH L++++ + ++ d
  gi|1160570   888    AAEHQLMKIAVSKIQTD    904

MAP65_ASE1: domain 1 of 1, from 911 to 927: score 1.5, E = 1.9
                   *->plsppkeseatspalns<-*
                      p++++k+s+ ++p l++
  gi|1160570   911    PATSVKMSVKSTPTLSA    927

XPA_C: domain 1 of 1, from 937 to 948: score 3.3, E = 2.2
                   *->dkykLltrTEaK<-*
                      +   LltrTE+K
  gi|1160570   937    EGDVLLTRTECK    948

Hormone_5: domain 1 of 1, from 966 to 974: score 3.0, E = 3.9
                CS    S-EEE-TTT
                   *->esCvvDpaC<-*
                      esC++D+ C
  gi|1160570   966    ESCALDDTC    974

PTS_IIA: domain 1 of 1, from 989 to 1006: score 2.2, E = 4.3
                CS    HHHHHHHHHHHHHHHHHH
                   *->dalieeAekdlneAHeaQ<-*
                      + l+ +A++ l++AH +Q
  gi|1160570   989    RTLVSKAKEKLSDAHGLQ    1006

DUF914: domain 1 of 1, from 1081 to 1098: score 0.2, E = 5
                   *->vkpelkkgqgvdggdtee<-*
                      +k+e +++++v + dt e
  gi|1160570  1081    IKFEHSFECDVACSDTME    1098

Xol-1_N: domain 1 of 1, from 1082 to 1099: score 0.4, E = 7
                CS    HTT---TTHHHHHHHHHH
                   *->KFElqidCktaviDailS<-*
                      KFE+ ++C  a  D   S
  gi|1160570  1082    KFEHSFECDVACSDTMES    1099

Myco_19_kDa: domain 1 of 1, from 1086 to 1094: score 1.6, E = 4.1
                   *->sFEIeVTCr<-*
                      sFE +V C+
  gi|1160570  1086    SFECDVACS    1094

DUF2396: domain 1 of 1, from 1087 to 1116: score 1.0, E = 3.9
                   *->PifGpeiqCPHCrqtipALtLtDtYLCnRHGa<-*
                        f  ++ C      +   tLtD  L   HGa
  gi|1160570  1087    --FECDVACSDTMESVETFTLTDEQLKLTHGA    1116

META: domain 1 of 1, from 1094 to 1114: score 3.3, E = 4.2
                   *->lsaLsavtsysveggtLtLtn<-*
                      ++ + +v ++++++ +L Lt+
  gi|1160570  1094    SDTMESVETFTLTDEQLKLTH    1114

PAP2: domain 1 of 1, from 1110 to 1143: score 2.1, E = 4.6
                CS    CCHHHHHHHHHHHHHHHH H HHHHCC-B--..H
                   *->aalalllalvaslllngl.a.ylKllfgrpRApP<-*
                      + l +++a + s+ ln+ +a+ lK++   pRApP
  gi|1160570  1110    LKLTHGAASGTSASLNYFnAkALKDWASLPRAPP    1143

Peptidase_S31: domain 1 of 1, from 1117 to 1139: score -1.1, E = 9.2
                   *->AsGtPA...FFDlKnLKGwsglP<-*
                      AsGt A+ ++F  K LK w+ lP
  gi|1160570  1117    ASGTSAslnYFNAKALKDWASLP    1139

Herpes_alk_exo: domain 1 of 1, from 1123 to 1145: score 0.4, E = 5.1
                   *->alnaWeataketfdsrspWapsal<-*
                      +ln+++a+a + ++s  p+ap+
  gi|1160570  1123    SLNYFNAKALKDWASL-PRAPPKH    1145

dCMP_cyt_deam_2: domain 1 of 1, from 1163 to 1178: score 1.3, E = 5.7
                   *->EkadakvSqeatArtt<-*
                      E ++akvS +++A++t
  gi|1160570  1163    EYEKAKVSWRTAAKAT    1178

DUF1359: domain 1 of 1, from 1255 to 1266: score 1.9, E = 5.6
                   *->sELvkkLGIdvk<-*
                      +E + +LGId
  gi|1160570  1255    NEIAVELGIDAN    1266

POTRA_1: domain 1 of 1, from 1278 to 1287: score 4.3, E = 1.8
                   *->ntleIrvvEr<-*
                      +t+ +r++Er
  gi|1160570  1278    DTVTVRITER    1287

TIM-br_sig_trns: domain 1 of 1, from 1300 to 1317: score 2.1, E = 3.4
                   *->keileklrakiakgepIi<-*
                      + i++++++ki++g +Ii
  gi|1160570  1300    ETIVKNFQDKIKDGTFII    1317

GIIM: domain 1 of 1, from 1303 to 1314: score 1.6, E = 9.9
                   *->vkrfkqkirellt<-*
                      vk+f++ki++  t
  gi|1160570  1303    VKNFQDKIKD-GT    1314

DUF1480: domain 1 of 1, from 1339 to 1355: score 1.1, E = 4.8
                   *->evDDaeLHGESsGDDqRv<-*
                      +vDDa   G SsGDD Rv
  gi|1160570  1339    DVDDAAS-GISSGDDTRV    1355

DUF1711: domain 1 of 1, from 1355 to 1380: score 2.2, E = 1.9
                   *->vkeaenspgssT.APvsAseesatkv<-*
                      v ++en+p s T++ +sAs +s+  v
  gi|1160570  1355    VSHDENTPTSFThSFASASITSEFNV    1380

Glug: domain 1 of 1, from 1358 to 1375: score 2.6, E = 6.4
                   *->eqenpgsienctatgnvtvt<-*
                      ++ +p+s +++ a++  ++t
  gi|1160570  1358    DENTPTSFTHSFASA--SIT    1375

TmoB: domain 1 of 1, from 1416 to 1429: score 1.8, E = 4.4
                CS    --EEEEEEEETT-SB
                   *->MAlFPiisnFegDFV<-*
                       +l Pi+++   DFV
  gi|1160570  1416    -SLVPIMARQMHDFV    1429

//