hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            117923736.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|117923736|ref|YP_864353.1|
Accession:      [none]
Description:    cadherin [Magnetococcus sp. MC-1]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
Cadherin        Cadherin domain                          64.7    7.9e-18   4
He_PIG          Putative Ig domain                       29.1    1.8e-07   4
PKD             PKD domain                               21.2    5.6e-06   4
DAG1            Dystroglycan (Dystrophin-associated g     7.2       0.03   1
PGK             Phosphoglycerate kinase                   7.0      0.076   1
HYR             HYR domain                                5.8       0.41   1
Peptidase_C3    3C cysteine protease (picornain 3C)       3.4          1   1
Drmip_Hesp      Developmentally Regulated MAPK Intera     3.6        1.7   1
PepSY           Peptidase propeptide and YPEB domain      5.1        1.7   1
DUF2102         Uncharacterized protein conserved in      3.5        1.9   1
Cna_B           Cna protein B-type domain                 3.1        2.1   1
fn3             Fibronectin type III domain               3.6        2.7   1
DUF218          DUF218 domain                             3.0        2.9   1
UreD            UreD urease accessory protein             1.2        4.1   1
SoxZ            Sulphur oxidation protein SoxZ            2.2        4.1   1
CbiZ            Adenosylcobinamide amidohydrolase         2.2        4.4   1
TrbL            TrbL/VirB6 plasmid conjugal transfer      1.6        4.6   1
B3_4            B3/4 domain                               1.7        4.6   1
UPF0052         Uncharacterised protein family UPF005     0.9        5.1   1
Bro-N           BRO family, N-terminal domain             1.9        5.3   1
Fe-S_biosyn     Iron-sulphur cluster biosynthesis         2.2        6.1   1
DUF1278         Protein of unknown function (DUF1278)     1.5        6.6   1
Ssu72           Ssu72-like protein                       -0.3        6.6   1
DUF849          Prokaryotic protein of unknown functi     0.1        7.3   1
LEA_5           Small hydrophilic plant seed protein      0.8        7.4   1
Ham1p_like      Ham1 family                               0.6          8   1
STE             STE like transcription factor             0.3        8.2   1
DUF1802         Domain of unknown function (DUF1802)      0.8        8.4   1
DUF1860         Domain of unknown function (DUF1860)     -1.0        8.8   1
Peptidase_C25_C Peptidase family C25, C terminal ig-l     1.1        8.8   1
MpPF1           M penetrans paralogue family 1           -1.3        9.2   1
Phage_X         Phage X family                            1.1        9.5   1
PQQ             PQQ enzyme repeat                         2.2        9.7   1
Homoserine_dh   Homoserine dehydrogenase                  0.6        9.8   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
UPF0052           1/1      65   113 ..   333   381 .]     0.9      5.1
LEA_5             1/1      69    90 ..     1    22 [.     0.8      7.4
DUF2102           1/1     101   111 ..    94   104 .]     3.5      1.9
Ham1p_like        1/1     118   126 ..     1     9 [.     0.6        8
Homoserine_dh     1/1     170   182 ..   187   200 .]     0.6      9.8
B3_4              1/1     180   191 ..   173   184 .]     1.7      4.6
TrbL              1/1     181   208 ..   255   285 .]     1.6      4.6
Ssu72             1/1     326   334 ..     1     9 [.    -0.3      6.6
CbiZ              1/1     360   375 ..    91   106 ..     2.2      4.4
Bro-N             1/1     476   491 ..     1    18 [.     1.9      5.3
PQQ               1/1     530   567 ..     1    37 []     2.2      9.7
STE               1/1     600   624 ..     1    26 [.     0.3      8.2
Phage_X           1/1     682   692 ..    92   102 .]     1.1      9.5
PepSY             1/1     696   720 ..    45    68 .]     5.1      1.7
Cadherin          1/4     721   779 ..    40   105 ..     7.7     0.17
PGK               1/1     725   744 ..   298   318 ..     7.0    0.076
He_PIG            1/4     757   768 ..    50    61 .]     5.6     0.86
PKD               1/4     757   778 ..    70    92 .]     4.7     0.64
Cadherin          2/4     788   872 ..     1   107 []    25.4  1.4e-06
He_PIG            2/4     847   863 ..    44    61 .]     0.7       21
PKD               2/4     851   873 ..    69    92 .]     3.6      1.4
Cna_B             1/1     852   874 ..    49    77 .]     3.1      2.1
Cadherin          3/4     908   973 ..    31   107 .]     5.2     0.89
Peptidase_C3      1/1     936   959 ..     1    30 [.     3.4        1
Drmip_Hesp        1/1     941   954 ..     1    15 [.     3.6      1.7
MpPF1             1/1     947   958 ..   399   410 ..    -1.3      9.2
He_PIG            3/4     951   962 ..    50    61 .]     3.9      2.6
PKD               3/4     951   972 ..    70    92 .]    12.6   0.0024
SoxZ              1/1     952   972 ..    83   104 .]     2.2      4.1
Fe-S_biosyn       1/1     970   979 ..     1    10 [.     2.2      6.1
Cadherin          4/4    1003  1069 ..    27   107 .]    26.3  7.7e-07
PKD               4/4    1047  1068 ..    70    92 .]     0.2       16
fn3               1/1    1091  1109 ..     1    19 [.     3.6      2.7
DUF1802           1/1    1118  1144 ..   157   186 .]     0.8      8.4
Peptidase_C25_C   1/1    1140  1152 ..     7    19 ..     1.1      8.8
DUF1278           1/1    1147  1184 ..     1    42 [.     1.5      6.6
DUF1860           1/1    1202  1230 ..   194   220 .]    -1.0      8.8
DAG1              1/1    1205  1257 ..    44    98 ..     7.2     0.03
DUF218            1/1    1217  1238 ..     1    19 [.     3.0      2.9
He_PIG            4/4    1228  1270 ..     1    61 []    19.0  0.00013
HYR               1/1    1257  1279 ..    60    86 .]     5.8     0.41
UreD              1/1    1260  1275 ..   207   222 .]     1.2      4.1
DUF849            1/1    1272  1281 ..     1    10 [.     0.1      7.3

Alignments of top-scoring domains:
UPF0052: domain 1 of 1, from 65 to 113: score 0.9, E = 5.1
                   *->dvlvnvedvpseedlkkyeregsepvdidkeadeklglraieanlla
                      +vl+    v +  dl+ +++eg+++v+ d ++d    + + +a+ l
  gi|1179237    65    RVLLVASNVADGDDLAAAAQEGVVVVRYDAFNDSGAAILEKIAQALD 111

                   ee<-*
                   +
  gi|1179237   112 GR    113

LEA_5: domain 1 of 1, from 69 to 90: score 0.8, E = 7.4
                   *->mAsgqeereeLdrrAkqGetvv<-*
                      +As+ ++ ++L++ A++G  vv
  gi|1179237    69    VASNVADGDDLAAAAQEGVVVV    90

DUF2102: domain 1 of 1, from 101 to 111: score 3.5, E = 1.9
                   *->klLpkIsrALe<-*
                      ++L+kI+ AL+
  gi|1179237   101    AILEKIAQALD    111

Ham1p_like: domain 1 of 1, from 118 to 126: score 0.6, E = 8
                CS    EEEE-S-HH
                   *->lvfATgNpg<-*
                      + fAT+N+g
  gi|1179237   118    IAFATHNAG    126

Homoserine_dh: domain 1 of 1, from 170 to 182: score 0.6, E = 9.8
                CS    -HHHHHHHHHHHHH
                   *->GaepTAsaVvaDiv<-*
                      G e+ A++V++D +
  gi|1179237   170    GCEV-AGSVQGDML    182

B3_4: domain 1 of 1, from 180 to 191: score 1.7, E = 4.6
                CS    HHHHHHHHHHS-
                   *->drAaaLilelaG<-*
                      d++++Li+++aG
  gi|1179237   180    DMLVSLISDIAG    191

TrbL: domain 1 of 1, from 181 to 208: score 1.6, E = 4.6
                   *->lllkqipgiAqglvgavvtlggavaaalaGG<-*
                      +l++ i +iA+  v+a++  +g    a++GG
  gi|1179237   181    MLVSLISDIAGRAVAASDDATG---NAASGG    208

Ssu72: domain 1 of 1, from 326 to 334: score -0.3, E = 6.6
                   *->SkLrvAVVC<-*
                      S  ++AVVC
  gi|1179237   326    SSIQYAVVC    334

CbiZ: domain 1 of 1, from 360 to 375: score 2.2, E = 4.4
                   *->glkVtafaTAGisnpa<-*
                      ++kVta+ TAGi+np+
  gi|1179237   360    TVKVTAATTAGITNPV    375

Bro-N: domain 1 of 1, from 476 to 491: score 1.9, E = 5.3
                   *->evrtvvdingepWFvAkD<-*
                      ++ tv  ing+ +F A D
  gi|1179237   476    QFFTV--INGKAYFAASD    491

PQQ: domain 1 of 1, from 530 to 567: score 2.2, E = 9.7
                CS    TEEEEETTTSEEEEEETTTTSEEEEEESSSGGGS GEE
                   *->gvvyvgtadGylyAlDakTGkvlWkfktggpvds.pvt<-*
                      g+vy++ +dG+   +  ++G    ++ + g+ +s+p+
  gi|1179237   530    GDVYFTAYDGTASQILTTSGTFASTVSVAGGFNStPQF    567

STE: domain 1 of 1, from 600 to 624: score 0.3, E = 8.2
                   *->nqvirRflLpndegyvsCvfWnnLyy<-*
                       ++i+ +   nd  y   v+ nnLy+
  gi|1179237   600    -KNINIYGSGNDKFYYPAVYNNNLYF    624

Phage_X: domain 1 of 1, from 682 to 692: score 1.1, E = 9.5
                   *->dWYvepvlstn<-*
                      d+Y++p++s++
  gi|1179237   682    DNYYGPIFSSS    692

PepSY: domain 1 of 1, from 696 to 720: score 5.1, E = 1.7
                   *->vvv.dddg.rlevyvDaytGevlgve<-*
                      v+ ++++g+++++y +a +Gev+ ++
  gi|1179237   696    VFSeNGGGtVFTAYANA-DGEVIFTL    720

Cadherin: domain 1 of 4, from 721 to 779: score 7.7, E = 0.17
                CS    --S S----B-TTSSEEE..E---S---S....    .S-B--EEE-
                   *->gnp.ggwFrIdpdtGdnegiisttkpLDREeif....ngeYeLtveA
                      g+ ++++F I+ +tG+    ++ +   D+E++ +  + + YeLt+ A
  gi|1179237   721    GGAdADKFDINAATGV----VTFKSIPDYETPAsaagSNYYELTITA 763

                CS ---.........S---EEEE--EE
                   tDadpllasgggpplsstatvtit<-*
                   tD         + +++   +v ++
  gi|1179237   764 TDT--------SGSMDKALQVLVH    779

PGK: domain 1 of 1, from 725 to 744: score 7.0, E = 0.076
                CS    ESSSSTTS-EEEEETTTT--T
                   *->adkFaadAntqvvtdaeGIPD<-*
                      adkF+ +A+t+vvt ++ IPD
  gi|1179237   725    ADKFDINAATGVVTFKS-IPD    744

He_PIG: domain 1 of 4, from 757 to 768: score 5.6, E = 0.86
                   *->ytftvtatdgsg<-*
                      y+ t+tatd+sg
  gi|1179237   757    YELTITATDTSG    768

PKD: domain 1 of 4, from 757 to 778: score 4.7, E = 0.64
                CS    EEEEEEEEETTCEEEEEEEEEEE
                   *->YtVtLtvsngvgsasattttvtV<-*
                      Y +t t+++  gs ++  ++v V
  gi|1179237   757    YELTITATDTSGSMDKA-LQVLV    778

Cadherin: domain 2 of 4, from 788 to 872: score 25.4, E = 1.4e-06
                CS    --EEE-SS...S---EEEEE---S..-TTTT----------SS----
                   *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnpggwFr
                        ++v  ++++Gt+v    At +   +g+ ++++ si ggn +g F+
  gi|1179237   788    SAVEVADTSANGTSV----ATPSS--TGDTTSVTWSIQGGNASGLFA 828

                CS B-TTSSEEE..E---S-  --S.....S-B--EEE----.........S-
                   IdpdtGdnegiisttkp..LDREeifngeYeLtveAtDadpllasgggpp
                   I+  tG     i+++  ++ D  ++  + Y+L+v+A+D+
  gi|1179237   829 INASTGA----ITIADAtkFDHATT--PSYTLSVRASDG----------- 861

                CS --EEEE--EEE-
                   lsstatvtitVl<-*
                    ++ +   itV+
  gi|1179237   862 -TTNTDHDITVT    872

He_PIG: domain 2 of 4, from 847 to 863: score 0.7, E = 21
                   *->tvqpGsytftvtatdgsg<-*
                      +++p syt  v a+dg +
  gi|1179237   847    ATTP-SYTLSVRASDGTT    863

PKD: domain 2 of 4, from 851 to 873: score 3.6, E = 1.4
                CS    EEEEEEEEEETTCEEEEEEEEEEE
                   *->tYtVtLtvsngvgsasattttvtV<-*
                      +Yt+++++s+g  +++   +tvtV
  gi|1179237   851    SYTLSVRASDGTTNTDHD-ITVTV    873

Cna_B: domain 1 of 1, from 852 to 874: score 3.1, E = 2.1
                CS    EEEEEEESSS-............EEEEEE
                   *->Ytltttpveftitensdgeeekivtvtit<-*
                      Ytl+    + t++ + d       tvt+t
  gi|1179237   852    YTLSVRASDGTTNTDHD------ITVTVT    874

Cadherin: domain 3 of 4, from 908 to 973: score 5.2, E = 0.89
                CS    T----------SS----B-TTSSEEE..E---S---S....    .S
                   *->grirYsilggnpggwFrIdpdtGdnegiisttkpLDREeif....ng
                      g ++Y+i g++ g +F Id  +G     ++ ++  D E+  +  + +
  gi|1179237   908    GTVSYAIGGTD-GAKFNIDGSSGA----VTFKAAPDFEALAsaasSN 949

                CS -B--EEE----.........S---EEEE--EEE-
                   eYeLtveAtDadpllasgggpplsstatvtitVl<-*
                    Y++t++AtD           + + t  v+itV+
  gi|1179237   950 AYTVTLSATDD----------NGTHTQDVVITVT    973

Peptidase_C3: domain 1 of 1, from 936 to 959: score 3.4, E = 1
                   *->gPsldfCmPaqsllkkNivpvttyldskGe<-*
                      +P+++    + s + +N+++vt+   s+++
  gi|1179237   936    APDFEA---LASAASSNAYTVTL---SATD    959

Drmip_Hesp: domain 1 of 1, from 941 to 954: score 3.6, E = 1.7
                   *->llAllAalaaAiqIT<-*
                       lA+ Aa+++A+++T
  gi|1179237   941    ALAS-AASSNAYTVT    954

MpPF1: domain 1 of 1, from 947 to 958: score -1.3, E = 9.2
                   *->snktYTITLtAt<-*
                      s++ YT+TL+At
  gi|1179237   947    SSNAYTVTLSAT    958

He_PIG: domain 3 of 4, from 951 to 962: score 3.9, E = 2.6
                   *->ytftvtatdgsg<-*
                      yt+t++atd  g
  gi|1179237   951    YTVTLSATDDNG    962

PKD: domain 3 of 4, from 951 to 972: score 12.6, E = 0.0024
                CS    EEEEEEEEETTCEEEEEEEEEEE
                   *->YtVtLtvsngvgsasattttvtV<-*
                      YtVtL +++++g+ ++  + +tV
  gi|1179237   951    YTVTLSATDDNGTHTQD-VVITV    972

SoxZ: domain 1 of 1, from 952 to 972: score 2.2, E = 4.1
                CS    .EEEEEEETTS-EEEEEEEE--
                   *->elkfsWtDnkGssetaeakItv<-*
                      ++++s tD++G++ +++ +Itv
  gi|1179237   952    TVTLSATDDNGTHTQDV-VITV    972

Fe-S_biosyn: domain 1 of 1, from 970 to 979: score 2.2, E = 6.1
                CS    -EE-HHHHHH
                   *->ItLTdaAakh<-*
                      It+TdaA ++
  gi|1179237   970    ITVTDAAPAW    979

Cadherin: domain 4 of 4, from 1003 to 1069: score 26.3, E = 7.7e-07
                CS    -TTTT----------SS----B-TTSSEEE..E---S-  --S....
                   *->lgpNgrirYsilggnpggwFrIdpdtGdnegiisttkp..LDREeif
                      +g+N++++ si +gn +g F+I+ +tG+    i+++  ++ D   +
  gi|1179237  1003    TGDNSGVTWSIQSGNASGLFAINAATGV----ITVADAskFDFSNT- 1044

                CS .S-B--EEE----.........S---EEEE--EEE-
                   ngeYeLtveAtDadpllasgggpplsstatvtitVl<-*
                    + Y+L+v+AtD+          + s+   +++ V
  gi|1179237  1045 -PFYTLSVRATDG----------NTSADHNLVVAVV    1069

PKD: domain 4 of 4, from 1047 to 1068: score 0.2, E = 16
                CS    EEEEEEEEETTCEEEEEEEEEEE
                   *->YtVtLtvsngvgsasattttvtV<-*
                      Yt+++++++g+ sa+ + + v V
  gi|1179237  1047    YTLSVRATDGNTSADHN-LVVAV    1068

fn3: domain 1 of 1, from 1091 to 1109: score 3.6, E = 2.7
                CS    ----CEEEEEEECTTEEEE
                   *->PsaPtnltvtdvtstsltl<-*
                      PsaP  + v +v+++++t+
  gi|1179237  1091    PSAPPPVVVAPVGESTVTV    1109

DUF1802: domain 1 of 1, from 1118 to 1144: score 0.8, E = 8.4
                   *->SWinLnesislaesrPVlsDeeFaqlaqei<-*
                      S+i+L + +sl   +P+ sD++  ++a +
  gi|1179237  1118    SFIPL-PAVSLRATPPAASDAA--RTAPAA    1144

Peptidase_C25_C: domain 1 of 1, from 1140 to 1152: score 1.1, E = 8.8
                CS    E--SEEETT-SEE
                   *->TaPAsipqnqaSy<-*
                      TaPA +p+++aS+
  gi|1179237  1140    TAPAALPASAASV    1152

DUF1278: domain 1 of 1, from 1147 to 1184: score 1.5, E = 6.6
                   *->MAskssflptlvvllllllaaasvasarpvptvaegttspat<-*
                       As+ s+ p+  v ++++ + ++  ++++vp v++  + pa+
  gi|1179237  1147    -ASAASVVPV--VMTAQFTV-STELGGFRVPVVTASQGGPAV    1184

DUF1860: domain 1 of 1, from 1202 to 1230: score -1.0, E = 8.8
                   *->DvLKFsLCnDGAAL..snYiinitAAKin<-*
                      Dv++ sL  D  A ++   ++ +tAA+in
  gi|1179237  1202    DVVRVSLPADAFAHtrTDAVVVLTAARIN    1230

DAG1: domain 1 of 1, from 1205 to 1257: score 7.2, E = 0.03
                CS    XXXXXXXXXXXXXX..XXXXXXXXXXX..X..XXXXXXXXXXXXXXX
                   *->rlhvptellassedqGiikiseadKdgheLkapswLhwdadsrtLqG
                      r+  p +++a      ++ +++a  +g  L  pswL +d+ s+tL G
  gi|1179237  1205    RVSLPADAFAHTRTDAVVVLTAARINGQPL--PSWLNFDSRSGTLSG 1249

                CS XXXXXXXX
                   LPLdtDKG<-*
                    P  + KG
  gi|1179237  1250 SPPADLKG    1257

DUF218: domain 1 of 1, from 1217 to 1238: score 3.0, E = 2.9
                   *->kaDaIvVLGggly.n.p.pspl<-*
                      + Da+vVL ++  +++p ps+l
  gi|1179237  1217    RTDAVVVLTAARInGqPlPSWL    1238

He_PIG: domain 4 of 4, from 1228 to 1270: score 19.0, E = 0.00013
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      + +                   +LPs+L++ds +G+++G+P+
  gi|1179237  1228    RING-----------------QPLPSWLNFDSRSGTLSGSPPADLK- 1256

                   Gsytftvtatdgsg<-*
                   G++ + + a d  g
  gi|1179237  1257 GTTVVKIIARDNLG    1270

HYR: domain 1 of 1, from 1257 to 1279: score 5.8, E = 0.41
                   *->GEettVtYtatDnaGNeAdsCtFtVtV<-*
                      G +t+V  +a+Dn GNeA     tV++
  gi|1179237  1257    G-TTVVKIIARDNLGNEA---IITVRI    1279

UreD: domain 1 of 1, from 1260 to 1275: score 1.2, E = 4.1
                   *->vvRvLgksaedvrhvf<-*
                      vv+++++++  +++++
  gi|1179237  1260    VVKIIARDNLGNEAII    1275

DUF849: domain 1 of 1, from 1272 to 1281: score 0.1, E = 7.3
                   *->KvIITcAvTG<-*
                       +IIT+ ++G
  gi|1179237  1272    EAIITVRING    1281

//