hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            117925469.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|117925469|ref|YP_866086.1|
Accession:      [none]
Description:    putative outer membrane adhesin like proteiin [Magnetococcus sp. MC-1]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
Pentapeptide    Pentapeptide repeats (8 copies)        1829.1          0  70
HemolysinCabind Hemolysin-type calcium-binding repeat   162.6    3.8e-48  36
TMP             TMP repeat                               31.6    6.2e-08   6
efhand          EF hand                                  24.4    1.7e-05   6
Planc_extracel  Planctomycete extracellular              16.6    6.2e-05   1
WSK             WSK motif                                19.5    0.00015   3
Flagellin_IN    Flagellin hook IN motif                  18.0    0.00032   6
F420_oxidored   NADP oxidoreductase coenzyme F420-dep    15.2    0.00057   3
DUF2001         Protein of unknown function (DUF2001)    12.6     0.0043   5
LTXXQ           LTXXQ motif                              13.9     0.0044   4
FMN_bind        FMN-binding domain                       12.8     0.0053   4
DUF59           Domain of unknown function DUF59         13.5     0.0062   3
Rep_fac_C       Replication factor C                     11.8       0.01   3
CobU            Cobinamide kinase / cobinamide phosph    10.4      0.012   3
Gly_radical     Glycine radical                          11.7      0.013   3
DUF1388         Repeat of unknown function (DUF1388)     12.2      0.013   2
Attacin_N       Attacin, N-terminal region               12.1      0.015   4
Sec3            Exocyst complex component Sec3            7.8       0.02   1
Eclosion        Eclosion hormone                          9.3      0.038   3
OmpA            OmpA family                              10.4      0.039   4
Gp5_C           Gp5 C-terminal repeat (3 copies)         10.3      0.048   6
SIC             sic protein                               5.4      0.056   3
DGOK            2-keto-3-deoxy-galactonokinase            3.8      0.077   2
DUF2150         Uncharacterized protein conserved in      8.0      0.078   1
Antimicrobial15 Ocellatin family                          8.7      0.082   4
CamS            CamS sex pheromone cAM373 precursor       6.6       0.13   4
DUF1757         Protein of unknown function (DUF1757)     6.2       0.14   3
YceI            YceI-like domain                          6.9       0.16   2
PPC             Bacterial pre-peptidase C-terminal do     7.7       0.17   2
Cloacin         Cloacin                                   5.7       0.17   3
CAMP_factor     CAMP factor (Cfa)                         5.8       0.19   2
DUF1547         Domain of Unknown Function (DUF1547)      6.9       0.22   2
Phage-tail_1    Baseplate structural protein, domain      3.9       0.24   1
DUF1771         Domain of unknown function (DUF1771)      7.5       0.26   3
DUF1326         Protein of unknown function (DUF1326)     6.1       0.28   1
Dockerin_1      Dockerin type I repeat                    7.8        0.3   5
Antimicrobial_7 Scorpion antimicrobial peptide            5.7        0.3   3
Glyco_hydro_65C Glycosyl hydrolase family 65, C-termi     7.8       0.32   3
RuvA_C          RuvA, C-terminal domain                   8.3       0.34   4
Haemagg_act     haemagglutination activity domain         5.7       0.38   1
Filamin         Filamin/ABP280 repeat                     6.1       0.41   1
T4_gp9_10       Bacteriophage T4 gp9/10-like protein      4.3       0.48   1
DUF2283         Protein of unknown function (DUF2283)     6.2       0.48   3
Plug            TonB-dependent Receptor Plug Domain       5.6       0.52   1
POC4            POC4 chaperone                            1.3       0.57   1
Sigma70_r3      Sigma-70 region 3                         6.4       0.62   1
L-fibroin       Fibroin light chain (L-fibroin)           5.1       0.68   1
LpxK            Tetraacyldisaccharide-1-P 4'-kinase       4.4       0.71   3
Fmp27_GFWDK     RNA pol II promoter Fmp27 protein dom     2.1       0.75   1
Beta-lactamase  Beta-lactamase                            4.3       0.76   4
SRP1_TIP1       Seripauperin and TIP1 family              4.8       0.77   1
MspA            MspA                                      4.7       0.77   2
Vac_Fusion      Chordopoxvirus fusion protein             2.4       0.78   1
MR_MLE_N        Mandelate racemase / muconate lactoni     3.6        0.8   1
TarH            Tar ligand binding domain homologue       5.2       0.81   1
MmoB_DmpM       MmoB/DmpM family                          5.3       0.84   1
DUF946          Plant protein of unknown function (DU    -0.2       0.91   1
PKD             PKD domain                                4.1       0.98   4
ADP_ribosyl_GH  ADP-ribosylglycohydrolase                 2.9          1   3
Peptidase_A4    Peptidase A4 family                       2.2        1.1   2
Avian_gp85      Avian retrovirus envelope protein, gp     3.0        1.1   1
Linocin_M18     Linocin_M18 bacteriocin protein           2.9        1.1   1
Hep_Hag         Hep_Hag                                   6.7        1.1   3
MOSP_C          Major Outer Sheath Protein C-terminal     2.4        1.1   1
Calsarcin       Calcineurin-binding protein (Calsarci     1.1        1.1   3
Chitin_bind_4   Insect cuticle protein                    5.0        1.1   2
Inhibitor_I68   Carboxypeptidase inhibitor I68            3.0        1.1   1
ACP_syn_III     3-Oxoacyl-[acyl-carrier-protein (ACP)     5.3        1.2   1
Big_3           Bacterial Ig-like domain (group 3)        5.7        1.2   5
Connexin50      Gap junction alpha-8 protein (Cx50)       2.9        1.2   3
Cna_B           Cna protein B-type domain                 3.8        1.3   3
zf-CHC2         CHC2 zinc finger                          4.7        1.3   4
NikM            Nickel uptake substrate-specific tran     2.9        1.3   3
LAGLIDADG_1     LAGLIDADG endonuclease                    5.0        1.3   1
DUF2006         Proteins of unknown function (DUF2006     0.1        1.3   1
Hydrolase       haloacid dehalogenase-like hydrolase      3.6        1.4   1
DUF719          Protein of unknown function (DUF719)      2.8        1.5   2
AmoC            Ammonia monooxygenase/methane monooxy     2.8        1.5   1
NAD_binding_3   Homoserine dehydrogenase, NAD binding     4.2        1.5   1
SPOR            Sporulation related domain                4.0        1.5   1
Rrp15p          Rrp15p                                    4.2        1.7   2
STN             Secretin and TonB N terminus short do     4.6        1.7   1
UBA_3           Fungal ubiquitin-associated domain        4.7        1.7   2
Adeno_PIX       Adenovirus hexon-associated protein (     3.4        1.7   1
DUF574          Protein of unknown function (DUF574)      2.8        1.7   3
Glyco_hydro_3   Glycosyl hydrolase family 3 N termina     2.5        1.7   1
CRT10           CRT10                                     1.8        1.8   1
DOMON           DOMON domain                              4.3        1.8   1
SPARC_Ca_bdg    Secreted protein acidic and rich in c     3.2        1.9   1
Fn_bind         Fibronectin binding repeat                5.2        1.9   1
ATP_bind_1      Conserved hypothetical ATP binding pr     2.4          2   1
Bombolitin      Bombolitin family                         4.7          2   3
PSGP            Apopolysialoglycoprotein (PSGP)           5.2          2   2
BSP             Plant Basic Secretory Protein             1.4        2.1   2
Herpes_UL1      Herpesvirus glycoprotein L                2.9        2.1   3
DUF745          Protein of unknown function (DUF745)      2.3        2.2   1
PI3_PI4_kinase  Phosphatidylinositol 3- and 4-kinase      3.0        2.2   1
DUF1969         Domain of unknown function (DUF1969)      1.7        2.3   1
Peptidase_A22B  Signal peptide peptidase                  2.3        2.3   1
DUF2095         Uncharacterized protein conserved in      2.8        2.4   1
Pkinase_C       Protein kinase C terminal domain          4.5        2.5   2
PapG_C          PapG chaperone-binding domain             2.3        2.6   1
MHC2-interact   CLIP, MHC2 interacting                    2.6        2.7   1
DUF2026         Protein of unknown function (DUF2026)     0.7        2.7   1
Sperm_act_pep   Sperm-activating peptides                 5.7        2.8   4
Orthopox_F7     Orthopoxvirus F7 protein                  2.0        2.8   1
Radial_spoke    Radial spokehead-like protein             0.7        2.8   1
Glyco_hydro_67C Glycosyl hydrolase family 67 C-termin     1.3        2.8   1
Memo            Memo-like protein                         0.9        2.8   3
DUF1873         Domain of unknown function (DUF1873)      1.4        2.9   1
HCV_NS4b        Hepatitis C virus non-structural prot     0.4          3   3
GTP_cyclohydroI GTP cyclohydrolase I                      2.3        3.1   1
Plasmod_MYXSPDY Plasmodium repeat_MYXSPDY                 4.7        3.1   1
Hum_adeno_E3A   Human adenovirus early E3A glycoprote     1.7        3.1   1
SBP_bac_5       Bacterial extracellular solute-bindin     1.4        3.1   1
MIP-T3          Microtubule-binding protein MIP-T3        0.6        3.1   1
DUF2124         Uncharacterized protein conserved in      2.3        3.1   3
DUF2420         Protein of unknown function (DUF2420)     2.6        3.2   1
Tymo_coat       Tymovirus coat protein                    2.6        3.2   3
BiPBP_C         Penicillin-Binding Protein C-terminus     2.9        3.2   1
Gmad2           Immunoglobulin-like domain of bacteri     2.5        3.3   1
DUF1627         Protein of unknown function (DUF1627)     1.7        3.3   1
DASH_Ask1       DASH complex subunit Ask1                 3.5        3.4   1
Glyco_hydro_19  Chitinase class I                         1.3        3.4   1
PGA2            Protein trafficking PGA2                  2.0        3.5   1
Fil_haemagg     Haemagluttinin repeat                     3.2        3.5   1
Herpes_gE       Alphaherpesvirus glycoprotein E          -0.2        3.6   1
MyTH4           MyTH4 domain                              2.5        3.6   1
DUF30           Domain of unknown function DUF30          2.6        3.6   1
DUF241          Arabidopsis protein of unknown functi    -0.4        3.6   1
Proteasome_A_N  Proteasome subunit A N-terminal signa     4.4        3.7   2
TIP41           TIP41-like family                         2.4        3.7   1
PIN_2           Predicted nucleotide-binding protein,     3.2        3.7   1
RTX             RTX N-terminal domain                    -1.0        3.7   1
Monooxygenase_B Monooxygenase subunit B protein           0.7          4   1
DUF983          Protein of unknown function (DUF983)      2.4          4   1
DUF844          Baculovirus protein of unknown functi     1.1        4.1   1
GspM            General secretion pathway, M protein      2.1        4.1   1
DUF1386         Protein of unknown function (DUF1386)     0.8        4.2   3
Gag_p17         gag gene protein p17 (matrix protein)     2.1        4.2   1
SLT_beta        Shiga-like toxin beta subunit             2.1        4.3   1
PalI            pH-response regulator, PalI / Rim9        2.9        4.3   1
FecR            FecR protein                              2.8        4.3   1
Urm1            Urm1 (Ubiquitin related modifier)        -1.2        4.3   1
DUF823          Salmonella repeat of unknown function     0.7        4.4   3
MxiH            Type III secretion needle MxiH like       3.0        4.4   2
4HBT            Thioesterase superfamily                  3.3        4.5   1
DUF342          Protein of unknown function (DUF342)      0.7        4.5   1
CBM_6           Carbohydrate binding module (family 6     1.6        4.5   1
Myosin_N        Myosin N-terminal SH3-like domain         3.6        4.5   1
TIR-like        Predicted nucleotide-binding protein      2.2        4.6   1
Peptidase_C69   Peptidase family C69                      0.1        4.6   1
AKAP_110        A-kinase anchor protein 110 kDa (AKAP    -1.1        4.6   1
DUF583          Protein of unknown function, DUF583       2.6        4.6   2
PTS_EIIA_2      Phosphoenolpyruvate-dependent sugar p     2.3        4.7   1
DUF790          Protein of unknown function (DUF790)      1.3        4.7   1
Corona_S2       Coronavirus S2 glycoprotein              -0.4        4.7   1
NRPS            Nonribosomal peptide synthase             0.6        4.8   1
Phosducin       Phosducin                                 0.7        4.8   1
Bile_Hydr_Trans Acyl-CoA thioester hydrolase / Bile a     2.1        4.9   1
Lysis_col       Lysis protein                             3.7          5   3
NosD            Periplasmic copper-binding protein (N     3.2          5   1
Herpes_TK_C     Thymidine kinase from Herpesvirus C-t     4.3          5   2
Cenp-F_leu_zip  Leucine-rich repeats of kinetochore p     1.6        5.1   1
L_lac_phage_MSP Lactococcus lactis bacteriophage majo     0.5        5.1   1
TES             Trematode Eggshell Synthesis              2.5        5.2   1
Opacity         Opacity family porin protein              2.4        5.2   1
PEP-utilizers   PEP-utilising enzyme, mobile domain       2.6        5.2   1
ThiS            ThiS family                               0.7        5.2   1
DUF1973         Domain of unknown function (DUF1973)     -0.4        5.3   1
MipZ            ATPase MipZ                               0.6        5.3   1
DUF791          Protein of unknown function (DUF791)     -0.4        5.3   1
Prefoldin       Prefoldin subunit                         2.5        5.4   1
PGA_cap         Bacterial capsule synthesis protein P     0.6        5.4   1
Chordopox_A33R  Chordopoxvirus A33R protein              -0.1        5.4   1
PNP_UDP_1       Phosphorylase superfamily                 1.5        5.4   1
Proteasome      Proteasome A-type and B-type              1.3        5.6   1
Pirin_C         Pirin C-terminal cupin domain             2.7        5.6   3
DUF934          Bacterial protein of unknown function     2.6        5.7   1
DUF498          Protein of unknown function (DUF498/D     1.4        5.7   1
DUF859          Siphovirus protein of unknown functio    -1.2        5.7   1
Hydrolase_2     Cell Wall Hydrolase                       2.7        5.8   1
ClpB_D2-small   C-terminal, D2-small domain, of ClpB      1.5        5.8   1
BESS            BESS motif                                3.5          6   3
S-AdoMet_synt_C S-adenosylmethionine synthetase, C-te     0.4          6   1
UPF0079         Uncharacterised P-loop hydrolase UPF0     2.4          6   1
Alpha-L-AF_C    Alpha-L-arabinofuranosidase C-terminu     1.5        6.2   1
BMC             BMC domain                                3.1        6.3   2
CHASE4          CHASE4 domain                             1.6        6.3   1
FBPase_glpX     Bacterial fructose-1,6-bisphosphatase     0.0        6.3   1
DUF2401         Putative secretory protein (DUF2401)      1.0        6.3   1
Flagellin_N     Bacterial flagellin N-terminus            1.9        6.4   3
DUF1391         Protein of unknown function (DUF1391)     2.4        6.4   2
DNA_gyraseA_C   DNA gyrase C-terminal domain, beta-pr     3.4        6.4   4
SAM_PNT         Sterile alpha motif (SAM)/Pointed dom     1.6        6.5   4
Glyco_hydro_85  Glycosyl hydrolase family 85              0.3        6.6   1
Ribosomal_L18p  Ribosomal L18p/L5e family                 1.9        6.7   2
FeThRed_B       Ferredoxin thioredoxin reductase cata     1.1        6.7   1
OpuAC           Substrate binding domain of ABC-type      1.2        6.9   1
DUF211          Uncharacterized ArCR, COG1888             0.1        6.9   1
DUF2588         Protein of unknown function (DUF2588)     1.6        6.9   3
Como_SCP        Small coat protein                        0.3          7   1
R_equi_Vir      Rhodococcus equi virulence-associated     0.4          7   1
Flu_B_M2        Influenza B matrix protein 2 (BM2)        0.9        7.1   1
DUF1484         Protein of unknown function (DUF1484)     1.7        7.2   1
EB_dh           Ethylbenzene dehydrogenase               -0.1        7.3   1
Beta-trefoil    Beta-trefoil                              0.2        7.4   3
NO_synthase     Nitric oxide synthase, oxygenase doma    -1.1        7.5   1
DUF915          Alpha/beta hydrolase of unknown funct     0.1        7.6   1
DUF1177         Protein of unknown function (DUF1177)    -0.1        7.6   1
DUF1914         Domain of unknown function (DUF1914)      1.6        7.7   1
DUF2431         Domain of unknown function (DUF2431)     -0.3        7.7   1
Baculo_VP39     Baculovirus major capsid protein VP39     0.1        7.7   1
gerPA           Spore germination protein gerPA/gerPF     1.5        7.8   1
Borrelia_rep    Borrelia repeat protein                   3.1        7.8   1
Phytase         Phytase                                  -0.5        7.8   1
GA              GA module                                 3.1        7.8   1
Peptidase_C39   Peptidase C39 family                      1.2        7.9   2
Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzy    -0.2        7.9   1
Endonuc-EcoRV   Restriction endonuclease EcoRV           -0.3          8   1
DUF387          Putative transcriptional regulators (     1.5        8.1   1
Attractin       Attractin family                          1.7        8.1   1
GSDH            Glucose / Sorbosone dehydrogenase         1.2        8.1   1
DUF2131         Uncharacterized protein conserved in      1.5        8.2   1
Phage_Coat_Gp8  Phage major coat protein, Gp8             1.3        8.3   1
AXH             Ataxin-1 and HBP1 module (AXH)            0.6        8.3   1
DUF1025         Domain of unknown function (DUF1025)      1.3        8.4   1
Glucodextran_N  Glucodextranase, domain N                -1.3        8.4   1
DUF1631         Protein of unknown function (DUF1631)    -1.7        8.4   1
RHS_repeat      RHS Repeat                                2.3        8.4   1
OSCP            ATP synthase delta (OSCP) subunit         1.0        8.4   1
Anemone_cytotox Sea anemone cytotoxic protein             0.8        8.4   3
CRC_subunit     Chromatin remodelling complex subunit     0.9        8.4   1
Nop53           Nop53 (60S ribosomal biogenesis)         -1.5        8.5   1
PHA_gran_rgn    Putative polyhydroxyalkanoic acid sys     2.5        8.6   4
WW              WW domain                                 2.7        8.6   1
Endonuc-HincII  Restriction endonuclease HincII           0.1        8.6   1
DASH_Dad4       DASH complex subunit Dad4                 0.9        8.6   1
Sod_Fe_N        Iron/manganese superoxide dismutases,     0.8        8.6   1
Sm_multidrug_ex Putative small multi-drug export prot     0.9        8.7   1
Dala_Dala_lig_N D-ala D-ala ligase N-terminus             0.1        8.8   1
Cytokin-bind    Cytokinin dehydrogenase 1, FAD and cy    -0.9        8.9   1
CUB             CUB domain                                0.7        8.9   1
OpcA            Outer membrane protein OpcA              -0.8        8.9   1
RAMPs           RAMP superfamily                          0.0        8.9   1
CbiD            CbiD                                      0.2          9   1
UPF0061         Uncharacterized ACR, YdiU/UPF0061 fam    -1.0          9   1
DUF2406         Uncharacterised protein (DUF2406)         0.6          9   1
Reo_P9          Reovirus P9-like family                  -1.2        9.1   1
Utp13           Utp13 specific WD40 associated domain     0.6        9.2   1
Methyltransf_6  Demethylmenaquinone methyltransferase     0.5        9.3   1
Bystin          Bystin                                   -0.6        9.3   1
DUF1505         Protein of unknown function (DUF1505)     0.7        9.3   1
SEA             SEA domain                                1.4        9.3   1
Eapp_C          E2F-associated phosphoprotein             0.9        9.4   1
DUF2453         Protein of unknown function (DUF2453)     0.9        9.4   1
Fimbrial        Fimbrial protein                          0.5        9.4   1
Nif11           Nitrogen fixation protein of unknown      2.3        9.5   4
FAD_binding_9   Siderophore-interacting FAD-binding d     1.5        9.5   1
Phage_HK97_TLTM Tail length tape measure protein         -0.8        9.6   1
Peptidase_C27   Rubella virus endopeptidase              -0.6        9.6   1
DUF763          Protein of unknown function (DUF763)     -1.3        9.6   1
Stap_Strp_toxin Staphylococcal/Streptococcal toxin, O     1.4        9.7   1
Abhydrolase_1   alpha/beta hydrolase fold                 0.2        9.7   1
Laminin_G_1     Laminin G domain                          0.6        9.9   1
Patatin         Patatin-like phospholipase                0.4        9.9   1
HSP9_HSP12      Heat shock protein 9 / 12                 0.8        9.9   2
Big_1           Bacterial Ig-like domain (group 1)        0.5        9.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Planc_extracel    1/1      31    58 ..     1    28 []    16.6  6.2e-05
Glyco_hydro_85    1/1      59    70 ..    38    49 ..     0.3      6.6
GA                1/1     126   139 ..    47    60 .]     3.1      7.8
Proteasome        1/1     127   155 ..   163   194 .]     1.3      5.6
Flu_B_M2          1/1     189   202 ..    96   109 .]     0.9      7.1
PSGP              1/2     248   260 ..     1    13 []     3.7      5.8
Phytase           1/1     307   340 ..   241   271 ..    -0.5      7.8
Glyco_hydro_65C   1/3     322   355 ..    23    56 .]     5.7      1.2
Methyltransf_6    1/1     327   333 ..   179   185 .]     0.5      9.3
4HBT              1/1     328   349 ..     5    26 ..     3.3      4.5
HemolysinCabind   1/36    352   362 ..     8    18 .]     6.5     0.82
HemolysinCabind   2/36    373   382 ..     9    18 .]     1.1       37
Patatin           1/1     443   457 ..   245   259 .]     0.4      9.9
DUF1627           1/1     466   495 ..     1    30 [.     1.7      3.3
Hydrolase_2       1/1     484   510 ..    61    89 ..     2.7      5.8
SBP_bac_5         1/1     529   614 ..   363   490 .]     1.4      3.1
GspM              1/1     551   570 ..    79    98 ..     2.1      4.1
DUF983            1/1     606   614 ..     1     9 [.     2.4        4
GSDH              1/1     653   673 ..    88   108 .]     1.2      8.1
Cenp-F_leu_zip    1/1     746   767 ..   122   143 .]     1.6      5.1
DUF1969           1/1     767   774 ..     1     8 [.     1.7      2.3
MR_MLE_N          1/1     781   790 ..   120   129 .]     3.6      0.8
Pkinase_C         1/2     813   822 ..    38    47 .]     0.5       33
OSCP              1/1     825   837 ..   164   176 .]     1.0      8.4
RuvA_C            1/4     831   842 ..     1    12 [.     0.6       38
AKAP_110          1/1     850   857 ..   719   726 .]    -1.1      4.6
Pentapeptide      1/70    867   906 ..     1    40 []    45.0  2.1e-11
Beta-lactamase    1/4     896   926 ..   357   386 .]     0.2      9.3
Pentapeptide      2/70    911   950 ..     1    40 []    41.4    2e-10
Peptidase_A22B    1/1     969   988 ..   392   411 .]     2.3      2.3
Sperm_act_pep     1/4     995  1004 ..     1    10 []     0.6       81
Pentapeptide      3/70   1006  1039 ..     7    40 .]    22.2    4e-05
Sperm_act_pep     2/4    1078  1087 ..     1    10 []     3.3       13
Pentapeptide      4/70   1093  1132 ..     1    40 []    28.2  8.6e-07
Abhydrolase_1     1/1    1103  1138 ..     1    32 [.     0.2      9.7
SAM_PNT           1/4    1103  1120 ..    42    60 ..     0.5       15
DUF2001           1/5    1128  1151 ..   126   151 .]     5.6     0.42
Pentapeptide      5/70   1141  1174 ..     7    40 .]     3.4      5.9
DUF1326           1/1    1152  1173 ..   100   121 ..     6.1     0.28
NO_synthase       1/1    1173  1191 ..   223   241 ..    -1.1      7.5
Pentapeptide      6/70   1243  1282 ..     1    40 []    36.6  4.2e-09
YceI              1/2    1325  1353 ..   155   186 .]     3.0        2
Fmp27_GFWDK       1/1    1419  1426 ..   154   161 .]     2.1     0.75
FAD_binding_9     1/1    1461  1477 ..   107   123 .]     1.5      9.5
efhand            1/6    1463  1491 ..     1    29 []    14.5   0.0082
SPARC_Ca_bdg      1/1    1472  1487 ..    90   106 ..     3.2      1.9
DUF2406           1/1    1486  1494 ..     1     9 [.     0.6        9
PGA_cap           1/1    1550  1556 ..   281   287 .]     0.6      5.4
Adeno_PIX         1/1    1585  1595 ..     1    11 [.     3.4      1.7
Pentapeptide      7/70   1685  1724 ..     1    40 []    49.7    1e-12
Pentapeptide      8/70   1734  1773 ..     1    40 []    40.7  3.2e-10
NRPS              1/1    1763  1771 ..     1     9 [.     0.6      4.8
DUF791            1/1    1807  1825 ..   368   386 .]    -0.4      5.3
DUF934            1/1    1813  1832 ..     1    23 [.     2.6      5.7
Pentapeptide      9/70   1820  1855 ..     1    36 [.    34.6  1.5e-08
Sperm_act_pep     3/4    1829  1834 ..     1     6 [.     0.4       90
Pentapeptide     10/70   1857  1879 ..    18    40 .]    14.0   0.0073
GTP_cyclohydroI   1/1    1879  1894 ..    90   105 .]     2.3      3.1
Pkinase_C         2/2    1913  1925 ..    35    47 .]     4.0      3.5
Pentapeptide     11/70   1919  1958 ..     1    40 []    22.2  3.8e-05
Stap_Strp_toxin   1/1    1943  1948 ..    89    94 .]     1.4      9.7
Pentapeptide     12/70   1960  1969 ..    31    40 .]     1.8       16
Pentapeptide     13/70   1986  2025 ..     1    40 []    31.1  1.3e-07
Attacin_N         1/4    2015  2022 ..    60    67 .]     0.6       24
Glyco_hydro_67C   1/1    2019  2028 ..     1    10 [.     1.3      2.8
Pentapeptide     14/70   2026  2035 ..    31    40 .]     1.5       20
Sm_multidrug_ex   1/1    2028  2036 ..     1    10 [.     0.9      8.7
F420_oxidored     1/3    2047  2075 ..   225   253 .]     5.0     0.45
Dockerin_1        1/5    2059  2072 ..     8    21 .]     2.7       11
MspA              1/2    2104  2148 ..    86   135 ..     2.8      2.5
Hydrolase         1/1    2142  2164 ..   162   184 .]     3.6      1.4
ATP_bind_1        1/1    2159  2166 ..     1     8 [.     2.4        2
Cloacin           1/3    2197  2225 ..     1    29 [.     1.9      2.1
DUF1386           1/3    2213  2219 ..     1     7 [.     0.3        6
DUF574            1/3    2226  2250 ..   253   283 .]     0.9      5.6
DNA_gyraseA_C     1/4    2233  2266 ..    14    53 .]     1.1       28
Memo              1/3    2234  2246 ..   321   333 .]     0.3      4.3
DUF2588           1/3    2291  2307 ..   130   146 .]     0.5       14
LpxK              1/3    2305  2322 ..   364   385 .]     1.5      4.5
Rep_fac_C         1/3    2305  2325 ..    51    72 ..     3.9      1.9
BESS              1/3    2313  2324 ..    26    37 .]     1.2       28
DUF59             1/3    2313  2326 ..     1    14 [.     4.5      1.9
Bombolitin        1/3    2315  2331 ..     1    17 []     1.6       18
CobU              1/3    2327  2335 ..   173   181 .]     3.5      1.2
DUF1771           1/3    2363  2376 ..     1    16 [.     2.5      6.9
Eclosion          1/3    2384  2395 ..    51    62 .]     3.1      2.6
FMN_bind          1/4    2387  2402 ..    99   114 .]     4.3      1.3
RuvA_C            2/4    2393  2404 ..     1    12 [.     2.6       12
Pentapeptide     15/70   2411  2426 ..    14    29 ..     3.9      4.3
Pentapeptide     16/70   2430  2469 ..     1    40 []    54.7  4.3e-14
Anemone_cytotox   1/3    2461  2480 ..     1    20 [.     0.3       12
Beta-trefoil      1/3    2469  2488 ..   113   132 ..     0.1      8.1
Pentapeptide     17/70   2475  2514 ..     1    40 []    38.6  1.2e-09
zf-CHC2           1/4    2479  2502 ..    75    98 .]     0.4       22
Pentapeptide     18/70   2571  2604 ..     7    40 .]    29.9  2.9e-07
WSK               1/3    2644  2657 ..     1    14 [.     6.5     0.76
TMP               1/6    2650  2660 ..     1    11 []     8.8     0.33
Pentapeptide     19/70   2660  2699 ..     1    40 []    33.2  3.7e-08
DUF2001           2/5    2705  2717 ..   139   151 .]     1.4      6.4
Pentapeptide     20/70   2705  2745 ..     5    40 .]     7.5     0.44
DUF2124           1/3    2719  2730 ..     1    12 [.     0.8      8.7
Gly_radical       1/3    2743  2761 ..     1    19 [.     3.9      1.9
Pentapeptide     21/70   2748  2758 ..     1    11 [.     1.0       28
Pentapeptide     22/70   2778  2808 ..    10    40 .]     6.0      1.2
Big_3             1/5    2790  2817 ..    24    46 ..     1.5       16
Pentapeptide     23/70   2809  2848 ..     1    40 []    28.4  7.7e-07
PHA_gran_rgn      1/4    2847  2860 ..    49    62 ..     0.0       38
Chordopox_A33R    1/1    2914  2932 ..     1    21 [.    -0.1      5.4
OmpA              1/4    2927  2943 ..     1    17 [.     3.1      4.1
Nif11             1/4    2928  2937 ..    41    50 .]     0.7       29
Connexin50        1/3    2973  2990 ..    23    41 ..     1.0        6
Tymo_coat         1/3    3000  3020 ..    34    54 ..     0.9      9.8
DUF2283           1/3    3015  3025 ..    43    53 .]     2.1      8.8
efhand            2/6    3029  3053 ..     1    25 [.     1.2       36
Dockerin_1        2/5    3038  3044 ..     1     7 [.     1.6       23
HCV_NS4b          1/3    3058  3067 ..   190   199 .]     0.1      3.7
ADP_ribosyl_GH    1/3    3074  3089 ..   295   311 ..     1.0      3.7
DUF1757           1/3    3090  3108 ..    47    65 ..     2.1      2.5
NikM              1/3    3105  3121 ..   234   250 ..     1.0      4.5
Cna_B             1/3    3108  3118 ..    16    26 ..     1.3      7.5
DUF823            1/3    3108  3118 ..     1    12 [.     0.2      6.1
Pirin_C           1/3    3123  3133 ..     1    11 [.     0.9       17
Bystin            1/1    3127  3140 ..   292   305 ..    -0.6      9.3
LTXXQ             1/4    3128  3140 ..    11    23 .]     4.2      3.5
Herpes_UL1        1/3    3132  3144 ..   104   124 .]     1.0      8.7
SAM_PNT           2/4    3134  3147 ..    78    91 .]     0.4       16
Antimicrobial_7   1/3    3138  3154 ..     1    18 [.     1.9      5.5
Antimicrobial15   1/4    3139  3147 ..     1     9 [.     2.7      7.3
UBA_3             1/2    3162  3175 ..     7    20 ..     2.3      7.7
MxiH              1/2    3176  3184 ..    77    85 .]     1.5       12
HSP9_HSP12        1/2    3177  3187 ..    49    59 .]     0.4       13
CAMP_factor       1/2    3213  3233 ..   190   210 ..     2.9      1.3
Pentapeptide     24/70   3249  3288 ..     1    40 []    53.6  8.7e-14
SIC               1/3    3252  3273 ..    38    59 ..     1.8     0.79
Beta-lactamase    2/4    3278  3308 ..   357   386 .]     1.4      4.6
Lysis_col         1/3    3294  3305 ..    36    47 .]     1.2       23
Pentapeptide     25/70   3297  3336 ..     1    40 []    51.1  4.2e-13
Pentapeptide     26/70   3383  3422 ..     1    40 []    46.2  9.5e-12
Pentapeptide     27/70   3423  3442 ..    21    40 .]    11.8    0.028
TMP               2/6    3469  3477 ..     3    11 .]     1.1       62
Pentapeptide     28/70   3478  3511 ..     7    40 .]    33.9  2.4e-08
Pentapeptide     29/70   3512  3532 ..    21    40 .]     3.5      5.6
Pentapeptide     30/70   3554  3593 ..     1    40 []    19.5  0.00022
DGOK              1/2    3594  3604 ..   288   298 .]     1.9     0.39
F420_oxidored     2/3    3610  3638 ..   225   253 .]     5.1     0.42
DUF719            1/2    3626  3657 ..    85   114 ..     1.4      3.6
PKD               1/4    3643  3663 ..     1    35 [.     0.2       16
BSP               1/2    3652  3670 ..    86   104 ..     0.7      3.4
Ribosomal_L18p    1/2    3674  3681 ..   138   145 .]     0.9       12
Cloacin           2/3    3761  3789 ..     1    29 [.     1.9      2.1
DUF1386           2/3    3777  3783 ..     1     7 [.     0.3        6
DUF574            2/3    3790  3814 ..   253   283 .]     0.9      5.6
DNA_gyraseA_C     2/4    3797  3830 ..    14    53 .]     1.1       28
Memo              2/3    3798  3810 ..   321   333 .]     0.3      4.3
DUF2588           2/3    3855  3871 ..   130   146 .]     0.5       14
LpxK              2/3    3869  3886 ..   364   385 .]     1.5      4.5
Rep_fac_C         2/3    3869  3889 ..    51    72 ..     3.9      1.9
BESS              2/3    3877  3888 ..    26    37 .]     1.2       28
DUF59             2/3    3877  3890 ..     1    14 [.     4.5      1.9
Bombolitin        2/3    3879  3895 ..     1    17 []     1.6       18
CobU              2/3    3891  3899 ..   173   181 .]     3.5      1.2
DUF1771           2/3    3927  3940 ..     1    16 [.     2.5      6.9
Eclosion          2/3    3948  3959 ..    51    62 .]     3.1      2.6
FMN_bind          2/4    3951  3966 ..    99   114 .]     4.3      1.3
RuvA_C            3/4    3957  3968 ..     1    12 [.     2.6       12
Pentapeptide     31/70   3975  3990 ..    14    29 ..     3.9      4.3
Pentapeptide     32/70   3994  4033 ..     1    40 []    54.7  4.3e-14
Anemone_cytotox   2/3    4025  4044 ..     1    20 [.     0.3       12
Beta-trefoil      2/3    4033  4052 ..   113   132 ..     0.1      8.1
Pentapeptide     33/70   4039  4078 ..     1    40 []    38.6  1.2e-09
zf-CHC2           2/4    4043  4066 ..    75    98 .]     0.4       22
Pentapeptide     34/70   4135  4168 ..     7    40 .]    29.9  2.9e-07
WSK               2/3    4208  4221 ..     1    14 [.     6.5     0.76
TMP               3/6    4214  4224 ..     1    11 []     8.8     0.33
Pentapeptide     35/70   4224  4263 ..     1    40 []    33.2  3.7e-08
DUF2001           3/5    4269  4281 ..   139   151 .]     1.4      6.4
Pentapeptide     36/70   4269  4309 ..     5    40 .]     7.5     0.44
DUF2124           2/3    4283  4294 ..     1    12 [.     0.8      8.7
Gly_radical       2/3    4307  4325 ..     1    19 [.     3.9      1.9
Pentapeptide     37/70   4312  4322 ..     1    11 [.     1.0       28
Pentapeptide     38/70   4342  4372 ..    10    40 .]     6.0      1.2
Big_3             2/5    4354  4381 ..    24    46 ..     1.5       16
Pentapeptide     39/70   4373  4412 ..     1    40 []    28.4  7.7e-07
PHA_gran_rgn      2/4    4411  4424 ..    49    62 ..     0.0       38
OmpA              2/4    4491  4507 ..     1    17 [.     3.1      4.1
Nif11             2/4    4492  4501 ..    41    50 .]     0.7       29
Connexin50        2/3    4537  4554 ..    23    41 ..     1.0        6
Tymo_coat         2/3    4564  4584 ..    34    54 ..     0.9      9.8
DUF2283           2/3    4579  4589 ..    43    53 .]     2.1      8.8
efhand            3/6    4593  4617 ..     1    25 [.     1.2       36
Dockerin_1        3/5    4602  4608 ..     1     7 [.     1.6       23
HCV_NS4b          2/3    4622  4631 ..   190   199 .]     0.1      3.7
ADP_ribosyl_GH    2/3    4638  4653 ..   295   311 ..     1.0      3.7
DUF1757           2/3    4654  4672 ..    47    65 ..     2.1      2.5
NikM              2/3    4669  4685 ..   234   250 ..     1.0      4.5
Cna_B             2/3    4672  4682 ..    16    26 ..     1.3      7.5
DUF823            2/3    4672  4682 ..     1    12 [.     0.2      6.1
Pirin_C           2/3    4687  4697 ..     1    11 [.     0.9       17
LTXXQ             2/4    4692  4704 ..    11    23 .]     4.2      3.5
Herpes_UL1        2/3    4696  4708 ..   104   124 .]     1.0      8.7
SAM_PNT           3/4    4698  4711 ..    78    91 .]     0.4       16
Antimicrobial_7   2/3    4702  4718 ..     1    18 [.     1.9      5.5
Antimicrobial15   2/4    4703  4711 ..     1     9 [.     2.7      7.3
DUF2131           1/1    4713  4731 ..    49    67 .]     1.5      8.2
UBA_3             2/2    4726  4739 ..     7    20 ..     2.3      7.7
MxiH              2/2    4740  4748 ..    77    85 .]     1.5       12
HSP9_HSP12        2/2    4741  4751 ..    49    59 .]     0.4       13
CAMP_factor       2/2    4777  4797 ..   190   210 ..     2.9      1.3
Pentapeptide     40/70   4813  4852 ..     1    40 []    53.6  8.7e-14
SIC               2/3    4816  4837 ..    38    59 ..     1.8     0.79
Beta-lactamase    3/4    4842  4872 ..   357   386 .]     1.4      4.6
Lysis_col         2/3    4858  4869 ..    36    47 .]     1.2       23
Pentapeptide     41/70   4861  4900 ..     1    40 []    51.1  4.2e-13
Pentapeptide     42/70   4947  4986 ..     1    40 []    46.2  9.5e-12
Pentapeptide     43/70   4987  5006 ..    21    40 .]    11.8    0.028
TMP               4/6    5033  5041 ..     3    11 .]     1.1       62
Pentapeptide     44/70   5042  5075 ..     7    40 .]    33.9  2.4e-08
Pentapeptide     45/70   5076  5096 ..    21    40 .]     3.5      5.6
Pentapeptide     46/70   5118  5157 ..     1    40 []    19.5  0.00022
DGOK              2/2    5158  5168 ..   288   298 .]     1.9     0.39
F420_oxidored     3/3    5174  5202 ..   225   253 .]     5.1     0.42
DUF719            2/2    5190  5221 ..    85   114 ..     1.4      3.6
PKD               2/4    5207  5227 ..     1    35 [.     0.2       16
BSP               2/2    5216  5234 ..    86   104 ..     0.7      3.4
Ribosomal_L18p    2/2    5238  5245 ..   138   145 .]     0.9       12
Cloacin           3/3    5325  5353 ..     1    29 [.     1.9      2.1
DUF1386           3/3    5341  5347 ..     1     7 [.     0.3        6
DUF574            3/3    5354  5378 ..   253   283 .]     0.9      5.6
DNA_gyraseA_C     3/4    5361  5394 ..    14    53 .]     1.1       28
Memo              3/3    5362  5374 ..   321   333 .]     0.3      4.3
DUF2588           3/3    5419  5435 ..   130   146 .]     0.5       14
LpxK              3/3    5433  5450 ..   364   385 .]     1.5      4.5
Rep_fac_C         3/3    5433  5453 ..    51    72 ..     3.9      1.9
BESS              3/3    5441  5452 ..    26    37 .]     1.2       28
DUF59             3/3    5441  5454 ..     1    14 [.     4.5      1.9
Bombolitin        3/3    5443  5459 ..     1    17 []     1.6       18
CobU              3/3    5455  5463 ..   173   181 .]     3.5      1.2
DUF1771           3/3    5491  5504 ..     1    16 [.     2.5      6.9
Eclosion          3/3    5512  5523 ..    51    62 .]     3.1      2.6
FMN_bind          3/4    5515  5530 ..    99   114 .]     4.3      1.3
RuvA_C            4/4    5521  5532 ..     1    12 [.     2.6       12
Pentapeptide     47/70   5539  5554 ..    14    29 ..     3.9      4.3
Pentapeptide     48/70   5558  5597 ..     1    40 []    54.7  4.3e-14
Anemone_cytotox   3/3    5589  5608 ..     1    20 [.     0.3       12
Beta-trefoil      3/3    5597  5616 ..   113   132 ..     0.1      8.1
Pentapeptide     49/70   5603  5642 ..     1    40 []    38.6  1.2e-09
zf-CHC2           3/4    5607  5630 ..    75    98 .]     0.4       22
Pentapeptide     50/70   5699  5732 ..     7    40 .]    29.9  2.9e-07
WSK               3/3    5772  5785 ..     1    14 [.     6.5     0.76
TMP               5/6    5778  5788 ..     1    11 []     8.8     0.33
Pentapeptide     51/70   5788  5827 ..     1    40 []    33.2  3.7e-08
DUF2001           4/5    5833  5845 ..   139   151 .]     1.4      6.4
Pentapeptide     52/70   5833  5873 ..     5    40 .]     7.5     0.44
DUF2124           3/3    5847  5858 ..     1    12 [.     0.8      8.7
Gly_radical       3/3    5871  5889 ..     1    19 [.     3.9      1.9
Pentapeptide     53/70   5876  5886 ..     1    11 [.     1.0       28
Pentapeptide     54/70   5906  5936 ..    10    40 .]     6.0      1.2
Big_3             3/5    5918  5945 ..    24    46 ..     1.5       16
Pentapeptide     55/70   5937  5976 ..     1    40 []    28.4  7.7e-07
PHA_gran_rgn      3/4    5975  5988 ..    49    62 ..     0.0       38
OmpA              3/4    6055  6071 ..     1    17 [.     3.1      4.1
Nif11             3/4    6056  6065 ..    41    50 .]     0.7       29
Connexin50        3/3    6101  6118 ..    23    41 ..     1.0        6
Tymo_coat         3/3    6128  6148 ..    34    54 ..     0.9      9.8
DUF2283           3/3    6143  6153 ..    43    53 .]     2.1      8.8
efhand            4/6    6157  6181 ..     1    25 [.     1.2       36
Dockerin_1        4/5    6166  6172 ..     1     7 [.     1.6       23
HCV_NS4b          3/3    6186  6195 ..   190   199 .]     0.1      3.7
ADP_ribosyl_GH    3/3    6202  6217 ..   295   311 ..     1.0      3.7
DUF1757           3/3    6218  6236 ..    47    65 ..     2.1      2.5
NikM              3/3    6233  6249 ..   234   250 ..     1.0      4.5
Cna_B             3/3    6236  6246 ..    16    26 ..     1.3      7.5
DUF823            3/3    6236  6246 ..     1    12 [.     0.2      6.1
Pirin_C           3/3    6251  6261 ..     1    11 [.     0.9       17
LTXXQ             3/4    6256  6268 ..    11    23 .]     4.2      3.5
Herpes_UL1        3/3    6260  6272 ..   104   124 .]     1.0      8.7
SAM_PNT           4/4    6262  6275 ..    78    91 .]     0.4       16
Antimicrobial_7   3/3    6266  6282 ..     1    18 [.     1.9      5.5
Antimicrobial15   3/4    6267  6275 ..     1     9 [.     2.7      7.3
Sec3              1/1    6295  6346 ..   372   426 ..     7.8     0.02
Pentapeptide     56/70   6380  6419 ..     1    40 []    53.6  8.7e-14
SIC               3/3    6383  6404 ..    38    59 ..     1.8     0.79
Beta-lactamase    4/4    6409  6439 ..   357   386 .]     1.4      4.6
Lysis_col         3/3    6425  6436 ..    36    47 .]     1.2       23
Pentapeptide     57/70   6428  6467 ..     1    40 []    51.1  4.2e-13
Pentapeptide     58/70   6514  6553 ..     1    40 []    46.2  9.5e-12
Pentapeptide     59/70   6554  6573 ..    21    40 .]    11.8    0.028
R_equi_Vir        1/1    6572  6596 ..    55    79 ..     0.4        7
Big_3             4/5    6598  6626 ..    16    46 ..     0.1       40
Pentapeptide     60/70   6613  6652 ..     1    40 []    36.7    4e-09
Pentapeptide     61/70   6654  6663 ..     1    10 [.     2.5       10
Pentapeptide     62/70   6685  6724 ..     1    40 []    20.8  9.8e-05
DUF745            1/1    6717  6738 ..     1    23 [.     2.3      2.2
PNP_UDP_1         1/1    6719  6768 ..   224   277 .]     1.5      5.4
YceI              2/2    6770  6801 ..   152   186 .]     3.9      1.2
MmoB_DmpM         1/1    6778  6796 ..    71    89 .]     5.3     0.84
DUF763            1/1    6813  6818 ..     1     6 [.    -1.3      9.6
PKD               3/4    6897  6916 ..    72    92 .]     0.8       11
DUF342            1/1    6899  6933 ..     1    36 [.     0.7      4.5
Big_3             5/5    6904  6916 ..    56    70 .]     1.1       21
Gmad2             1/1    6913  6926 ..    83    98 .]     2.5      3.3
Peptidase_C39     1/2    6913  6935 ..    99   121 ..     1.0      9.5
Nop53             1/1    7008  7016 ..   450   458 .]    -1.5      8.5
MipZ              1/1    7094  7103 ..   258   267 .]     0.6      5.3
Pentapeptide     63/70   7113  7153 ..     1    40 []    38.2  1.5e-09
Endonuc-EcoRV     1/1    7127  7134 ..   244   252 .]    -0.3        8
AXH               1/1    7161  7171 ..     1    11 [.     0.6      8.3
Pentapeptide     64/70   7165  7204 ..     1    40 []    40.3  4.1e-10
DUF241            1/1    7175  7180 ..   265   270 .]    -0.4      3.6
Herpes_TK_C       1/2    7180  7185 ..    28    33 .]     1.8       23
Pentapeptide     65/70   7205  7244 ..     1    40 []    60.0  1.5e-15
DUF2006           1/1    7298  7310 ..   378   395 .]     0.1      1.3
DUF498            1/1    7307  7324 ..     1    18 [.     1.4      5.7
Sperm_act_pep     4/4    7314  7326 ..     1    10 []     1.4       47
Pentapeptide     66/70   7316  7329 ..    27    40 .]     8.1      0.3
Pentapeptide     67/70   7332  7364 ..     8    40 .]    20.9    9e-05
Herpes_TK_C       2/2    7359  7365 ..    27    33 .]     2.5       15
LAGLIDADG_1       1/1    7362  7370 ..     1     9 [.     5.0      1.3
Pentapeptide     68/70   7418  7432 ..     9    23 ..     3.4      5.9
Pentapeptide     69/70   7438  7464 ..     1    27 [.     7.8     0.37
MOSP_C            1/1    7478  7491 ..    63    76 ..     2.4      1.1
DUF2001           5/5    7607  7614 ..   144   151 .]     2.8      2.7
Sod_Fe_N          1/1    7609  7618 ..     1    10 [.     0.8      8.6
Plug              1/1    7635  7677 ..    53   104 .]     5.6     0.52
Pentapeptide     70/70   7642  7655 ..    27    40 .]     6.5     0.84
L_lac_phage_MSP   1/1    7770  7781 ..   290   301 .]     0.5      5.1
PSGP              2/2    7825  7837 ..     1    13 []     1.5       27
Peptidase_C39     2/2    7848  7865 ..   103   120 ..     0.3       15
Phage-tail_1      1/1    7863  7872 ..   188   197 .]     3.9     0.24
Nif11             4/4    7889  7901 ..    36    50 .]     0.3       36
DUF2453           1/1    7954  7961 ..     1     8 [.     0.9      9.4
Hep_Hag           1/3    7988  8009 ..     1    22 [.     1.9       23
Attractin         1/1    8037  8044 ..    48    55 .]     1.7      8.1
DASH_Ask1         1/1    8086  8097 ..    57    68 .]     3.5      3.4
FecR              1/1    8140  8153 ..    91   104 .]     2.8      4.3
Gag_p17           1/1    8215  8225 ..     1    11 [.     2.1      4.2
Corona_S2         1/1    8240  8256 ..     1    17 [.    -0.4      4.7
UPF0079           1/1    8330  8357 ..   107   135 .]     2.4        6
Inhibitor_I68     1/1    8357  8365 ..     1    10 [.     3.0      1.1
DUF387            1/1    8369  8379 ..   154   164 .]     1.5      8.1
PI3_PI4_kinase    1/1    8386  8403 ..   308   325 .]     3.0      2.2
Flagellin_IN      1/6    8446  8481 ..     1    44 [.     7.1     0.37
DUF1914           1/1    8487  8501 ..     1    17 [.     1.6      7.7
Gp5_C             1/6    8489  8501 ..     1    13 [.     3.0      8.4
TES               1/1    8494  8508 ..     1    16 [.     2.5      5.2
Laminin_G_1       1/1    8529  8538 ..     1    10 [.     0.6      9.9
FBPase_glpX       1/1    8533  8541 ..   223   231 ..     0.0      6.3
Peptidase_A4      1/2    8697  8729 ..   175   210 ..     2.2      1.1
Flagellin_IN      2/6    8700  8756 ..     1    63 []     5.1      1.4
EB_dh             1/1    8742  8764 ..   343   368 ..    -0.1      7.3
DUF211            1/1    8743  8757 ..    44    58 ..     0.1      6.9
Glyco_hydro_3     1/1    8765  8776 ..   232   243 .]     2.5      1.7
SPOR              1/1    8810  8832 ..     1    22 [.     4.0      1.5
PTS_EIIA_2        1/1    8828  8844 ..   137   153 .]     2.3      4.7
BiPBP_C           1/1    8906  8924 ..    76    94 .]     2.9      3.2
OpuAC             1/1    9062  9091 ..   268   296 .]     1.2      6.9
Phage_Coat_Gp8    1/1    9073  9087 ..     1    15 [.     1.3      8.3
BMC               1/2    9093  9116 ..    52    80 .]     0.2       39
DUF2401           1/1    9232  9244 ..   241   253 .]     1.0      6.3
Urm1              1/1    9254  9261 ..     1     8 [.    -1.2      4.3
FeThRed_B         1/1    9309  9322 ..     1    15 [.     1.1      6.7
DOMON             1/1    9510  9532 ..     1    23 [.     4.3      1.8
Fimbrial          1/1    9579  9611 ..    65    99 ..     0.5      9.4
Cys_Met_Meta_PP   1/1    9614  9626 ..   417   429 .]    -0.2      7.9
PalI              1/1    9674  9695 ..     1    27 [.     2.9      4.3
PapG_C            1/1    9775  9784 ..     1    11 [.     2.3      2.6
NAD_binding_3     1/1    9798  9820 ..   109   131 ..     4.2      1.5
SRP1_TIP1         1/1    9849  9865 ..    99   115 .]     4.8     0.77
DUF859            1/1    9892  9904 ..   662   674 .]    -1.2      5.7
Borrelia_rep      1/1    9902  9915 ..     5    18 .]     3.1      7.8
TMP               6/6    9993 10003 ..     1    11 []     3.2       15
Orthopox_F7       1/1   10024 10046 ..    60    82 .]     2.0      2.8
Antimicrobial15   4/4   10027 10043 ..     1    19 []     0.6       34
DUF2150           1/1   10051 10068 ..   175   192 .]     8.0    0.078
Dala_Dala_lig_N   1/1   10075 10083 ..   136   144 .]     0.1      8.8
AmoC              1/1   10107 10134 ..   229   256 .]     2.8      1.5
POC4              1/1   10205 10215 ..   270   280 .]     1.3     0.57
Bile_Hydr_Trans   1/1   10229 10244 ..   119   134 .]     2.1      4.9
Chitin_bind_4     1/2   10263 10276 ..    46    59 ..     0.8       18
zf-CHC2           4/4   10274 10291 ..    65    82 ..     3.5      2.9
Alpha-L-AF_C      1/1   10283 10324 ..   140   185 ..     1.5      6.2
DUF1873           1/1   10290 10295 ..   107   112 .]     1.4      2.9
PKD               4/4   10309 10349 ..     1    57 [.     3.1      2.1
DNA_gyraseA_C     4/4   10354 10372 ..    32    53 .]     0.1       51
CUB               1/1   10423 10435 ..   104   116 .]     0.7      8.9
Attacin_N         2/4   10436 10458 ..    44    67 .]     8.2     0.19
Attacin_N         3/4   10470 10479 ..     1    10 [.     0.8       23
SEA               1/1   10483 10584 ..     1   121 []     1.4      9.3
L-fibroin         1/1   10507 10529 ..   255   277 .]     5.1     0.68
OmpA              4/4   10509 10530 ..     1    22 [.     1.2       14
SLT_beta          1/1   10520 10553 ..    36    70 .]     2.1      4.3
Peptidase_C69     1/1   10526 10543 ..    94   111 ..     0.1      4.6
Vac_Fusion        1/1   10622 10643 ..     1    22 [.     2.4     0.78
DUF1025           1/1   10624 10633 ..     1    10 [.     1.3      8.4
UPF0061           1/1   10628 10645 ..   614   631 .]    -1.0        9
CRT10             1/1   10658 10669 ..  1010  1021 .]     1.8      1.8
DASH_Dad4         1/1   10682 10694 ..     1    13 [.     0.9      8.6
Utp13             1/1   10700 10708 ..   142   150 .]     0.6      9.2
DUF583            1/2   10725 10734 ..    89    98 .]     0.6       17
PHA_gran_rgn      4/4   10736 10752 ..    75    91 .]     2.4      9.2
FMN_bind          4/4   10741 10755 ..   100   114 .]     0.0       21
Dockerin_1        5/5   10773 10781 ..     1     9 [.     0.2       63
efhand            5/6   10773 10792 ..    10    29 .]     5.3      2.7
DUF915            1/1   10801 10816 ..   197   212 ..     0.1      7.6
ThiS              1/1   10818 10828 ..    81    91 .]     0.7      5.2
Sigma70_r3        1/1   10844 10866 ..    61    83 .]     6.4     0.62
Big_1             1/1   10975 10993 ..    87   106 .]     0.5      9.9
PPC               1/2   10989 11065 ..     1    85 []     2.9      3.9
Flagellin_IN      3/6   11002 11065 ..     1    63 []     1.2       18
STN               1/1   11031 11064 ..    24    53 .]     4.6      1.7
Filamin           1/1   11048 11063 ..    62    79 ..     6.1     0.41
efhand            6/6   11142 11154 ..    10    22 ..     1.0       41
DUF946            1/1   11180 11189 ..     1    10 [.    -0.2     0.91
Herpes_gE         1/1   11200 11214 ..   499   514 .]    -0.2      3.6
BMC               2/2   11338 11352 ..    47    61 ..     3.0        7
Hep_Hag           2/3   11348 11367 ..     1    20 [.     1.3       34
Monooxygenase_B   1/1   11387 11406 ..   131   150 ..     0.7        4
Opacity           1/1   11487 11496 ..   180   189 .]     2.4      5.2
Linocin_M18       1/1   11503 11524 ..   140   165 ..     2.9      1.1
DUF790            1/1   11526 11538 ..   432   444 .]     1.3      4.7
RAMPs             1/1   11526 11562 ..   107   195 ..     0.0      8.9
Endonuc-HincII    1/1   11554 11569 ..     1    18 [.     0.1      8.6
ACP_syn_III       1/1   11596 11611 ..    64    86 .]     5.3      1.2
PEP-utilizers     1/1   11610 11621 ..    80    92 .]     2.6      5.2
HemolysinCabind   3/36  11676 11684 ..    10    18 .]     1.9       21
HemolysinCabind   4/36  11697 11714 ..     1    18 []    18.9  0.00015
Gp5_C             2/6   11701 11724 ..     1    24 []     1.7       21
HemolysinCabind   5/36  11722 11732 ..     8    18 .]     6.1      1.1
HemolysinCabind   6/36  11740 11750 ..     8    18 .]     3.6      6.3
CHASE4            1/1   11748 11764 ..    23    42 ..     1.6      6.3
Reo_P9            1/1   11774 11784 ..   346   356 .]    -1.2      9.1
WW                1/1   11794 11806 ..    18    30 .]     2.7      8.6
Avian_gp85        1/1   11799 11811 ..     1    14 [.     3.0      1.1
HemolysinCabind   7/36  11813 11830 ..     1    18 []     2.2       17
Cytokin-bind      1/1   11819 11830 ..    13    24 ..    -0.9      8.9
DUF583            2/2   11870 11884 ..    84    98 .]     1.9      7.1
HemolysinCabind   8/36  11943 11960 ..     1    18 []     9.1     0.14
T4_gp9_10         1/1   11956 11967 ..     1    12 [.     4.3     0.48
HemolysinCabind   9/36  11961 11978 ..     1    18 []    17.0  0.00055
DUF2095           1/1   11998 12011 ..   116   129 .]     2.8      2.4
HemolysinCabind  10/36  12014 12031 ..     1    18 []     8.3     0.24
HemolysinCabind  11/36  12032 12049 ..     1    18 []    16.0   0.0011
Proteasome_A_N    1/2   12052 12073 ..     1    23 []     3.1      8.7
RHS_repeat        1/1   12058 12075 ..     1    18 [.     2.3      8.4
HemolysinCabind  12/36  12072 12089 ..     1    18 []     0.3       64
HemolysinCabind  13/36  12090 12107 ..     1    18 []     6.6     0.78
RTX               1/1   12109 12119 ..   657   667 .]    -1.0      3.7
HemolysinCabind  14/36  12139 12156 ..     1    18 []     0.6       52
Plasmod_MYXSPDY   1/1   12177 12192 ..     1    17 []     4.7      3.1
DUF1391           1/2   12199 12212 ..     1    14 [.     2.0      8.4
HemolysinCabind  15/36  12202 12219 ..     1    18 []     3.0      9.5
Glyco_hydro_65C   2/3   12236 12254 ..    39    56 .]     1.3       20
Proteasome_A_N    2/2   12237 12253 ..     1    18 [.     1.4       26
PGA2              1/1   12241 12249 ..     1     9 [.     2.0      3.5
Gp5_C             3/6   12288 12299 ..     1    12 [.     1.0       36
HemolysinCabind  16/36  12335 12340 ..    13    18 .]     0.7       48
CamS              1/4   12340 12350 ..   343   353 .]     1.6        3
HemolysinCabind  17/36  12341 12358 ..     1    18 []     3.7      6.1
Flagellin_N       1/3   12344 12376 ..   107   141 .]     0.6       14
Phage_HK97_TLTM   1/1   12361 12372 ..   276   287 .]    -0.8      9.6
Calsarcin         1/3   12394 12414 ..   292   312 .]     0.4      2.1
Rrp15p            1/2   12422 12438 ..     1    17 [.     2.1      5.9
DUF1631           1/1   12459 12473 ..   860   874 .]    -1.7      8.4
HemolysinCabind  18/36  12466 12476 ..     8    18 .]     1.0       39
CamS              2/4   12476 12486 ..   343   353 .]     1.6        3
HemolysinCabind  19/36  12477 12494 ..     1    18 []     3.7      6.1
Flagellin_N       2/3   12480 12512 ..   107   141 .]     0.6       14
Calsarcin         2/3   12530 12550 ..   292   312 .]     0.4      2.1
HemolysinCabind  20/36  12602 12612 ..     8    18 .]     1.0       39
CamS              3/4   12612 12622 ..   343   353 .]     1.6        3
HemolysinCabind  21/36  12613 12630 ..     1    18 []     3.7      6.1
Flagellin_N       3/3   12616 12648 ..   107   141 .]     0.6       14
Calsarcin         3/3   12666 12686 ..   292   312 .]     0.4      2.1
Rrp15p            2/2   12694 12710 ..     1    17 [.     2.1      5.9
Baculo_VP39       1/1   12739 12754 ..   314   329 .]     0.1      7.7
HemolysinCabind  22/36  12745 12750 ..    13    18 .]     0.7       48
CamS              4/4   12750 12760 ..   343   353 .]     1.6        3
HemolysinCabind  23/36  12751 12768 ..     1    18 []     0.1       74
Myosin_N          1/1   12766 12784 ..    24    44 .]     3.6      4.5
Glyco_hydro_65C   3/3   12781 12800 ..    38    56 .]     0.7       29
DUF1177           1/1   12792 12804 ..   268   280 .]    -0.1      7.6
HemolysinCabind  24/36  12821 12838 ..     1    18 []     5.8      1.4
Glyco_hydro_19    1/1   12828 12839 ..     1    12 [.     1.3      3.4
TIP41             1/1   12849 12855 ..     1     7 [.     2.4      3.7
TarH              1/1   12856 12880 ..     1    25 [.     5.2     0.81
DUF30             1/1   12857 12870 ..    72    85 .]     2.6      3.6
Gp5_C             4/6   12884 12907 ..     1    24 []     2.7       11
HemolysinCabind  25/36  12889 12906 ..     1    18 []     3.6      6.4
DUF1505           1/1   12901 12910 ..   119   128 .]     0.7      9.3
HemolysinCabind  26/36  12960 12967 ..    11    18 .]     0.9       41
HemolysinCabind  27/36  13026 13038 ..     6    18 .]     0.3       62
Hep_Hag           3/3   13034 13045 ..    17    28 .]     3.5      8.5
Fn_bind           1/1   13052 13079 ..    11    44 .]     5.2      1.9
HemolysinCabind  28/36  13053 13063 ..     8    18 .]     1.0       39
DUF2431           1/1   13171 13177 ..     1     7 [.    -0.3      7.7
HemolysinCabind  29/36  13172 13189 ..     1    18 []     6.9     0.64
Prefoldin         1/1   13217 13229 ..    68    80 ..     2.5      5.4
HemolysinCabind  30/36  13270 13279 ..     1    10 [.     2.6       13
DUF844            1/1   13281 13302 ..   357   378 .]     1.1      4.1
S-AdoMet_synt_C   1/1   13330 13341 ..     1    12 [.     0.4        6
DUF1547           1/2   13340 13360 ..    43    63 .]     2.0      6.6
LTXXQ             4/4   13376 13388 ..    11    23 .]     1.4       23
HemolysinCabind  31/36  13419 13433 ..     4    18 .]     3.3      7.8
CbiD              1/1   13437 13459 ..   283   305 .]     0.2        9
Gp5_C             5/6   13448 13463 ..     9    24 .]     0.4       52
DUF1547           2/2   13449 13475 ..    37    63 .]     4.9     0.89
Gp5_C             6/6   13488 13511 ..     1    24 []     1.4       26
HemolysinCabind  32/36  13492 13500 ..     1     9 [.     2.7       12
ClpB_D2-small     1/1   13497 13510 ..    78    95 .]     1.5      5.8
Eapp_C            1/1   13530 13535 ..   147   152 .]     0.9      9.4
HemolysinCabind  33/36  13531 13542 ..     7    18 .]     5.9      1.2
DUF2420           1/1   13569 13582 ..   101   114 .]     2.6      3.2
DUF1391           2/2   13586 13599 ..     1    14 [.     0.4       22
HemolysinCabind  34/36  13589 13606 ..     1    18 []     6.8     0.66
Glucodextran_N    1/1   13629 13648 ..   235   254 ..    -1.3      8.4
Flagellin_IN      4/6   13657 13681 ..     1    32 [.     3.4      4.3
HemolysinCabind  35/36  13660 13669 ..     9    18 .]     1.6       26
MspA              2/2   13663 13681 ..     1    22 [.     1.9      4.3
Hum_adeno_E3A     1/1   13682 13708 ..     1    27 [.     1.7      3.1
Chitin_bind_4     2/2   13693 13705 ..    39    51 ..     4.2      1.9
CRC_subunit       1/1   13724 13737 ..    34    50 ..     0.9      8.4
HemolysinCabind  36/36  13733 13747 ..     4    18 .]     5.5      1.7
DUF2026           1/1   13765 13778 ..   194   207 .]     0.7      2.7
NosD              1/1   13794 13816 ..    51    74 .]     3.2        5
Fil_haemagg       1/1   13814 13852 ..     1    32 [.     3.2      3.5
PIN_2             1/1   13838 13862 ..   109   134 .]     3.2      3.7
Como_SCP          1/1   13852 13872 ..    34    55 ..     0.3        7
CBM_6             1/1   13853 13866 ..    77    90 ..     1.6      4.5
DUF1973           1/1   13863 13879 ..    85   101 ..    -0.4      5.3
PPC               2/2   13885 13948 ..     1    85 []     4.7      1.2
Flagellin_IN      5/6   13888 13914 ..     1    31 [.     0.6       26
Haemagg_act       1/1   13920 13965 ..     1    50 [.     5.7     0.38
gerPA             1/1   13935 13950 ..    60    75 .]     1.5      7.8
Peptidase_A4      2/2   13975 13991 ..   124   140 ..     0.0        5
OpcA              1/1   13982 13994 ..     1    13 [.    -0.8      8.9
DUF1484           1/1   14069 14081 ..    98   110 .]     1.7      7.2
Flagellin_IN      6/6   14089 14115 ..     1    31 [.     0.5       27
TIR-like          1/1   14160 14167 ..   118   125 .]     2.2      4.6
MIP-T3            1/1   14170 14185 ..   575   589 .]     0.6      3.1
Attacin_N         4/4   14188 14213 ..     1    27 [.     2.5      7.2
MyTH4             1/1   14318 14328 ..   112   122 .]     2.5      3.6
Radial_spoke      1/1   14319 14335 ..   603   619 .]     0.7      2.8
MHC2-interact     1/1   14330 14359 ..     1    34 [.     2.6      2.7
Peptidase_C27     1/1   14756 14767 ..   155   166 .]    -0.6      9.6
DUF1388           1/2   14788 14816 ..     1    29 []     4.2      2.4
DUF1388           2/2   14818 14846 ..     1    29 []     8.0      0.2
Phosducin         1/1   14829 14846 ..     1    19 [.     0.7      4.8

Alignments of top-scoring domains:
Planc_extracel: domain 1 of 1, from 31 to 58: score 16.6, E = 6.2e-05
                   *->rrrrrrrrrsrrrrRRLrlEsLEsRrLL<-*
                       r+ r rr +  r+RRL++E+LE R +L
  gi|1179254    31    ARTGRGRRYAQGRQRRLLVENLEPRFML    58

Glyco_hydro_85: domain 1 of 1, from 59 to 70: score 0.3, E = 6.6
                   *->aGEGiVtiPpvd<-*
                      +GEG+V++P++d
  gi|1179254    59    SGEGLVLPPTPD    70

GA: domain 1 of 1, from 126 to 139: score 3.1, E = 7.8
                CS    SSHHHHHHHHHHHH
                   *->tTvegVkdlkakAk<-*
                      +Tve+++ l+++A+
  gi|1179254   126    PTVEDAQGLVNEAL    139

Proteasome: domain 1 of 1, from 127 to 155: score 1.3, E = 5.6
                CS    CHHHHHHHHHHHHHHHHHHBTTSGSGEEEEEE
                   *->tleeaielaikAlkeaierdalsggnievavi<-*
                      t+e+a  l+ +Al++  +    s g++ev+++
  gi|1179254   127    TVEDAQGLVNEALSNHND---RSEGGVEVVWL    155

Flu_B_M2: domain 1 of 1, from 189 to 202: score 0.9, E = 7.1
                   *->iKmGetvLEvEeLq<-*
                      iK+G t L++E L
  gi|1179254   189    IKLGSTTLDLEGLA    202

PSGP: domain 1 of 2, from 248 to 260: score 3.7, E = 5.8
                   *->DdAtsEAAtGPsg<-*
                      D A sE  tG s
  gi|1179254   248    DVAASENLTGASN    260

Phytase: domain 1 of 1, from 307 to 340: score -0.5, E = 7.8
                CS    -S--EEEE  E-SSS S--S-EEEEEEEE-STT-
                   *->GskGtvvD..RAdGd.HLtaDiEGLtiYYAadGK<-*
                      Gs G v+D +  +Gd H t D  G+t+ YA +G+
  gi|1179254   307    GSAGDVLDfsDVTGDlHFTIDNNGVTVRYADEGR    340

Glyco_hydro_65C: domain 1 of 3, from 322 to 355: score 5.7, E = 1.2
                   *->lkvaidakrvtitllgGdapLtirvaGkevtLdg<-*
                      l ++id++ vt++  ++++  ti++ G ++tL+g
  gi|1179254   322    LHFTIDNNGVTVRYADEGRSETIETTGGSYTLKG    355

Methyltransf_6: domain 1 of 1, from 327 to 333: score 0.5, E = 9.3
                CS    ETTEEEE
                   *->DndGivV<-*
                      Dn+G++V
  gi|1179254   327    DNNGVTV    333

4HBT: domain 1 of 1, from 328 to 349: score 3.3, E = 4.5
                CS    -HHHHHHHHHHHHHHHHHHTSC
                   *->hGGvylalaDeaagaaarslgg<-*
                      ++Gv++++aDe++++ + + gg
  gi|1179254   328    NNGVTVRYADEGRSETIETTGG    349

HemolysinCabind: domain 1 of 36, from 352 to 362: score 6.5, E = 0.82
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      tL Gg GnD++
  gi|1179254   352    TLKGGLGNDLF    362

HemolysinCabind: domain 2 of 36, from 373 to 382: score 1.1, E = 37
                CS    EEEESSCGEE
                   *->LyGgaGnDtl<-*
                      ++GgaG D
  gi|1179254   373    IDGGAGKDHV    382

Patatin: domain 1 of 1, from 443 to 457: score 0.4, E = 9.9
                   *->vDGGvvaNnPvllar<-*
                      +DG ++ ++P+l++
  gi|1179254   443    QDGLISTTLPILDMS    457

DUF1627: domain 1 of 1, from 466 to 495: score 1.7, E = 3.3
                   *->ieqrGpqtadELAtlFGvtsRkvastLAma<-*
                       +  G    dEL  l G+ s  + s+LA a
  gi|1179254   466    FGLAGVNSQDELTDLLGIDSGEMDSALAAA    495

Hydrolase_2: domain 1 of 1, from 484 to 510: score 2.7, E = 5.8
                   *->ndeawpkakeAAraALpsGerrdPtggAl<-*
                      ++ ++++a++AA+aA+ sG+  d  ++A+
  gi|1179254   484    DSGEMDSALAAADAAI-SGS-TDMGLWAD    510

SBP_bac_5: domain 1 of 1, from 529 to 614: score 1.4, E = 3.1
                CS    TT-BTSCT.SS.EEE.E...EEEEEEEETSH HHHHHHHHHHHHHHH
                   *->aGykggggggrrkevavkgpallllltnddp.lkalAeaiqqqLakN
                      aG+ +++g+ r +        l ++ t+  ++ + l +ai+q+La+
  gi|1179254   529    AGLYDQWGEVRFD--------LDFTSTTSFTtPVTLSDAITQALAQ- 566

                CS HCT....EEEEEEEE-HHHHHTTT--...............HHHHHH.H.
                   liGeqnlikvelktleptfsdadwatyvatptdsdpevrdladdlldaep
                    +G    +++++ +                                 +
  gi|1179254   567 -AG----LELNVSSD-------------------------------LTV- 579

                CS HHHTT-SEEEEEEE-TTSCTH HHHHCCSCT C T
                   vlegdfdlallgwgadypdpp.fldpflsat.g.g<-*
                    ++ +  ++++ ++a+++d ++  + f++  + ++
  gi|1179254   580 EASLGGGVGVGVMLAGVTDLDtATSGFDGFLrVdP    614

GspM: domain 1 of 1, from 551 to 570: score 2.1, E = 4.1
                CS    -----HHHHHHHHHHHCT--
                   *->ptpaalsgvitrSAarqGLt<-*
                      +tp++ls++it+++a+ GL+
  gi|1179254   551    TTPVTLSDAITQALAQAGLE    570

DUF983: domain 1 of 1, from 606 to 614: score 2.4, E = 4
                   *->FrGfLKvrp<-*
                      F+GfL+v p
  gi|1179254   606    FDGFLRVDP    614

GSDH: domain 1 of 1, from 653 to 673: score 1.2, E = 8.1
                   *->sqalirLsLdgdkVteeeRll<-*
                      +qa +r++Ld+    ++ R++
  gi|1179254   653    LQAMARMQLDDAAADGQGRIS    673

Cenp-F_leu_zip: domain 1 of 1, from 746 to 767: score 1.6, E = 5.1
                   *->qikeesktavemLqtqLKeLnE<-*
                      qi  e+k +++ L  qL++L E
  gi|1179254   746    QIGQELKESLLGLLGQLQGLGE    767

DUF1969: domain 1 of 1, from 767 to 774: score 1.7, E = 2.3
                   *->QNLPyGVF<-*
                      +NLP+G F
  gi|1179254   767    ENLPFGLF    774

MR_MLE_N: domain 1 of 1, from 781 to 790: score 3.6, E = 0.8
                CS    TTSBHHHHTT
                   *->lnlPladLLG<-*
                      l+++l++L+G
  gi|1179254   781    LGQSLSQLIG    790

Pkinase_C: domain 1 of 2, from 813 to 822: score 0.5, E = 33
                CS    GTT--EE---
                   *->FrGFtYvnpe<-*
                      F G++++  +
  gi|1179254   813    FDGYSFSGTD    822

OSCP: domain 1 of 1, from 825 to 837: score 1.0, E = 8.4
                CS    XXXXXXXXXXXXX
                   *->SvrgkLerlarqL<-*
                      Svrg L++l++++
  gi|1179254   825    SVRGLLQTLNDAM    837

RuvA_C: domain 1 of 4, from 831 to 842: score 0.6, E = 38
                CS    HHHHHCCHHHHH
                   *->daleeAvsALla<-*
                      + l++A++ALla
  gi|1179254   831    QTLNDAMAALLA    842

AKAP_110: domain 1 of 1, from 850 to 857: score -1.1, E = 4.6
                   *->LDWlmvnL<-*
                      LDW ++nL
  gi|1179254   850    LDWSGANL    857

Pentapeptide: domain 1 of 70, from 867 to 906: score 45.0, E = 2.1e-11
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       +L+g +++gA+L+gad+sg dL+g n+ gA+Lsga++s+
  gi|1179254   867    FDLRGMDFSGANLKGADFSGLDLSGINFAGADLSGAIFSN    906

Beta-lactamase: domain 1 of 4, from 896 to 926: score 0.2, E = 9.3
                CS    SSTEEEEEEESESSCHHHH HHHHHHHHHHH
                   *->raglgvavltNrdgpnpda.adarlialaaa<-*
                      +a+l+ a+++N+  ++  +++d+ ++ l +
  gi|1179254   896    GADLSGAIFSNGADRATLRgVDFSAAILDGI    926

Pentapeptide: domain 2 of 70, from 911 to 950: score 41.4, E = 2e-10
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a L+g++++ A+L g+d+sg dL+g  L gA L+g+n+sg
  gi|1179254   911    ATLRGVDFSAAILDGIDFSGLDLRGIKLDGAWLNGVNFSG    950

Peptidase_A22B: domain 1 of 1, from 969 to 988: score 2.3, E = 2.3
                CS    XXXXXXXXXXXXXXXXXXXX
                   *->tlllvAlwRgELkklWsyse<-*
                      ++l++Al +++L++l+ + +
  gi|1179254   969    PTLTHALTNRDLSDLFGGAS    988

Sperm_act_pep: domain 1 of 4, from 995 to 1004: score 0.6, E = 81
                   *->GFsLgGgGVg<-*
                      G++L  +GVg
  gi|1179254   995    GYGLDLSGVG    1004

Pentapeptide: domain 3 of 70, from 1006 to 1039: score 22.2, E = 4e-05
                CS    B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->nLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      +L+g+dL+g dLsg ++ +  + gAnL+g+++ +
  gi|1179254  1006    DLSGFDLSGLDLSGINFADISFAGANLRGSRFFD    1039

Sperm_act_pep: domain 2 of 4, from 1078 to 1087: score 3.3, E = 13
                   *->GFsLgGgGVg<-*
                      GFsLg gGV
  gi|1179254  1078    GFSLGWGGVL    1087

Pentapeptide: domain 4 of 70, from 1093 to 1132: score 28.2, E = 8.6e-07
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       n+sg + +g+dL+g dL+g dL+g +L+gAn+sga+L +
  gi|1179254  1093    GNFSGFDWSGFDLSGLDLRGFDLSGLTLRGANMSGARLDD    1132

Abhydrolase_1: domain 1 of 1, from 1103 to 1138: score 0.2, E = 9.7
                CS    CEEEEECTTTSTTSSEE..    GGCCGGGSHHHHH
                   *->fdvialDlrGfGqSsrpkr....gapdladyrfddl<-*
                      fd  +lDlrGf  S  ++r+ + ++  l+d++++d+
  gi|1179254  1103    FDLSGLDLRGFDLSGLTLRganmSGARLDDTTTMDA    1138

SAM_PNT: domain 1 of 4, from 1103 to 1120: score 0.5, E = 15
                CS    TT-SS--GGGCSSS-HHHH
                   *->fsLepidfskFadmsGkeL<-*
                      f+L++ d++ F d+sG +L
  gi|1179254  1103    FDLSGLDLRGF-DLSGLTL    1120

DUF2001: domain 1 of 5, from 1128 to 1151: score 5.6, E = 0.42
                   *->AdfevgsDeilEeEvPFTFeDfelld<-*
                      A ++++    ++  ++F F+D+  +d
  gi|1179254  1128    ARLDDT--TTMDATTDFSFSDWQGVD    1151

Pentapeptide: domain 5 of 70, from 1141 to 1174: score 3.4, E = 5.9
                CS    B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->nLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      +++ +d +g+dLsg       ++g n+ g ++ g
  gi|1179254  1141    DFSFSDWQGVDLSGLSTLLGQFRGVNFAGIDFAG    1174

DUF1326: domain 1 of 1, from 1152 to 1173: score 6.1, E = 0.28
                   *->favlAsLvgevlgverAPIdFe<-*
                      +++l++L g+++gv +A IdF+
  gi|1179254  1152    LSGLSTLLGQFRGVNFAGIDFA    1173

NO_synthase: domain 1 of 1, from 1173 to 1191: score -1.1, E = 7.5
                CS    SEEEEETTEEES---EE--
                   *->SnMlLdiGGLeFtacpFnG<-*
                      ++  +d+G L+Fta  F+G
  gi|1179254  1173    AGISFDVGSLDFTAVNFSG    1191

Pentapeptide: domain 6 of 70, from 1243 to 1282: score 36.6, E = 4.2e-09
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      ++Lsg +L+g d++ga + g+ + g+ L gAnLsg++Lsg
  gi|1179254  1243    SDLSGRDLSGGDFSGASFFGSLFDGVRLDGANLSGVDLSG    1282

YceI: domain 1 of 2, from 1325 to 1353: score 3.0, E = 2
                   *->GigygspllgkgamglksvgdeVtltidleak<-*
                      G   ++ ++g+   g  + gd+V+l+++l+a+
  gi|1179254  1325    GAPGPAFAFGG---GVAFNGDRVELKLNLQAN    1353

Fmp27_GFWDK: domain 1 of 1, from 1419 to 1426: score 2.1, E = 0.75
                   *->GSrDPYki<-*
                      +S DPY+i
  gi|1179254  1419    ASFDPYMI    1426

FAD_binding_9: domain 1 of 1, from 1461 to 1477: score 1.5, E = 9.5
                   *->rAqpGDtlgiaGPggsf<-*
                      +Aq+G ++ +a+P+g
  gi|1179254  1461    DAQVGARISLADPNGDG    1477

efhand: domain 1 of 6, from 1463 to 1491: score 14.5, E = 0.0082
                CS    HHHHHHHHHTTTSSSEEHHHHHHHHHHHH
                   *->elkeaFkefDkDgDGkIsfeEfkaalkkl<-*
                      ++ + ++++D +gDGk+sf E+ a+ ++
  gi|1179254  1463    QVGARISLADPNGDGKLSFSELAALQEAD    1491

SPARC_Ca_bdg: domain 1 of 1, from 1472 to 1487: score 3.2, E = 1.9
                   *->DtnPsDryLShsELapl<-*
                      D n +D++LS+sELa+l
  gi|1179254  1472    DPN-GDGKLSFSELAAL    1487

DUF2406: domain 1 of 1, from 1486 to 1494: score 0.6, E = 9
                   *->AvqEAQPfe<-*
                      A+qEA P++
  gi|1179254  1486    ALQEADPTA    1494

PGA_cap: domain 1 of 1, from 1550 to 1556: score 0.6, E = 5.4
                   *->GNFifdq<-*
                      G+Fif+q
  gi|1179254  1550    GDFIFNQ    1556

Adeno_PIX: domain 1 of 1, from 1585 to 1595: score 3.4, E = 1.7
                   *->eGeVftpFLTa<-*
                      +G+ ++ FLT+
  gi|1179254  1585    DGALNSAFLTT    1595

Pentapeptide: domain 7 of 70, from 1685 to 1724: score 49.7, E = 1e-12
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                        L+g +++gA+L+gad++gAdL+gA + gA+Lsga + g
  gi|1179254  1685    QSLRGFDFTGANLTGADFRGADLSGASFAGADLSGALFVG    1724

Pentapeptide: domain 8 of 70, from 1734 to 1773: score 40.7, E = 3.2e-10
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a+L+++nL+gA L g  L g dL+gAnL +++Lsg++Ls+
  gi|1179254  1734    AILNDVNLSGATLGGLSLAGLDLRGANLAHTDLSGVDLSN    1773

NRPS: domain 1 of 1, from 1763 to 1771: score 0.6, E = 4.8
                   *->HravSGVeV<-*
                      H++ SGV++
  gi|1179254  1763    HTDLSGVDL    1771

DUF791: domain 1 of 1, from 1807 to 1825: score -0.4, E = 5.3
                   *->SkVKddglsLvfglQLLGF<-*
                      S+V + g++L  g  L G+
  gi|1179254  1807    SSVTGQGVALAAGADLSGY    1825

DUF934: domain 1 of 1, from 1813 to 1832: score 2.6, E = 5.7
                   *->GVwLapDddpeeLapadLdrlal<-*
                      GV La+++d+   ++ dL+++ l
  gi|1179254  1813    GVALAAGADLS--GY-DLSGFNL    1832

Pentapeptide: domain 9 of 70, from 1820 to 1855: score 34.6, E = 1.5e-08
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsga<-*
                      a+Lsg +L+g++L+g  L g dL+gAnL+ AnL++a
  gi|1179254  1820    ADLSGYDLSGFNLSGLRLDGIDLSGANLTRANLRDA    1855

Sperm_act_pep: domain 3 of 4, from 1829 to 1834: score 0.4, E = 90
                   *->GFsLgG<-*
                      GF+L+G
  gi|1179254  1829    GFNLSG    1834

Pentapeptide: domain 10 of 70, from 1857 to 1879: score 14.0, E = 0.0073
                CS    -TT-B-TT-B-TT-B-TT-B-TC
                   *->LsgAdLtgAnLsgAnLsganLsg<-*
                      L gA L gA+LsgA   g+++sg
  gi|1179254  1857    LAGATLAGADLSGAFAWGVDFSG    1879

GTP_cyclohydroI: domain 1 of 1, from 1879 to 1894: score 2.3, E = 3.1
                   *->GgiktgsetvTsaagg<-*
                      G++  +s+tvT+++++
  gi|1179254  1879    GVVGSDSATVTDMVVE    1894

Pkinase_C: domain 2 of 2, from 1913 to 1925: score 4.0, E = 3.5
                CS    -GGGTT--EE---
                   *->qleFrGFtYvnpe<-*
                      +++F GF++  ++
  gi|1179254  1913    DNNFAGFSFDGFD    1925

Pentapeptide: domain 11 of 70, from 1919 to 1958: score 22.2, E = 3.8e-05
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                        + g +L++ d++g dL gA L g++L+ A Ls a +s
  gi|1179254  1919    FSFDGFDLSQLDFSGKDLAGASLKGVTLHEAILSTASFSA    1958

Stap_Strp_toxin: domain 1 of 1, from 1943 to 1948: score 1.4, E = 9.7
                CS    EEEEST
                   *->GVTlhe<-*
                      GVTlhe
  gi|1179254  1943    GVTLHE    1948

Pentapeptide: domain 12 of 70, from 1960 to 1969: score 1.8, E = 16
                CS    -B-TT-B-TC
                   *->AnLsganLsg<-*
                      +++++a+Lsg
  gi|1179254  1960    TDFTHADLSG    1969

Pentapeptide: domain 13 of 70, from 1986 to 2025: score 31.1, E = 1.3e-07
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                        ++gAnL+g dL++  +sg +L gAnL g  Lsg++L +
  gi|1179254  1986    GLFQGANLAGLDLSNLSFSGVNLAGANLAGVSLSGTHLDM    2025

Attacin_N: domain 1 of 4, from 2015 to 2022: score 0.6, E = 24
                   *->GlSLtkth<-*
                      G+SL++th
  gi|1179254  2015    GVSLSGTH    2022

Glyco_hydro_67C: domain 1 of 1, from 2019 to 2028: score 1.3, E = 2.8
                CS    SSSTTHHHHH
                   *->TGhpLaQANl<-*
                      +G +L++ANl
  gi|1179254  2019    SGTHLDMANL    2028

Pentapeptide: domain 14 of 70, from 2026 to 2035: score 1.5, E = 20
                CS    -B-TT-B-TC
                   *->AnLsganLsg<-*
                      AnL+ga L g
  gi|1179254  2026    ANLRGAVLVG    2035

Sm_multidrug_ex: domain 1 of 1, from 2028 to 2036: score 0.9, E = 8.7
                   *->ElRGAIpvGi<-*
                       lRGA++vGi
  gi|1179254  2028    -LRGAVLVGI    2036

F420_oxidored: domain 1 of 3, from 2047 to 2075: score 5.0, E = 0.45
                CS    .....CSTTEEEEEEESGGGHHHHHTHHH
                   *->aqLkddvtGfggvdiGgLralerleprta<-*
                      ++L d+ t f+gvd+G L+ l ++++  +
  gi|1179254  2047    GALYDAATNFAGVDAGDLATLKSSMLQSL    2075

Dockerin_1: domain 1 of 5, from 2059 to 2072: score 2.7, E = 11
                CS    -SHHHHHHHHHHH-
                   *->VnalDlallkkyll<-*
                      V+a Dla lk  +l
  gi|1179254  2059    VDAGDLATLKSSML    2072

MspA: domain 1 of 2, from 2104 to 2148: score 2.8, E = 2.5
                   *->vdlgasngVslggsaGvtPsiglvsiGsvsgipdGllpdvtpplgaG
                      +dl+    V+l+ ++Gv++s+g+ ++ ++     ++lpd++++  a+
  gi|1179254  2104    IDLNM--RVNLAREIGVNFSLGT-ADLDEA--AQAVLPDLAISGDAS 2145

                   igv<-*
                   +++
  gi|1179254  2146 ANI    2148

Hydrolase: domain 1 of 1, from 2142 to 2164: score 3.6, E = 1.4
                CS    ESSCHHHHHHHHCTEEEEEESSH
                   *->GDgvnDapalaaAGvgvamgngg<-*
                      GD+ + +  la +++g ++g++g
  gi|1179254  2142    GDASANIYTLANVDLGLVIGTAG    2164

ATP_bind_1: domain 1 of 1, from 2159 to 2166: score 2.4, E = 2
                   *->VvGpaGSG<-*
                      V+G+aGSG
  gi|1179254  2159    VIGTAGSG    2166

Cloacin: domain 1 of 3, from 2197 to 2225: score 1.9, E = 2.1
                   *->aLatpgagglav.....SVsgPWGnealSAAiad<-*
                       L   g ggl++++++ S s+     +lSAA+ad
  gi|1179254  2197    QLDVAGIGGLSIeqgemSLSA-----KLSAAVAD    2225

DUF1386: domain 1 of 3, from 2213 to 2219: score 0.3, E = 6
                   *->MSLssKL<-*
                      MSLs+KL
  gi|1179254  2213    MSLSAKL    2219

DUF574: domain 1 of 3, from 2226 to 2250: score 0.9, E = 5.6
                   *->PDgeagkyddgdereptpeaigiyaGVARKp<-*
                      PD+ +g      e ++t ++++ ++GV+ +
  gi|1179254  2226    PDASDG------EKRITSAEVSAAGGVGTLI    2250

DNA_gyraseA_C: domain 1 of 4, from 2233 to 2266: score 1.1, E = 28
                CS    EEEEGGGS-B--TTB--EEGSGTS-TTTT-SEEEEEEECT
                   *->kRtplsefreqgRgakGvkainllkLkegdkvvsvlvvne<-*
                      kR+   e+++ g  + G  +i   +L+++ ++++++v +
  gi|1179254  2233    KRITSAEVSAAG--GVGT-LI---TLTPEAELAGMFVFDA    2266

Memo: domain 1 of 3, from 2234 to 2246: score 0.3, E = 4.3
                   *->gdtDSvVgYAsav<-*
                      ++t++ V++A++v
  gi|1179254  2234    RITSAEVSAAGGV    2246

DUF2588: domain 1 of 3, from 2291 to 2307: score 0.5, E = 14
                   *->wdGkrwrlaepeiwvAe<-*
                      +dG  w+++ p++wv
  gi|1179254  2291    YDGAAWSVQSPDVWVDL    2307

LpxK: domain 1 of 3, from 2305 to 2322: score 1.5, E = 4.5
                   *->VeaelllddepaldelLlarla<-*
                      V++++    ++al +++l++l
  gi|1179254  2305    VDLQI----SEALKAKILDLLG    2322

Rep_fac_C: domain 1 of 3, from 2305 to 2325: score 3.9, E = 1.9
                CS    HHT.SSS-HHHHHHHHHHHHHH
                   *->krledipeslklellkeLgeie<-*
                      + l +i+e+lk+++l+ Lg +e
  gi|1179254  2305    VDL-QISEALKAKILDLLGQVE    2325

BESS: domain 1 of 3, from 2313 to 2324: score 1.2, E = 28
                   *->fKikiqqllfel<-*
                      +K ki++ll+++
  gi|1179254  2313    LKAKILDLLGQV    2324

DUF59: domain 1 of 3, from 2313 to 2326: score 4.5, E = 1.9
                CS    -HHHHHHHHTT-B-
                   *->lkeaileALktViD<-*
                      lk++il++L +V D
  gi|1179254  2313    LKAKILDLLGQVED    2326

Bombolitin: domain 1 of 3, from 2315 to 2331: score 1.6, E = 18
                   *->iKitDiLAKLGKvLAHv<-*
                       Ki+D+L ++  v+A
  gi|1179254  2315    AKILDLLGQVEDVIAGL    2331

CobU: domain 1 of 3, from 2327 to 2335: score 3.5, E = 1.2
                   *->VvaGlplKl<-*
                      V+aGlpl+l
  gi|1179254  2327    VIAGLPLDL    2335

DUF1771: domain 1 of 3, from 2363 to 2376: score 2.5, E = 6.9
                   *->eYqPGrlRaeAdkhgk<-*
                      +Y   +lR++A+++++
  gi|1179254  2363    DYL--KLRDAANAYFT    2376

Eclosion: domain 1 of 3, from 2384 to 2395: score 3.1, E = 2.6
                   *->DiaSIAPFLnkl<-*
                      D+ S+ +FLn+l
  gi|1179254  2384    DFPSVRGFLNAL    2395

FMN_bind: domain 1 of 4, from 2387 to 2402: score 4.3, E = 1.3
                   *->TSrafkkavqrAldka<-*
                      ++r+f++a+++Al+++
  gi|1179254  2387    SVRGFLNALNDALAAL    2402

RuvA_C: domain 2 of 4, from 2393 to 2404: score 2.6, E = 12
                CS    HHHHHCCHHHHH
                   *->daleeAvsALla<-*
                      +al++A++AL +
  gi|1179254  2393    NALNDALAALTS    2404

Pentapeptide: domain 15 of 70, from 2411 to 2426: score 3.9, E = 4.3
                CS    CCEE-TT-B-TT-B-T
                   *->rgadLsgAdLtgAnLs<-*
                      +g d sgA+L g+++s
  gi|1179254  2411    EGLDWSGANLAGVDFS    2426

Pentapeptide: domain 16 of 70, from 2430 to 2469: score 54.7, E = 4.3e-14
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       +L+g++++gA L+ga+++g dLtg+n+ gA+Lsga+++g
  gi|1179254  2430    LDLRGVDFSGALLKGANFTGLDLTGVNFAGADLSGAIFQG    2469

Anemone_cytotox: domain 1 of 3, from 2461 to 2480: score 0.3, E = 12
                CS    --TTEEEEGGG--HHHHHHH
                   *->avAGavIaGasLafkiLkkv<-*
                      ++ Ga+  G  L   iL kv
  gi|1179254  2461    DLSGAIFQGVGLPSAILRKV    2480

Beta-trefoil: domain 1 of 3, from 2469 to 2488: score 0.1, E = 8.1
                   *->GvalPPliirKVdkqkaiLd<-*
                      Gv lP  i+rKVd   aiLd
  gi|1179254  2469    GVGLPSAILRKVDFSDAILD    2488

Pentapeptide: domain 17 of 70, from 2475 to 2514: score 38.6, E = 1.2e-09
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a+L+ ++++ A+L g+d+sg dL+ An+s+A + g+n+s
  gi|1179254  2475    AILRKVDFSDAILDGIDFSGLDLRWANMSNAHMDGVNFSY    2514

zf-CHC2: domain 1 of 4, from 2479 to 2502: score 0.4, E = 22
                   *->klsFvEAVekLAdragielpyekg<-*
                      k++F++A+++ +d++g++l+  +
  gi|1179254  2479    KVDFSDAILDGIDFSGLDLRWANM    2502

Pentapeptide: domain 18 of 70, from 2571 to 2604: score 29.9, E = 2.9e-07
                CS    B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->nLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      +++g+dL+g  + g dL+g  L gAnL++a++s+
  gi|1179254  2571    DFSGFDLSGLRFDGIDLSGLKLIGANLRNAIFSD    2604

WSK: domain 1 of 3, from 2644 to 2657: score 6.5, E = 0.76
                   *->regegaWaSfKrLV<-*
                      ++ ++aWa +K+LV
  gi|1179254  2644    GSFAEAWAGIKKLV    2657

TMP: domain 1 of 6, from 2650 to 2660: score 8.8, E = 0.33
                   *->WngIkgffsga<-*
                      W gIk+ +sga
  gi|1179254  2650    WAGIKKLVSGA    2660

Pentapeptide: domain 19 of 70, from 2660 to 2699: score 33.2, E = 3.7e-08
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a++sg ++++ dL+  d+sg + +gA LsgAnL+++ L g
  gi|1179254  2660    ADFSGFDFSNWDLSTLDFSGINISGAKLSGANLKDSTLGG    2699

DUF2001: domain 2 of 5, from 2705 to 2717: score 1.4, E = 6.4
                   *->EvPFTFeDfelld<-*
                      +++F F+D+  +d
  gi|1179254  2705    DTDFSFSDWRGVD    2717

Pentapeptide: domain 20 of 70, from 2705 to 2745: score 7.5, E = 0.44
                CS    T-B-TTEEECCEE-TT-B     -TT-B-TT-B-TT-B-TC
                   *->gAnLrgAdLrgadLsgAd.....LtgAnLsgAnLsganLsg<-*
                      + +++ +d rg+dLsg  +  ++++g+n+ g ++ g n+
  gi|1179254  2705    DTDFSFSDWRGVDLSGLStllghFRGVNFAGLDFDGINFDP    2745

DUF2124: domain 1 of 3, from 2719 to 2730: score 0.8, E = 8.7
                   *->kGlsgmLreFke<-*
                      +Gls +L++F++
  gi|1179254  2719    SGLSTLLGHFRG    2730

Gly_radical: domain 1 of 3, from 2743 to 2761: score 3.9, E = 1.9
                CS    TTTT--CCCCHCCHHHHHC
                   *->vepginPmegkDaegplaf<-*
                      ++pg++++ g D+ g+l++
  gi|1179254  2743    FDPGVLEFSGADFSGALHL    2761

Pentapeptide: domain 21 of 70, from 2748 to 2758: score 1.0, E = 28
                CS    -EECT-B-TTE
                   *->anLsgAnLrgA<-*
                        +sgA+++gA
  gi|1179254  2748    LEFSGADFSGA    2758

Pentapeptide: domain 22 of 70, from 2778 to 2808: score 6.0, E = 1.2
                CS    TEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->gAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      gA ++g+dLsg    +  +++  ++g+++sg
  gi|1179254  2778    GASFKGVDLSGETSQNGKFKWGSFKGVDFSG    2808

Big_3: domain 1 of 5, from 2790 to 2817: score 1.5, E = 16
                   *->tyknGk........vtpddvtvsGdetvDts<-*
                      t++nGk + ++ ++v++++v++sG   +D s
  gi|1179254  2790    TSQNGKfkwgsfkgVDFSGVDFSG---IDLS    2817

Pentapeptide: domain 23 of 70, from 2809 to 2848: score 28.4, E = 7.7e-07
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       ++sg++L+g+dL+ + ++gA+L ++ + gA L g+++sg
  gi|1179254  2809    VDFSGIDLSGVDLSLSVFEGAVLESTLFDGALLGGVDFSG    2848

PHA_gran_rgn: domain 1 of 4, from 2847 to 2860: score 0.0, E = 38
                   *->sGVdGqlevtedki<-*
                      sGV G+++++++++
  gi|1179254  2847    SGVSGSIASAANAF    2860

Chordopox_A33R: domain 1 of 1, from 2914 to 2932: score -0.1, E = 5.4
                   *->msleentDkdeSndnqtAFiG<-*
                      m+l++n  +d+S  ++ AF++
  gi|1179254  2914    MNLQVN--VDKSFHEAFAFSS    2932

OmpA: domain 1 of 4, from 2927 to 2943: score 3.1, E = 4.1
                   *->lFdfdkatLkpegqqlL<-*
                       F+f +++L+pe+ +++
  gi|1179254  2927    AFAFSSDDLLPEALAQV    2943

Nif11: domain 1 of 4, from 2928 to 2937: score 0.7, E = 29
                   *->feisgdeLla<-*
                      f++s+d+Ll
  gi|1179254  2928    FAFSSDDLLP    2937

Connexin50: domain 1 of 3, from 2973 to 2990: score 1.0, E = 6
                   *->TEVGgvEaspLpakPfeqF<-*
                      T VGg+ + pLp++ ++++
  gi|1179254  2973    TDVGGLLTVPLPSS-YDPY    2990

Tymo_coat: domain 1 of 3, from 3000 to 3020: score 0.9, E = 9.8
                CS    EEESSS-EEEEEEGGGSHHHH
                   *->tslGtkEtsaqisLAsadsiA<-*
                      +slG+++ sa++ LA+++ ++
  gi|1179254  3000    ASLGVQDISASLDLANIAGVT    3020

DUF2283: domain 1 of 3, from 3015 to 3025: score 2.1, E = 8.8
                   *->riVGIEiLnAS<-*
                      +i G++++ AS
  gi|1179254  3015    NIAGVTVESAS    3025

efhand: domain 2 of 6, from 3029 to 3053: score 1.2, E = 36
                CS    HHHHHHHHHTTTSSSEEHHHHHHHH
                   *->elkeaFkefDkDgDGkIsfeEfkaa<-*
                      ++ +  ++ D+DgDG++ + E++a+
  gi|1179254  3029    RVAASVDMQDVDGDGRLYYSELQAL    3053

Dockerin_1: domain 2 of 5, from 3038 to 3044: score 1.6, E = 23
                CS    -TT-SS-
                   *->DvNgDGk<-*
                      Dv+gDG+
  gi|1179254  3038    DVDGDGR    3044

HCV_NS4b: domain 1 of 3, from 3058 to 3067: score 0.1, E = 3.7
                   *->avqWmNRLLt<-*
                      ++ WmN L t
  gi|1179254  3058    PTNWMNHLVT    3067

ADP_ribosyl_GH: domain 1 of 3, from 3074 to 3089: score 1.0, E = 3.7
                CS    HH.HHHHHHHTT-SSHH
                   *->fepealllavnlGGDtD<-*
                      fe + l  avn GGD+D
  gi|1179254  3074    FE-AELQTAVNVGGDAD    3089

DUF1757: domain 1 of 3, from 3090 to 3108: score 2.1, E = 2.5
                   *->iGsllgaPvsallssrkln<-*
                      +G+llg P+++++s + ++
  gi|1179254  3090    LGALLGSPIVTIVSDQLFT    3108

NikM: domain 1 of 3, from 3105 to 3121: score 1.0, E = 4.5
                   *->qkvkTDanGvFsftpPk<-*
                      q ++TDanG++ f+ P+
  gi|1179254  3105    QLFTTDANGKVQFNAPE    3121

Cna_B: domain 1 of 3, from 3108 to 3118: score 1.3, E = 7.5
                CS    E--TTSEEEEE
                   *->tTdenGkytft<-*
                      tTd+nGk++f+
  gi|1179254  3108    TTDANGKVQFN    3118

DUF823: domain 1 of 3, from 3108 to 3118: score 0.2, E = 6.1
                   *->GvTgAdGtatft<-*
                       +T+A+G+++f+
  gi|1179254  3108    -TTDANGKVQFN    3118

Pirin_C: domain 1 of 3, from 3123 to 3133: score 0.9, E = 17
                CS    EEEEEE-TT-E
                   *->YlDitLeaGar<-*
                      YlDi+L+a+ +
  gi|1179254  3123    YLDIALTADQK    3133

Bystin: domain 1 of 1, from 3127 to 3140: score -0.6, E = 9.3
                   *->diteDQkeaLldLl<-*
                      ++t DQk++Ll++l
  gi|1179254  3127    ALTADQKDKLLEVL    3140

LTXXQ: domain 1 of 4, from 3128 to 3140: score 4.2, E = 3.5
                   *->LTpEQrqqlkrlk<-*
                      LT++Q+++l +
  gi|1179254  3128    LTADQKDKLLEVL    3140

Herpes_UL1: domain 1 of 3, from 3132 to 3144: score 1.0, E = 8.7
                   *->qkdeTRlALYKElldaLdsal<-*
                      qkd         ll++Ld+++
  gi|1179254  3132    QKDK--------LLEVLDTLK    3144

SAM_PNT: domain 2 of 4, from 3134 to 3147: score 0.4, E = 16
                CS    HHHHHHHHHHHCCC
                   *->diLwehLqiLrkas<-*
                      d+L e L+ L++a+
  gi|1179254  3134    DKLLEVLDTLKSAG    3147

Antimicrobial_7: domain 1 of 3, from 3138 to 3154: score 1.9, E = 5.5
                   *->GKvwDwIKsiAkkvwnSe<-*
                        v+D+ Ks+    +nS+
  gi|1179254  3138    -EVLDTLKSAGDGALNSD    3154

Antimicrobial15: domain 1 of 4, from 3139 to 3147: score 2.7, E = 7.3
                   *->VlDILKnAa<-*
                      VlD LK A+
  gi|1179254  3139    VLDTLKSAG    3147

UBA_3: domain 1 of 2, from 3162 to 3175: score 2.3, E = 7.7
                CS    -SSHHHHHHHHHTT
                   *->GiDrdlVdqFvsqG<-*
                      GiD+ l d F+sqG
  gi|1179254  3162    GIDQSLADMFASQG    3175

MxiH: domain 1 of 2, from 3176 to 3184: score 1.5, E = 12
                   *->lmqgIiQKf<-*
                      ++++IiQ++
  gi|1179254  3176    SDKSIIQRI    3184

HSP9_HSP12: domain 1 of 2, from 3177 to 3187: score 0.4, E = 13
                   *->dKStvQkAhDk<-*
                      dKS+ Q  +D
  gi|1179254  3177    DKSIIQRIFDL    3187

CAMP_factor: domain 1 of 2, from 3213 to 3233: score 2.9, E = 1.3
                   *->YktLNKAIThAvGVqlNPktT<-*
                      ++ LN A+T+Av V + +++T
  gi|1179254  3213    VDVLNNALTKAVTVDFDAAVT    3233

Pentapeptide: domain 24 of 70, from 3249 to 3288: score 53.6, E = 8.7e-14
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                        L++ +++gAdLrgad+sgAdL+g+++sgAnL ga++s
  gi|1179254  3249    QSLRNFDFSGADLRGADFSGADLSGVDFSGANLAGAIFST    3288

SIC: domain 1 of 3, from 3252 to 3273: score 1.8, E = 0.79
                   *->RnFDWsGddwsgDDWPEDDWsG<-*
                      RnFD+sG d  g D+   D sG
  gi|1179254  3252    RNFDFSGADLRGADFSGADLSG    3273

Beta-lactamase: domain 2 of 4, from 3278 to 3308: score 1.4, E = 4.6
                CS    SSTEEEEEEESESSCHHHH HHHHHHHHHHH
                   *->raglgvavltNrdgpnpda.adarlialaaa<-*
                      +a+l+ a+++++ g+n ++ ++  + ++ a
  gi|1179254  3278    GANLAGAIFSTTSGGNSSRaKLGGVNLQGAI    3308

Lysis_col: domain 1 of 3, from 3294 to 3305: score 1.2, E = 23
                   *->SSsSeLTGvavq<-*
                      SS ++L Gv +q
  gi|1179254  3294    SSRAKLGGVNLQ    3305

Pentapeptide: domain 25 of 70, from 3297 to 3336: score 51.1, E = 4.2e-13
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a L g+nL+gA+L g+ Lsg dL+gA+Ls+++Lsg++Ls
  gi|1179254  3297    AKLGGVNLQGAILDGVSLSGLDLRGADLSNTDLSGVDLSY    3336

Pentapeptide: domain 26 of 70, from 3383 to 3422: score 46.2, E = 9.5e-12
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       +Lsg +L+g+dL+g dLsg +LtgAnL+gAnL+++ Ls
  gi|1179254  3383    VDLSGYDLAGFDLSGLDLSGVNLTGANLTGANLRDVLLSS    3422

Pentapeptide: domain 27 of 70, from 3423 to 3442: score 11.8, E = 0.028
                CS    -B-TT-B-TT-B-TT-B-TC
                   *->AdLtgAnLsgAnLsganLsg<-*
                      A+L gA++sgA   g++++g
  gi|1179254  3423    ANLAGADFSGAFAWGVDFTG    3442

TMP: domain 2 of 6, from 3469 to 3477: score 1.1, E = 62
                   *->gIkgffsga<-*
                      gIk+f++++
  gi|1179254  3469    GIKDFATDK    3477

Pentapeptide: domain 28 of 70, from 3478 to 3511: score 33.9, E = 2.4e-08
                CS    B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->nLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      +L+g+dL+g dLsg d++g+nLs+A L g++Lsg
  gi|1179254  3478    DLSGFDLSGLDLSGMDFSGVNLSDALLCGTDLSG    3511

Pentapeptide: domain 29 of 70, from 3512 to 3532: score 3.5, E = 5.6
                CS    -B-TT-B-TT -B-TT-B-TC
                   *->AdLtgAnLsg.AnLsganLsg<-*
                      AdLt A+Ls  ++++ga+Lsg
  gi|1179254  3512    ADLTTATLSKlTDFTGADLSG    3532

Pentapeptide: domain 30 of 70, from 3554 to 3593: score 19.5, E = 0.00022
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      anL g +L+   L+g dL gA+L g+ L+g+ L  +nL+g
  gi|1179254  3554    ANLAGLDLSDLSLSGLDLAGANLAGVVLNGTALDMSNLRG    3593

DGOK: domain 1 of 2, from 3594 to 3604: score 1.9, E = 0.39
                   *->AvrAGLseiAr<-*
                      Av+AG+ eiA
  gi|1179254  3594    AVLAGVQEIAQ    3604

F420_oxidored: domain 2 of 3, from 3610 to 3638: score 5.1, E = 0.42
                CS    .....CSTTEEEEEEESGGGHHHHHTHHH
                   *->aqLkddvtGfggvdiGgLralerleprta<-*
                      ++L d+ t f g+d+G+L+ l ++++  +
  gi|1179254  3610    GALYDAATNFSGIDAGALSTLKSGMLESL    3638

DUF719: domain 1 of 2, from 3626 to 3657: score 1.4, E = 3.6
                   *->savtarfGmlsiisgV.vQstGKsV.ITGGLD<-*
                      +++t   Gml ++ gV+vQ  G sV+ TGGLD
  gi|1179254  3626    ALSTLKSGMLESLAGVgVQAGGPSVqFTGGLD    3657

PKD: domain 1 of 4, from 3643 to 3663: score 0.2, E = 16
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSEC
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspv<-*
                      v+a+           g +V+Ft+ +  d + G+ v
  gi|1179254  3643    VQAG-----------GPSVQFTGGL--DLS-GDEV    3663

BSP: domain 1 of 2, from 3652 to 3670: score 0.7, E = 3.4
                   *->atsGielddgdneIhlSar<-*
                      +t+G++l++++ +I+l++r
  gi|1179254  3652    FTGGLDLSGDEVVIALNLR    3670

Ribosomal_L18p: domain 1 of 2, from 3674 to 3681: score 0.9, E = 12
                CS    HHCCHB--
                   *->ArEaGLnf<-*
                      ArE GL+f
  gi|1179254  3674    AREVGLEF    3681

Cloacin: domain 2 of 3, from 3761 to 3789: score 1.9, E = 2.1
                   *->aLatpgagglav.....SVsgPWGnealSAAiad<-*
                       L   g ggl++++++ S s+     +lSAA+ad
  gi|1179254  3761    QLDVAGIGGLSIeqgemSLSA-----KLSAAVAD    3789

DUF1386: domain 2 of 3, from 3777 to 3783: score 0.3, E = 6
                   *->MSLssKL<-*
                      MSLs+KL
  gi|1179254  3777    MSLSAKL    3783

DUF574: domain 2 of 3, from 3790 to 3814: score 0.9, E = 5.6
                   *->PDgeagkyddgdereptpeaigiyaGVARKp<-*
                      PD+ +g      e ++t ++++ ++GV+ +
  gi|1179254  3790    PDASDG------EKRITSAEVSAAGGVGTLI    3814

DNA_gyraseA_C: domain 2 of 4, from 3797 to 3830: score 1.1, E = 28
                CS    EEEEGGGS-B--TTB--EEGSGTS-TTTT-SEEEEEEECT
                   *->kRtplsefreqgRgakGvkainllkLkegdkvvsvlvvne<-*
                      kR+   e+++ g  + G  +i   +L+++ ++++++v +
  gi|1179254  3797    KRITSAEVSAAG--GVGT-LI---TLTPEAELAGMFVFDA    3830

Memo: domain 2 of 3, from 3798 to 3810: score 0.3, E = 4.3
                   *->gdtDSvVgYAsav<-*
                      ++t++ V++A++v
  gi|1179254  3798    RITSAEVSAAGGV    3810

DUF2588: domain 2 of 3, from 3855 to 3871: score 0.5, E = 14
                   *->wdGkrwrlaepeiwvAe<-*
                      +dG  w+++ p++wv
  gi|1179254  3855    YDGAAWSVQSPDVWVDL    3871

LpxK: domain 2 of 3, from 3869 to 3886: score 1.5, E = 4.5
                   *->VeaelllddepaldelLlarla<-*
                      V++++    ++al +++l++l
  gi|1179254  3869    VDLQI----SEALKAKILDLLG    3886

Rep_fac_C: domain 2 of 3, from 3869 to 3889: score 3.9, E = 1.9
                CS    HHT.SSS-HHHHHHHHHHHHHH
                   *->krledipeslklellkeLgeie<-*
                      + l +i+e+lk+++l+ Lg +e
  gi|1179254  3869    VDL-QISEALKAKILDLLGQVE    3889

BESS: domain 2 of 3, from 3877 to 3888: score 1.2, E = 28
                   *->fKikiqqllfel<-*
                      +K ki++ll+++
  gi|1179254  3877    LKAKILDLLGQV    3888

DUF59: domain 2 of 3, from 3877 to 3890: score 4.5, E = 1.9
                CS    -HHHHHHHHTT-B-
                   *->lkeaileALktViD<-*
                      lk++il++L +V D
  gi|1179254  3877    LKAKILDLLGQVED    3890

Bombolitin: domain 2 of 3, from 3879 to 3895: score 1.6, E = 18
                   *->iKitDiLAKLGKvLAHv<-*
                       Ki+D+L ++  v+A
  gi|1179254  3879    AKILDLLGQVEDVIAGL    3895

CobU: domain 2 of 3, from 3891 to 3899: score 3.5, E = 1.2
                   *->VvaGlplKl<-*
                      V+aGlpl+l
  gi|1179254  3891    VIAGLPLDL    3899

DUF1771: domain 2 of 3, from 3927 to 3940: score 2.5, E = 6.9
                   *->eYqPGrlRaeAdkhgk<-*
                      +Y   +lR++A+++++
  gi|1179254  3927    DYL--KLRDAANAYFT    3940

Eclosion: domain 2 of 3, from 3948 to 3959: score 3.1, E = 2.6
                   *->DiaSIAPFLnkl<-*
                      D+ S+ +FLn+l
  gi|1179254  3948    DFPSVRGFLNAL    3959

FMN_bind: domain 2 of 4, from 3951 to 3966: score 4.3, E = 1.3
                   *->TSrafkkavqrAldka<-*
                      ++r+f++a+++Al+++
  gi|1179254  3951    SVRGFLNALNDALAAL    3966

RuvA_C: domain 3 of 4, from 3957 to 3968: score 2.6, E = 12
                CS    HHHHHCCHHHHH
                   *->daleeAvsALla<-*
                      +al++A++AL +
  gi|1179254  3957    NALNDALAALTS    3968

Pentapeptide: domain 31 of 70, from 3975 to 3990: score 3.9, E = 4.3
                CS    CCEE-TT-B-TT-B-T
                   *->rgadLsgAdLtgAnLs<-*
                      +g d sgA+L g+++s
  gi|1179254  3975    EGLDWSGANLAGVDFS    3990

Pentapeptide: domain 32 of 70, from 3994 to 4033: score 54.7, E = 4.3e-14
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       +L+g++++gA L+ga+++g dLtg+n+ gA+Lsga+++g
  gi|1179254  3994    LDLRGVDFSGALLKGANFTGLDLTGVNFAGADLSGAIFQG    4033

Anemone_cytotox: domain 2 of 3, from 4025 to 4044: score 0.3, E = 12
                CS    --TTEEEEGGG--HHHHHHH
                   *->avAGavIaGasLafkiLkkv<-*
                      ++ Ga+  G  L   iL kv
  gi|1179254  4025    DLSGAIFQGVGLPSAILRKV    4044

Beta-trefoil: domain 2 of 3, from 4033 to 4052: score 0.1, E = 8.1
                   *->GvalPPliirKVdkqkaiLd<-*
                      Gv lP  i+rKVd   aiLd
  gi|1179254  4033    GVGLPSAILRKVDFSDAILD    4052

Pentapeptide: domain 33 of 70, from 4039 to 4078: score 38.6, E = 1.2e-09
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a+L+ ++++ A+L g+d+sg dL+ An+s+A + g+n+s
  gi|1179254  4039    AILRKVDFSDAILDGIDFSGLDLRWANMSNAHMDGVNFSY    4078

zf-CHC2: domain 2 of 4, from 4043 to 4066: score 0.4, E = 22
                   *->klsFvEAVekLAdragielpyekg<-*
                      k++F++A+++ +d++g++l+  +
  gi|1179254  4043    KVDFSDAILDGIDFSGLDLRWANM    4066

Pentapeptide: domain 34 of 70, from 4135 to 4168: score 29.9, E = 2.9e-07
                CS    B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->nLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      +++g+dL+g  + g dL+g  L gAnL++a++s+
  gi|1179254  4135    DFSGFDLSGLRFDGIDLSGLKLIGANLRNAIFSD    4168

WSK: domain 2 of 3, from 4208 to 4221: score 6.5, E = 0.76
                   *->regegaWaSfKrLV<-*
                      ++ ++aWa +K+LV
  gi|1179254  4208    GSFAEAWAGIKKLV    4221

TMP: domain 3 of 6, from 4214 to 4224: score 8.8, E = 0.33
                   *->WngIkgffsga<-*
                      W gIk+ +sga
  gi|1179254  4214    WAGIKKLVSGA    4224

Pentapeptide: domain 35 of 70, from 4224 to 4263: score 33.2, E = 3.7e-08
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a++sg ++++ dL+  d+sg + +gA LsgAnL+++ L g
  gi|1179254  4224    ADFSGFDFSNWDLSTLDFSGINISGAKLSGANLKDSTLGG    4263

DUF2001: domain 3 of 5, from 4269 to 4281: score 1.4, E = 6.4
                   *->EvPFTFeDfelld<-*
                      +++F F+D+  +d
  gi|1179254  4269    DTDFSFSDWRGVD    4281

Pentapeptide: domain 36 of 70, from 4269 to 4309: score 7.5, E = 0.44
                CS    T-B-TTEEECCEE-TT-B     -TT-B-TT-B-TT-B-TC
                   *->gAnLrgAdLrgadLsgAd.....LtgAnLsgAnLsganLsg<-*
                      + +++ +d rg+dLsg  +  ++++g+n+ g ++ g n+
  gi|1179254  4269    DTDFSFSDWRGVDLSGLStllghFRGVNFAGLDFDGINFDP    4309

DUF2124: domain 2 of 3, from 4283 to 4294: score 0.8, E = 8.7
                   *->kGlsgmLreFke<-*
                      +Gls +L++F++
  gi|1179254  4283    SGLSTLLGHFRG    4294

Gly_radical: domain 2 of 3, from 4307 to 4325: score 3.9, E = 1.9
                CS    TTTT--CCCCHCCHHHHHC
                   *->vepginPmegkDaegplaf<-*
                      ++pg++++ g D+ g+l++
  gi|1179254  4307    FDPGVLEFSGADFSGALHL    4325

Pentapeptide: domain 37 of 70, from 4312 to 4322: score 1.0, E = 28
                CS    -EECT-B-TTE
                   *->anLsgAnLrgA<-*
                        +sgA+++gA
  gi|1179254  4312    LEFSGADFSGA    4322

Pentapeptide: domain 38 of 70, from 4342 to 4372: score 6.0, E = 1.2
                CS    TEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->gAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      gA ++g+dLsg    +  +++  ++g+++sg
  gi|1179254  4342    GASFKGVDLSGETSQNGKFKWGSFKGVDFSG    4372

Big_3: domain 2 of 5, from 4354 to 4381: score 1.5, E = 16
                   *->tyknGk........vtpddvtvsGdetvDts<-*
                      t++nGk + ++ ++v++++v++sG   +D s
  gi|1179254  4354    TSQNGKfkwgsfkgVDFSGVDFSG---IDLS    4381

Pentapeptide: domain 39 of 70, from 4373 to 4412: score 28.4, E = 7.7e-07
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       ++sg++L+g+dL+ + ++gA+L ++ + gA L g+++sg
  gi|1179254  4373    VDFSGIDLSGVDLSLSVFEGAVLESTLFDGALLGGVDFSG    4412

PHA_gran_rgn: domain 2 of 4, from 4411 to 4424: score 0.0, E = 38
                   *->sGVdGqlevtedki<-*
                      sGV G+++++++++
  gi|1179254  4411    SGVSGSIASAANAF    4424

OmpA: domain 2 of 4, from 4491 to 4507: score 3.1, E = 4.1
                   *->lFdfdkatLkpegqqlL<-*
                       F+f +++L+pe+ +++
  gi|1179254  4491    AFAFSSDDLLPEALAQV    4507

Nif11: domain 2 of 4, from 4492 to 4501: score 0.7, E = 29
                   *->feisgdeLla<-*
                      f++s+d+Ll
  gi|1179254  4492    FAFSSDDLLP    4501

Connexin50: domain 2 of 3, from 4537 to 4554: score 1.0, E = 6
                   *->TEVGgvEaspLpakPfeqF<-*
                      T VGg+ + pLp++ ++++
  gi|1179254  4537    TDVGGLLTVPLPSS-YDPY    4554

Tymo_coat: domain 2 of 3, from 4564 to 4584: score 0.9, E = 9.8
                CS    EEESSS-EEEEEEGGGSHHHH
                   *->tslGtkEtsaqisLAsadsiA<-*
                      +slG+++ sa++ LA+++ ++
  gi|1179254  4564    ASLGVQDISASLDLANIAGVT    4584

DUF2283: domain 2 of 3, from 4579 to 4589: score 2.1, E = 8.8
                   *->riVGIEiLnAS<-*
                      +i G++++ AS
  gi|1179254  4579    NIAGVTVESAS    4589

efhand: domain 3 of 6, from 4593 to 4617: score 1.2, E = 36
                CS    HHHHHHHHHTTTSSSEEHHHHHHHH
                   *->elkeaFkefDkDgDGkIsfeEfkaa<-*
                      ++ +  ++ D+DgDG++ + E++a+
  gi|1179254  4593    RVAASVDMQDVDGDGRLYYSELQAL    4617

Dockerin_1: domain 3 of 5, from 4602 to 4608: score 1.6, E = 23
                CS    -TT-SS-
                   *->DvNgDGk<-*
                      Dv+gDG+
  gi|1179254  4602    DVDGDGR    4608

HCV_NS4b: domain 2 of 3, from 4622 to 4631: score 0.1, E = 3.7
                   *->avqWmNRLLt<-*
                      ++ WmN L t
  gi|1179254  4622    PTNWMNHLVT    4631

ADP_ribosyl_GH: domain 2 of 3, from 4638 to 4653: score 1.0, E = 3.7
                CS    HH.HHHHHHHTT-SSHH
                   *->fepealllavnlGGDtD<-*
                      fe + l  avn GGD+D
  gi|1179254  4638    FE-AELQTAVNVGGDAD    4653

DUF1757: domain 2 of 3, from 4654 to 4672: score 2.1, E = 2.5
                   *->iGsllgaPvsallssrkln<-*
                      +G+llg P+++++s + ++
  gi|1179254  4654    LGALLGSPIVTIVSDQLFT    4672

NikM: domain 2 of 3, from 4669 to 4685: score 1.0, E = 4.5
                   *->qkvkTDanGvFsftpPk<-*
                      q ++TDanG++ f+ P+
  gi|1179254  4669    QLFTTDANGKVQFNAPE    4685

Cna_B: domain 2 of 3, from 4672 to 4682: score 1.3, E = 7.5
                CS    E--TTSEEEEE
                   *->tTdenGkytft<-*
                      tTd+nGk++f+
  gi|1179254  4672    TTDANGKVQFN    4682

DUF823: domain 2 of 3, from 4672 to 4682: score 0.2, E = 6.1
                   *->GvTgAdGtatft<-*
                       +T+A+G+++f+
  gi|1179254  4672    -TTDANGKVQFN    4682

Pirin_C: domain 2 of 3, from 4687 to 4697: score 0.9, E = 17
                CS    EEEEEE-TT-E
                   *->YlDitLeaGar<-*
                      YlDi+L+a+ +
  gi|1179254  4687    YLDIALTADQK    4697

LTXXQ: domain 2 of 4, from 4692 to 4704: score 4.2, E = 3.5
                   *->LTpEQrqqlkrlk<-*
                      LT++Q+++l +
  gi|1179254  4692    LTADQKDKLLEVL    4704

Herpes_UL1: domain 2 of 3, from 4696 to 4708: score 1.0, E = 8.7
                   *->qkdeTRlALYKElldaLdsal<-*
                      qkd         ll++Ld+++
  gi|1179254  4696    QKDK--------LLEVLDTLK    4708

SAM_PNT: domain 3 of 4, from 4698 to 4711: score 0.4, E = 16
                CS    HHHHHHHHHHHCCC
                   *->diLwehLqiLrkas<-*
                      d+L e L+ L++a+
  gi|1179254  4698    DKLLEVLDTLKSAG    4711

Antimicrobial_7: domain 2 of 3, from 4702 to 4718: score 1.9, E = 5.5
                   *->GKvwDwIKsiAkkvwnSe<-*
                        v+D+ Ks+    +nS+
  gi|1179254  4702    -EVLDTLKSAGDGALNSD    4718

Antimicrobial15: domain 2 of 4, from 4703 to 4711: score 2.7, E = 7.3
                   *->VlDILKnAa<-*
                      VlD LK A+
  gi|1179254  4703    VLDTLKSAG    4711

DUF2131: domain 1 of 1, from 4713 to 4731: score 1.5, E = 8.2
                   *->GPidkaWvaenleqIkaaL<-*
                      G+++++ ++++++ I ++L
  gi|1179254  4713    GALNSDFINTKIPGIDQSL    4731

UBA_3: domain 2 of 2, from 4726 to 4739: score 2.3, E = 7.7
                CS    -SSHHHHHHHHHTT
                   *->GiDrdlVdqFvsqG<-*
                      GiD+ l d F+sqG
  gi|1179254  4726    GIDQSLADMFASQG    4739

MxiH: domain 2 of 2, from 4740 to 4748: score 1.5, E = 12
                   *->lmqgIiQKf<-*
                      ++++IiQ++
  gi|1179254  4740    SDKSIIQRI    4748

HSP9_HSP12: domain 2 of 2, from 4741 to 4751: score 0.4, E = 13
                   *->dKStvQkAhDk<-*
                      dKS+ Q  +D
  gi|1179254  4741    DKSIIQRIFDL    4751

CAMP_factor: domain 2 of 2, from 4777 to 4797: score 2.9, E = 1.3
                   *->YktLNKAIThAvGVqlNPktT<-*
                      ++ LN A+T+Av V + +++T
  gi|1179254  4777    VDVLNNALTKAVTVDFDAAVT    4797

Pentapeptide: domain 40 of 70, from 4813 to 4852: score 53.6, E = 8.7e-14
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                        L++ +++gAdLrgad+sgAdL+g+++sgAnL ga++s
  gi|1179254  4813    QSLRNFDFSGADLRGADFSGADLSGVDFSGANLAGAIFST    4852

SIC: domain 2 of 3, from 4816 to 4837: score 1.8, E = 0.79
                   *->RnFDWsGddwsgDDWPEDDWsG<-*
                      RnFD+sG d  g D+   D sG
  gi|1179254  4816    RNFDFSGADLRGADFSGADLSG    4837

Beta-lactamase: domain 3 of 4, from 4842 to 4872: score 1.4, E = 4.6
                CS    SSTEEEEEEESESSCHHHH HHHHHHHHHHH
                   *->raglgvavltNrdgpnpda.adarlialaaa<-*
                      +a+l+ a+++++ g+n ++ ++  + ++ a
  gi|1179254  4842    GANLAGAIFSTTSGGNSSRaKLGGVNLQGAI    4872

Lysis_col: domain 2 of 3, from 4858 to 4869: score 1.2, E = 23
                   *->SSsSeLTGvavq<-*
                      SS ++L Gv +q
  gi|1179254  4858    SSRAKLGGVNLQ    4869

Pentapeptide: domain 41 of 70, from 4861 to 4900: score 51.1, E = 4.2e-13
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a L g+nL+gA+L g+ Lsg dL+gA+Ls+++Lsg++Ls
  gi|1179254  4861    AKLGGVNLQGAILDGVSLSGLDLRGADLSNTDLSGVDLSY    4900

Pentapeptide: domain 42 of 70, from 4947 to 4986: score 46.2, E = 9.5e-12
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       +Lsg +L+g+dL+g dLsg +LtgAnL+gAnL+++ Ls
  gi|1179254  4947    VDLSGYDLAGFDLSGLDLSGVNLTGANLTGANLRDVLLSS    4986

Pentapeptide: domain 43 of 70, from 4987 to 5006: score 11.8, E = 0.028
                CS    -B-TT-B-TT-B-TT-B-TC
                   *->AdLtgAnLsgAnLsganLsg<-*
                      A+L gA++sgA   g++++g
  gi|1179254  4987    ANLAGADFSGAFAWGVDFTG    5006

TMP: domain 4 of 6, from 5033 to 5041: score 1.1, E = 62
                   *->gIkgffsga<-*
                      gIk+f++++
  gi|1179254  5033    GIKDFATDK    5041

Pentapeptide: domain 44 of 70, from 5042 to 5075: score 33.9, E = 2.4e-08
                CS    B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->nLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      +L+g+dL+g dLsg d++g+nLs+A L g++Lsg
  gi|1179254  5042    DLSGFDLSGLDLSGMDFSGVNLSDALLCGTDLSG    5075

Pentapeptide: domain 45 of 70, from 5076 to 5096: score 3.5, E = 5.6
                CS    -B-TT-B-TT -B-TT-B-TC
                   *->AdLtgAnLsg.AnLsganLsg<-*
                      AdLt A+Ls  ++++ga+Lsg
  gi|1179254  5076    ADLTTATLSKlTDFTGADLSG    5096

Pentapeptide: domain 46 of 70, from 5118 to 5157: score 19.5, E = 0.00022
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      anL g +L+   L+g dL gA+L g+ L+g+ L  +nL+g
  gi|1179254  5118    ANLAGLDLSDLSLSGLDLAGANLAGVVLNGTALDMSNLRG    5157

DGOK: domain 2 of 2, from 5158 to 5168: score 1.9, E = 0.39
                   *->AvrAGLseiAr<-*
                      Av+AG+ eiA
  gi|1179254  5158    AVLAGVQEIAQ    5168

F420_oxidored: domain 3 of 3, from 5174 to 5202: score 5.1, E = 0.42
                CS    .....CSTTEEEEEEESGGGHHHHHTHHH
                   *->aqLkddvtGfggvdiGgLralerleprta<-*
                      ++L d+ t f g+d+G+L+ l ++++  +
  gi|1179254  5174    GALYDAATNFSGIDAGALSTLKSGMLESL    5202

DUF719: domain 2 of 2, from 5190 to 5221: score 1.4, E = 3.6
                   *->savtarfGmlsiisgV.vQstGKsV.ITGGLD<-*
                      +++t   Gml ++ gV+vQ  G sV+ TGGLD
  gi|1179254  5190    ALSTLKSGMLESLAGVgVQAGGPSVqFTGGLD    5221

PKD: domain 2 of 4, from 5207 to 5227: score 0.2, E = 16
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSEC
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspv<-*
                      v+a+           g +V+Ft+ +  d + G+ v
  gi|1179254  5207    VQAG-----------GPSVQFTGGL--DLS-GDEV    5227

BSP: domain 2 of 2, from 5216 to 5234: score 0.7, E = 3.4
                   *->atsGielddgdneIhlSar<-*
                      +t+G++l++++ +I+l++r
  gi|1179254  5216    FTGGLDLSGDEVVIALNLR    5234

Ribosomal_L18p: domain 2 of 2, from 5238 to 5245: score 0.9, E = 12
                CS    HHCCHB--
                   *->ArEaGLnf<-*
                      ArE GL+f
  gi|1179254  5238    AREVGLEF    5245

Cloacin: domain 3 of 3, from 5325 to 5353: score 1.9, E = 2.1
                   *->aLatpgagglav.....SVsgPWGnealSAAiad<-*
                       L   g ggl++++++ S s+     +lSAA+ad
  gi|1179254  5325    QLDVAGIGGLSIeqgemSLSA-----KLSAAVAD    5353

DUF1386: domain 3 of 3, from 5341 to 5347: score 0.3, E = 6
                   *->MSLssKL<-*
                      MSLs+KL
  gi|1179254  5341    MSLSAKL    5347

DUF574: domain 3 of 3, from 5354 to 5378: score 0.9, E = 5.6
                   *->PDgeagkyddgdereptpeaigiyaGVARKp<-*
                      PD+ +g      e ++t ++++ ++GV+ +
  gi|1179254  5354    PDASDG------EKRITSAEVSAAGGVGTLI    5378

DNA_gyraseA_C: domain 3 of 4, from 5361 to 5394: score 1.1, E = 28
                CS    EEEEGGGS-B--TTB--EEGSGTS-TTTT-SEEEEEEECT
                   *->kRtplsefreqgRgakGvkainllkLkegdkvvsvlvvne<-*
                      kR+   e+++ g  + G  +i   +L+++ ++++++v +
  gi|1179254  5361    KRITSAEVSAAG--GVGT-LI---TLTPEAELAGMFVFDA    5394

Memo: domain 3 of 3, from 5362 to 5374: score 0.3, E = 4.3
                   *->gdtDSvVgYAsav<-*
                      ++t++ V++A++v
  gi|1179254  5362    RITSAEVSAAGGV    5374

DUF2588: domain 3 of 3, from 5419 to 5435: score 0.5, E = 14
                   *->wdGkrwrlaepeiwvAe<-*
                      +dG  w+++ p++wv
  gi|1179254  5419    YDGAAWSVQSPDVWVDL    5435

LpxK: domain 3 of 3, from 5433 to 5450: score 1.5, E = 4.5
                   *->VeaelllddepaldelLlarla<-*
                      V++++    ++al +++l++l
  gi|1179254  5433    VDLQI----SEALKAKILDLLG    5450

Rep_fac_C: domain 3 of 3, from 5433 to 5453: score 3.9, E = 1.9
                CS    HHT.SSS-HHHHHHHHHHHHHH
                   *->krledipeslklellkeLgeie<-*
                      + l +i+e+lk+++l+ Lg +e
  gi|1179254  5433    VDL-QISEALKAKILDLLGQVE    5453

BESS: domain 3 of 3, from 5441 to 5452: score 1.2, E = 28
                   *->fKikiqqllfel<-*
                      +K ki++ll+++
  gi|1179254  5441    LKAKILDLLGQV    5452

DUF59: domain 3 of 3, from 5441 to 5454: score 4.5, E = 1.9
                CS    -HHHHHHHHTT-B-
                   *->lkeaileALktViD<-*
                      lk++il++L +V D
  gi|1179254  5441    LKAKILDLLGQVED    5454

Bombolitin: domain 3 of 3, from 5443 to 5459: score 1.6, E = 18
                   *->iKitDiLAKLGKvLAHv<-*
                       Ki+D+L ++  v+A
  gi|1179254  5443    AKILDLLGQVEDVIAGL    5459

CobU: domain 3 of 3, from 5455 to 5463: score 3.5, E = 1.2
                   *->VvaGlplKl<-*
                      V+aGlpl+l
  gi|1179254  5455    VIAGLPLDL    5463

DUF1771: domain 3 of 3, from 5491 to 5504: score 2.5, E = 6.9
                   *->eYqPGrlRaeAdkhgk<-*
                      +Y   +lR++A+++++
  gi|1179254  5491    DYL--KLRDAANAYFT    5504

Eclosion: domain 3 of 3, from 5512 to 5523: score 3.1, E = 2.6
                   *->DiaSIAPFLnkl<-*
                      D+ S+ +FLn+l
  gi|1179254  5512    DFPSVRGFLNAL    5523

FMN_bind: domain 3 of 4, from 5515 to 5530: score 4.3, E = 1.3
                   *->TSrafkkavqrAldka<-*
                      ++r+f++a+++Al+++
  gi|1179254  5515    SVRGFLNALNDALAAL    5530

RuvA_C: domain 4 of 4, from 5521 to 5532: score 2.6, E = 12
                CS    HHHHHCCHHHHH
                   *->daleeAvsALla<-*
                      +al++A++AL +
  gi|1179254  5521    NALNDALAALTS    5532

Pentapeptide: domain 47 of 70, from 5539 to 5554: score 3.9, E = 4.3
                CS    CCEE-TT-B-TT-B-T
                   *->rgadLsgAdLtgAnLs<-*
                      +g d sgA+L g+++s
  gi|1179254  5539    EGLDWSGANLAGVDFS    5554

Pentapeptide: domain 48 of 70, from 5558 to 5597: score 54.7, E = 4.3e-14
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       +L+g++++gA L+ga+++g dLtg+n+ gA+Lsga+++g
  gi|1179254  5558    LDLRGVDFSGALLKGANFTGLDLTGVNFAGADLSGAIFQG    5597

Anemone_cytotox: domain 3 of 3, from 5589 to 5608: score 0.3, E = 12
                CS    --TTEEEEGGG--HHHHHHH
                   *->avAGavIaGasLafkiLkkv<-*
                      ++ Ga+  G  L   iL kv
  gi|1179254  5589    DLSGAIFQGVGLPSAILRKV    5608

Beta-trefoil: domain 3 of 3, from 5597 to 5616: score 0.1, E = 8.1
                   *->GvalPPliirKVdkqkaiLd<-*
                      Gv lP  i+rKVd   aiLd
  gi|1179254  5597    GVGLPSAILRKVDFSDAILD    5616

Pentapeptide: domain 49 of 70, from 5603 to 5642: score 38.6, E = 1.2e-09
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a+L+ ++++ A+L g+d+sg dL+ An+s+A + g+n+s
  gi|1179254  5603    AILRKVDFSDAILDGIDFSGLDLRWANMSNAHMDGVNFSY    5642

zf-CHC2: domain 3 of 4, from 5607 to 5630: score 0.4, E = 22
                   *->klsFvEAVekLAdragielpyekg<-*
                      k++F++A+++ +d++g++l+  +
  gi|1179254  5607    KVDFSDAILDGIDFSGLDLRWANM    5630

Pentapeptide: domain 50 of 70, from 5699 to 5732: score 29.9, E = 2.9e-07
                CS    B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->nLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      +++g+dL+g  + g dL+g  L gAnL++a++s+
  gi|1179254  5699    DFSGFDLSGLRFDGIDLSGLKLIGANLRNAIFSD    5732

WSK: domain 3 of 3, from 5772 to 5785: score 6.5, E = 0.76
                   *->regegaWaSfKrLV<-*
                      ++ ++aWa +K+LV
  gi|1179254  5772    GSFAEAWAGIKKLV    5785

TMP: domain 5 of 6, from 5778 to 5788: score 8.8, E = 0.33
                   *->WngIkgffsga<-*
                      W gIk+ +sga
  gi|1179254  5778    WAGIKKLVSGA    5788

Pentapeptide: domain 51 of 70, from 5788 to 5827: score 33.2, E = 3.7e-08
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a++sg ++++ dL+  d+sg + +gA LsgAnL+++ L g
  gi|1179254  5788    ADFSGFDFSNWDLSTLDFSGINISGAKLSGANLKDSTLGG    5827

DUF2001: domain 4 of 5, from 5833 to 5845: score 1.4, E = 6.4
                   *->EvPFTFeDfelld<-*
                      +++F F+D+  +d
  gi|1179254  5833    DTDFSFSDWRGVD    5845

Pentapeptide: domain 52 of 70, from 5833 to 5873: score 7.5, E = 0.44
                CS    T-B-TTEEECCEE-TT-B     -TT-B-TT-B-TT-B-TC
                   *->gAnLrgAdLrgadLsgAd.....LtgAnLsgAnLsganLsg<-*
                      + +++ +d rg+dLsg  +  ++++g+n+ g ++ g n+
  gi|1179254  5833    DTDFSFSDWRGVDLSGLStllghFRGVNFAGLDFDGINFDP    5873

DUF2124: domain 3 of 3, from 5847 to 5858: score 0.8, E = 8.7
                   *->kGlsgmLreFke<-*
                      +Gls +L++F++
  gi|1179254  5847    SGLSTLLGHFRG    5858

Gly_radical: domain 3 of 3, from 5871 to 5889: score 3.9, E = 1.9
                CS    TTTT--CCCCHCCHHHHHC
                   *->vepginPmegkDaegplaf<-*
                      ++pg++++ g D+ g+l++
  gi|1179254  5871    FDPGVLEFSGADFSGALHL    5889

Pentapeptide: domain 53 of 70, from 5876 to 5886: score 1.0, E = 28
                CS    -EECT-B-TTE
                   *->anLsgAnLrgA<-*
                        +sgA+++gA
  gi|1179254  5876    LEFSGADFSGA    5886

Pentapeptide: domain 54 of 70, from 5906 to 5936: score 6.0, E = 1.2
                CS    TEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->gAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      gA ++g+dLsg    +  +++  ++g+++sg
  gi|1179254  5906    GASFKGVDLSGETSQNGKFKWGSFKGVDFSG    5936

Big_3: domain 3 of 5, from 5918 to 5945: score 1.5, E = 16
                   *->tyknGk........vtpddvtvsGdetvDts<-*
                      t++nGk + ++ ++v++++v++sG   +D s
  gi|1179254  5918    TSQNGKfkwgsfkgVDFSGVDFSG---IDLS    5945

Pentapeptide: domain 55 of 70, from 5937 to 5976: score 28.4, E = 7.7e-07
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       ++sg++L+g+dL+ + ++gA+L ++ + gA L g+++sg
  gi|1179254  5937    VDFSGIDLSGVDLSLSVFEGAVLESTLFDGALLGGVDFSG    5976

PHA_gran_rgn: domain 3 of 4, from 5975 to 5988: score 0.0, E = 38
                   *->sGVdGqlevtedki<-*
                      sGV G+++++++++
  gi|1179254  5975    SGVSGSIASAANAF    5988

OmpA: domain 3 of 4, from 6055 to 6071: score 3.1, E = 4.1
                   *->lFdfdkatLkpegqqlL<-*
                       F+f +++L+pe+ +++
  gi|1179254  6055    AFAFSSDDLLPEALAQV    6071

Nif11: domain 3 of 4, from 6056 to 6065: score 0.7, E = 29
                   *->feisgdeLla<-*
                      f++s+d+Ll
  gi|1179254  6056    FAFSSDDLLP    6065

Connexin50: domain 3 of 3, from 6101 to 6118: score 1.0, E = 6
                   *->TEVGgvEaspLpakPfeqF<-*
                      T VGg+ + pLp++ ++++
  gi|1179254  6101    TDVGGLLTVPLPSS-YDPY    6118

Tymo_coat: domain 3 of 3, from 6128 to 6148: score 0.9, E = 9.8
                CS    EEESSS-EEEEEEGGGSHHHH
                   *->tslGtkEtsaqisLAsadsiA<-*
                      +slG+++ sa++ LA+++ ++
  gi|1179254  6128    ASLGVQDISASLDLANIAGVT    6148

DUF2283: domain 3 of 3, from 6143 to 6153: score 2.1, E = 8.8
                   *->riVGIEiLnAS<-*
                      +i G++++ AS
  gi|1179254  6143    NIAGVTVESAS    6153

efhand: domain 4 of 6, from 6157 to 6181: score 1.2, E = 36
                CS    HHHHHHHHHTTTSSSEEHHHHHHHH
                   *->elkeaFkefDkDgDGkIsfeEfkaa<-*
                      ++ +  ++ D+DgDG++ + E++a+
  gi|1179254  6157    RVAASVDMQDVDGDGRLYYSELQAL    6181

Dockerin_1: domain 4 of 5, from 6166 to 6172: score 1.6, E = 23
                CS    -TT-SS-
                   *->DvNgDGk<-*
                      Dv+gDG+
  gi|1179254  6166    DVDGDGR    6172

HCV_NS4b: domain 3 of 3, from 6186 to 6195: score 0.1, E = 3.7
                   *->avqWmNRLLt<-*
                      ++ WmN L t
  gi|1179254  6186    PTNWMNHLVT    6195

ADP_ribosyl_GH: domain 3 of 3, from 6202 to 6217: score 1.0, E = 3.7
                CS    HH.HHHHHHHTT-SSHH
                   *->fepealllavnlGGDtD<-*
                      fe + l  avn GGD+D
  gi|1179254  6202    FE-AELQTAVNVGGDAD    6217

DUF1757: domain 3 of 3, from 6218 to 6236: score 2.1, E = 2.5
                   *->iGsllgaPvsallssrkln<-*
                      +G+llg P+++++s + ++
  gi|1179254  6218    LGALLGSPIVTIVSDQLFT    6236

NikM: domain 3 of 3, from 6233 to 6249: score 1.0, E = 4.5
                   *->qkvkTDanGvFsftpPk<-*
                      q ++TDanG++ f+ P+
  gi|1179254  6233    QLFTTDANGKVQFNAPE    6249

Cna_B: domain 3 of 3, from 6236 to 6246: score 1.3, E = 7.5
                CS    E--TTSEEEEE
                   *->tTdenGkytft<-*
                      tTd+nGk++f+
  gi|1179254  6236    TTDANGKVQFN    6246

DUF823: domain 3 of 3, from 6236 to 6246: score 0.2, E = 6.1
                   *->GvTgAdGtatft<-*
                       +T+A+G+++f+
  gi|1179254  6236    -TTDANGKVQFN    6246

Pirin_C: domain 3 of 3, from 6251 to 6261: score 0.9, E = 17
                CS    EEEEEE-TT-E
                   *->YlDitLeaGar<-*
                      YlDi+L+a+ +
  gi|1179254  6251    YLDIALTADQK    6261

LTXXQ: domain 3 of 4, from 6256 to 6268: score 4.2, E = 3.5
                   *->LTpEQrqqlkrlk<-*
                      LT++Q+++l +
  gi|1179254  6256    LTADQKDKLLEVL    6268

Herpes_UL1: domain 3 of 3, from 6260 to 6272: score 1.0, E = 8.7
                   *->qkdeTRlALYKElldaLdsal<-*
                      qkd         ll++Ld+++
  gi|1179254  6260    QKDK--------LLEVLDTLK    6272

SAM_PNT: domain 4 of 4, from 6262 to 6275: score 0.4, E = 16
                CS    HHHHHHHHHHHCCC
                   *->diLwehLqiLrkas<-*
                      d+L e L+ L++a+
  gi|1179254  6262    DKLLEVLDTLKSAG    6275

Antimicrobial_7: domain 3 of 3, from 6266 to 6282: score 1.9, E = 5.5
                   *->GKvwDwIKsiAkkvwnSe<-*
                        v+D+ Ks+    +nS+
  gi|1179254  6266    -EVLDTLKSAGDGALNSD    6282

Antimicrobial15: domain 3 of 4, from 6267 to 6275: score 2.7, E = 7.3
                   *->VlDILKnAa<-*
                      VlD LK A+
  gi|1179254  6267    VLDTLKSAG    6275

Sec3: domain 1 of 1, from 6295 to 6346: score 7.8, E = 0.02
                   *->LaeLepvilaEQdFivrFFhltslsnttfadyvtldpdgrrqlalpd
                      Lae++ +++ EQ Fi ++F lts+  + f+++  +d++ ++   +p
  gi|1179254  6295    LAEIFGAAEGEQTFIQKLFNLTSDATAYFNTTHLADSPVGS---EPK 6338

                   arrkgsrd<-*
                   a++ g+ d
  gi|1179254  6339 ATIRGLAD    6346

Pentapeptide: domain 56 of 70, from 6380 to 6419: score 53.6, E = 8.7e-14
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                        L++ +++gAdLrgad+sgAdL+g+++sgAnL ga++s
  gi|1179254  6380    QSLRNFDFSGADLRGADFSGADLSGVDFSGANLAGAIFST    6419

SIC: domain 3 of 3, from 6383 to 6404: score 1.8, E = 0.79
                   *->RnFDWsGddwsgDDWPEDDWsG<-*
                      RnFD+sG d  g D+   D sG
  gi|1179254  6383    RNFDFSGADLRGADFSGADLSG    6404

Beta-lactamase: domain 4 of 4, from 6409 to 6439: score 1.4, E = 4.6
                CS    SSTEEEEEEESESSCHHHH HHHHHHHHHHH
                   *->raglgvavltNrdgpnpda.adarlialaaa<-*
                      +a+l+ a+++++ g+n ++ ++  + ++ a
  gi|1179254  6409    GANLAGAIFSTTSGGNSSRaKLGGVNLQGAI    6439

Lysis_col: domain 3 of 3, from 6425 to 6436: score 1.2, E = 23
                   *->SSsSeLTGvavq<-*
                      SS ++L Gv +q
  gi|1179254  6425    SSRAKLGGVNLQ    6436

Pentapeptide: domain 57 of 70, from 6428 to 6467: score 51.1, E = 4.2e-13
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a L g+nL+gA+L g+ Lsg dL+gA+Ls+++Lsg++Ls
  gi|1179254  6428    AKLGGVNLQGAILDGVSLSGLDLRGADLSNTDLSGVDLSY    6467

Pentapeptide: domain 58 of 70, from 6514 to 6553: score 46.2, E = 9.5e-12
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       +Lsg +L+g+dL+g dLsg +LtgAnL+gAnL+++ Ls
  gi|1179254  6514    VDLSGYDLAGFDLSGLDLSGVNLTGANLTGANLRDVLLSS    6553

Pentapeptide: domain 59 of 70, from 6554 to 6573: score 11.8, E = 0.028
                CS    -B-TT-B-TT-B-TT-B-TC
                   *->AdLtgAnLsgAnLsganLsg<-*
                      A+L gA++sgA   g++++g
  gi|1179254  6554    ANLAGADFSGAFAWGVDFTG    6573

R_equi_Vir: domain 1 of 1, from 6572 to 6596: score 0.4, E = 7
                   *->vgseeydsaadsvnlavassnglvl<-*
                      +gs+++dsa++s +l++  +n +++
  gi|1179254  6572    TGSSGGDSATVSNMLVEKAANISAG    6596

Big_3: domain 4 of 5, from 6598 to 6626: score 0.1, E = 40
                   *->ledlfvsatyknGk.vtpddvtvsGdetvDts<-*
                      ++dl++ at+ n k++++++ ++sG   +D+s
  gi|1179254  6598    ASDLKDFATSNNFKgFDFSGWDLSG---IDFS    6626

Pentapeptide: domain 60 of 70, from 6613 to 6652: score 36.7, E = 4e-09
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       ++sg +L+g d++g dLs A L+g+nL+gA Ls a+Ls+
  gi|1179254  6613    FDFSGWDLSGIDFSGKDLSAALLRGVNLEGAILSTAILSQ    6652

Pentapeptide: domain 61 of 70, from 6654 to 6663: score 2.5, E = 10
                CS    -EECT-B-TT
                   *->anLsgAnLrg<-*
                      +++sgA+L+g
  gi|1179254  6654    SDFSGADLSG    6663

Pentapeptide: domain 62 of 70, from 6685 to 6724: score 20.8, E = 9.8e-05
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      +nL g +L+g  + g++L gA+L ++n   A + +anL+g
  gi|1179254  6685    TNLAGLDLSGLSFLGVNLAGANLADVNVDEASFDQANLKG    6724

DUF745: domain 1 of 1, from 6717 to 6738: score 2.3, E = 2.2
                   *->ckvgTigkgnakqKaSsIAqKAA<-*
                      ++++  +kg + ++ S+IA++AA
  gi|1179254  6717    FDQA-NLKGAILSGVSNIASGAA    6738

PNP_UDP_1: domain 1 of 1, from 6719 to 6768: score 1.5, E = 5.4
                CS    HHT-EEEEEEEE.E.....E-GGGTT--...------HHHHHHHHHH
                   *->elgipflairvisDlaagdgadeelthelRReeveefleeaaeraaa
                      +++++ ++++++s++a g  a + +         ++++ +a++  a+
  gi|1179254  6719    QANLKGAILSGVSNIASG-AAFQGALYD---GLTKFTGSDAETLKAK 6761

                CS HHH HHHH
                   lal.alla<-*
                     ++ ll+
  gi|1179254  6762 M-VeSLLE    6768

YceI: domain 2 of 2, from 6770 to 6801: score 3.9, E = 1.2
                   *->sdFGigygspllgkgamglksvgdeVtltidleak<-*
                      s F+ + +   +++   gl++ gdeV ++++ +++
  gi|1179254  6770    SRFNHNGPMISFTG---GLDMSGDEVVIDLNMQLN    6801

MmoB_DmpM: domain 1 of 1, from 6778 to 6796: score 5.3, E = 0.84
                CS    CCEESSEEEESSSEEEEES
                   *->lssfaGridedDDeftltw<-*
                      ++sf G +d+ +De+++
  gi|1179254  6778    MISFTGGLDMSGDEVVIDL    6796

DUF763: domain 1 of 1, from 6813 to 6818: score -1.3, E = 9.6
                   *->GiAdLP<-*
                      G+AdLP
  gi|1179254  6813    GVADLP    6818

PKD: domain 3 of 4, from 6897 to 6916: score 0.8, E = 11
                CS    EEEEEEETTCEEEEEEEEEEE
                   *->VtLtvsngvgsasattttvtV<-*
                      V++ v +++   +a+ +tv+V
  gi|1179254  6897    VQVEVVDSYLDLTAK-VTVEV    6916

DUF342: domain 1 of 1, from 6899 to 6933: score 0.7, E = 4.5
                   *->ievtvsdDkMkAtltltpp.ylgGkpltileeileaL<-*
                      +ev+ s  ++ A++t++ +++ ++ + t l  ++++L
  gi|1179254  6899    VEVVDSYLDLTAKVTVEVAdP-DDSDGT-LRILKSEL    6933

Big_3: domain 5 of 5, from 6904 to 6916: score 1.1, E = 21
                   *->tYkGqpvtatftVtV<-*
                      +Y+    ta++tV+V
  gi|1179254  6904    SYLD--LTAKVTVEV    6916

Gmad2: domain 1 of 1, from 6913 to 6926: score 2.5, E = 3.3
                   *->tleVfetSpsDGsgse<-*
                      t+eV ++++sDG+  +
  gi|1179254  6913    TVEVADPDDSDGT--L    6926

Peptidase_C39: domain 1 of 2, from 6913 to 6935: score 1.0, E = 9.5
                   *->kvlIaDPDpavGkiklsreeFek<-*
                      +v +aDPD ++G+ ++ ++e+++
  gi|1179254  6913    TVEVADPDDSDGTLRILKSELDA    6935

Nop53: domain 1 of 1, from 7008 to 7016: score -1.5, E = 8.5
                   *->LkDRyrsLQ<-*
                      LkDR +sL+
  gi|1179254  7008    LKDRILSLL    7016

MipZ: domain 1 of 1, from 7094 to 7103: score 0.6, E = 5.3
                   *->dLlagLnLpl<-*
                      +L+a LnLp+
  gi|1179254  7094    ALMANLNLPF    7103

Pentapeptide: domain 63 of 70, from 7113 to 7153: score 38.2, E = 1.5e-09
                CS    -EECT-B-TT EEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrg.AdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      a Lsg +++g AdLr+ +++gA L gAn+sg +Lsg+n+ g
  gi|1179254  7113    AKLSGTDFSGvADLRNFIFRGAQLDGANFSGLDLSGVNFLG    7153

Endonuc-EcoRV: domain 1 of 1, from 7127 to 7134: score -0.3, E = 8
                CS    HHHHTT.--
                   *->RNliYrqGk<-*
                      RN+i+r G+
  gi|1179254  7127    RNFIFR-GA    7134

AXH: domain 1 of 1, from 7161 to 7171: score 0.6, E = 8.3
                   *->FlkGtrlqlad<-*
                      F +G++l+lad
  gi|1179254  7161    FDAGSLLRLAD    7171

Pentapeptide: domain 64 of 70, from 7165 to 7204: score 40.3, E = 4.1e-10
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      + L+ A++ gA L ++d s  dL+g+n+sg nL+ga++sg
  gi|1179254  7165    SLLRLADFKGASLLNIDWSALDLSGVNFSGVNLEGADFSG    7204

DUF241: domain 1 of 1, from 7175 to 7180: score -0.4, E = 3.6
                   *->VSLLNI<-*
                      +SLLNI
  gi|1179254  7175    ASLLNI    7180

Herpes_TK_C: domain 1 of 2, from 7180 to 7185: score 1.8, E = 23
                   *->vdWaAL<-*
                      +dW+AL
  gi|1179254  7180    IDWSAL    7185

Pentapeptide: domain 65 of 70, from 7205 to 7244: score 60.0, E = 1.5e-15
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->anLsgAnLrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                       +Lsg+n++gA+Lrg+d+sgA+L+g+n+sgA+L+ga L +
  gi|1179254  7205    LDLSGVNFSGANLRGVDFSGANLRGVNFSGADLRGATLDM    7244

DUF2006: domain 1 of 1, from 7298 to 7310: score 0.1, E = 1.3
                   *->shvsGpVsGrGYlElTGY<-*
                      s      +G GYl l GY
  gi|1179254  7298    SG-----QGAGYLSLDGY    7310

DUF498: domain 1 of 1, from 7307 to 7324: score 1.4, E = 5.7
                   *->idgYgpGgfringvryeg<-*
                       dgY+++gf + g  + g
  gi|1179254  7307    LDGYSWDGFDLSGLDFSG    7324

Sperm_act_pep: domain 4 of 4, from 7314 to 7326: score 1.4, E = 47
                   *->GFsLgG...gGVg<-*
                      GF+L+G + +GV+
  gi|1179254  7314    GFDLSGldfSGVD    7326

Pentapeptide: domain 66 of 70, from 7316 to 7329: score 8.1, E = 0.3
                CS    B-TT-B-TT-B-TC
                   *->nLsgAnLsganLsg<-*
                      +Lsg ++sg+++s+
  gi|1179254  7316    DLSGLDFSGVDFSN    7329

Pentapeptide: domain 67 of 70, from 7332 to 7364: score 20.9, E = 9e-05
                CS    -TTEEECCEE-TT-B-TT-B-TT-B-TT-B-TC
                   *->LrgAdLrgadLsgAdLtgAnLsgAnLsganLsg<-*
                      L gA+Lrg+ + +A +  ++LsgA  ++++ sg
  gi|1179254  7332    LIGANLRGVSFANALFDTVDLSGAFAYRVDWSG    7364

Herpes_TK_C: domain 2 of 2, from 7359 to 7365: score 2.5, E = 15
                   *->vvdWaAL<-*
                      +vdW++L
  gi|1179254  7359    RVDWSGL    7365

LAGLIDADG_1: domain 1 of 1, from 7362 to 7370: score 5.0, E = 1.3
                CS    HHHHHHHHE
                   *->LaGFiDGeG<-*
                      ++G++DG+G
  gi|1179254  7362    WSGLTDGDG    7370

Pentapeptide: domain 68 of 70, from 7418 to 7432: score 3.4, E = 5.9
                CS    TTEEECCEE-TT-B-
                   *->rgAdLrgadLsgAdL<-*
                      +g+++rg dLsg d+
  gi|1179254  7418    SGFNFRGWDLSGVDF    7432

Pentapeptide: domain 69 of 70, from 7438 to 7464: score 7.8, E = 0.37
                CS    -EECT-B-TTEEECCEE-TT-B-TT-B
                   *->anLsgAnLrgAdLrgadLsgAdLtgAn<-*
                       ++sg+++  A L ++++ +A + gA+
  gi|1179254  7438    MDFSGVDFGFARLLNVNFGNASFDGAT    7464

MOSP_C: domain 1 of 1, from 7478 to 7491: score 2.4, E = 1.1
                   *->yThLltGLdaGVea<-*
                      +T+Ll+GL++GV++
  gi|1179254  7478    ATALLDGLFGGVDF    7491

DUF2001: domain 5 of 5, from 7607 to 7614: score 2.8, E = 2.7
                   *->FeDfelld<-*
                      F+Dfel+d
  gi|1179254  7607    FSDFELPD    7614

Sod_Fe_N: domain 1 of 1, from 7609 to 7618: score 0.8, E = 8.6
                CS    -S----SSST
                   *->kyeLPdLPYd<-*
                       +eLPdL +d
  gi|1179254  7609    DFELPDLNFD    7618

Plug: domain 1 of 1, from 7635 to 7677: score 5.6, E = 0.52
                CS    -GECCEEEETTEE-SSTSTTS..SBGCCEEEEEEEE.SCHTTTTSST
                   *->gssrvlilvDGvpigsvglssRIippeliervevlkDGpssalyGag
                      +s+ +++++DG    + ++    ++ + i  v+vl   ++sa ++a
  gi|1179254  7635    NSNSATFTLDGA---NLRG----LDLSGIGDVDVLS--AASAFFDAL 7672

                CS GSSEE
                   algGv<-*
                   ++  v
  gi|1179254  7673 TTFSV    7677

Pentapeptide: domain 70 of 70, from 7642 to 7655: score 6.5, E = 0.84
                CS    B-TT-B-TT-B-TC
                   *->nLsgAnLsganLsg<-*
                      +L gAnL+g +Lsg
  gi|1179254  7642    TLDGANLRGLDLSG    7655

L_lac_phage_MSP: domain 1 of 1, from 7770 to 7781: score 0.5, E = 5.1
                   *->DvtAGvavtdks<-*
                      D  AG+avt +s
  gi|1179254  7770    DLDAGIAVTTRS    7781

PSGP: domain 2 of 2, from 7825 to 7837: score 1.5, E = 27
                   *->DdAtsEAAtGPsg<-*
                      D At+E A G s
  gi|1179254  7825    DLATAEIAPGSSF    7837

Peptidase_C39: domain 2 of 2, from 7848 to 7865: score 0.3, E = 15
                   *->aDPDpavGkiklsreeFe<-*
                      aDPD+++Gk +++ ++++
  gi|1179254  7848    ADPDNSDGKARITVADLS    7865

Phage-tail_1: domain 1 of 1, from 7863 to 7872: score 3.9, E = 0.24
                CS    -SSEEEEEEH
                   *->DidGisImDy<-*
                      D+ G++I+Dy
  gi|1179254  7863    DLSGVTIADY    7872

Nif11: domain 4 of 4, from 7889 to 7901: score 0.3, E = 36
                   *->AkeaGfeisgdeLla<-*
                      A +aGf++  +++++
  gi|1179254  7889    ASVAGFNV--SDWGN    7901

DUF2453: domain 1 of 1, from 7954 to 7961: score 0.9, E = 9.4
                   *->LvaaiPFi<-*
                      L+a++PF+
  gi|1179254  7954    LNASLPFV    7961

Hep_Hag: domain 1 of 3, from 7988 to 8009: score 1.9, E = 23
                CS    ECSTT-EEESTT-EE-STTEEE
                   *->AtganStAiGsnakAsgensvA<-*
                      A g+ S ++ +++ +sg ++ A
  gi|1179254  7988    ADGTESNVLMDYYASSGTHTYA    8009

Attractin: domain 1 of 1, from 8037 to 8044: score 1.7, E = 8.1
                CS    TT-S----
                   *->sSTTlrPe<-*
                      +STT++P
  gi|1179254  8037    GSTTVGPF    8044

DASH_Ask1: domain 1 of 1, from 8086 to 8097: score 3.5, E = 3.4
                   *->feqSAnVsLtad<-*
                      f++S+n +L+ad
  gi|1179254  8086    FDASGNMQLSAD    8097

FecR: domain 1 of 1, from 8140 to 8153: score 2.8, E = 4.3
                   *->adgteVtVleGsVe<-*
                      + g+ V VleG+V
  gi|1179254  8140    NAGVTVGVLEGKVD    8153

Gag_p17: domain 1 of 1, from 8215 to 8225: score 2.1, E = 4.2
                   *->GAraSvLsggk<-*
                      GA + +L+gg+
  gi|1179254  8215    GADTAALTGGQ    8225

Corona_S2: domain 1 of 1, from 8240 to 8256: score -0.4, E = 4.7
                   *->sndtsvctepvltYSsf<-*
                      s+ +  +t pv+t S+f
  gi|1179254  8240    SIENVATTSPVITKSNF    8256

UPF0079: domain 1 of 1, from 8330 to 8357: score 2.4, E = 6
                CS    GGGGTTTS---SE..EEEEEECTTEEEEE
                   *->pErlpeiLpedriLFeirlkrlddgrrei<-*
                      +E + ++L++d   F++ l+r++d++ e+
  gi|1179254  8330    GESISPVLTDDV-AFDLVLRRAGDMQPEV    8357

Inhibitor_I68: domain 1 of 1, from 8357 to 8365: score 3.0, E = 1.1
                   *->vVFfllVLvs<-*
                       VF+++VL+s
  gi|1179254  8357    -VFSIMVLAS    8365

DUF387: domain 1 of 1, from 8369 to 8379: score 1.5, E = 8.1
                   *->GLksLdELPpl<-*
                      G++s+dEL++l
  gi|1179254  8369    GFTSIDELAEL    8379

PI3_PI4_kinase: domain 1 of 1, from 8386 to 8403: score 3.0, E = 2.2
                CS    .....HHHHHHSSS--TT
                   *->AvarGelmledglpdwrs<-*
                      Ava G+l++++ lp w s
  gi|1179254  8386    AVAYGALLVQTDLPAWVS    8403

Flagellin_IN: domain 1 of 6, from 8446 to 8481: score 7.1, E = 0.37
                   *->tltinggggkensvadgvdislsagdslaaladaINsaaaktGV<-*
                      tl+++ +g++           +s+ ds a++ d+I   +a tG+
  gi|1179254  8446    TLSFKLAGKTDQ------SFVVSGSDSDADIKDKIK--TALTGL    8481

DUF1914: domain 1 of 1, from 8487 to 8501: score 1.6, E = 7.7
                   *->isiNsisvkGlkGsldv<-*
                      + +N+i++  +kG + v
  gi|1179254  8487    VQANDIET--AKGNFEV    8501

Gp5_C: domain 1 of 6, from 8489 to 8501: score 3.0, E = 8.4
                CS    S-EEEEESS-EEE
                   *->GnesltVkGnrtv<-*
                      +n+ +t kGn++v
  gi|1179254  8489    ANDIETAKGNFEV    8501

TES: domain 1 of 1, from 8494 to 8508: score 2.5, E = 5.2
                   *->lyakGkfqarGnedkG<-*
                        akG+f   Gn d+G
  gi|1179254  8494    -TAKGNFEVAGNRDEG    8508

Laminin_G_1: domain 1 of 1, from 8529 to 8538: score 0.6, E = 9.9
                CS    EEECECCECC
                   *->FRTtepsGlL<-*
                      F++++p+G++
  gi|1179254  8529    FSASAPEGVI    8538

FBPase_glpX: domain 1 of 1, from 8533 to 8541: score 0.0, E = 6.3
                   *->APEGViSAA<-*
                      APEGViSA+
  gi|1179254  8533    APEGVISAV    8541

Peptidase_A4: domain 1 of 2, from 8697 to 8729: score 2.2, E = 1.1
                CS    -EEESEEEEEEEEEEETTEEE-STT-EEEEEEETTE
                   *->AdFgPtVtFtdasaTssGetVsldDAtivDIeqnge<-*
                      A+F+ +V F +   T+ +    + DAt ++++q +e
  gi|1179254  8697    ASFDLSVVFNGQTYTTAS---IAHDATATQVRQALE    8729

Flagellin_IN: domain 2 of 6, from 8700 to 8756: score 5.1, E = 1.4
                   *->tltinggggkensvadgvdislsagdslaaladaIN..saaaktGVs
                      +l+   +g++++      + s++ ++++ ++++a+ + s++++
  gi|1179254  8700    DLSVVFNGQTYT------TASIAHDATATQVRQALEsaSNGSSSLGA 8740

                   AsvdadtnggrLvltstt<-*
                    svd +t  +++ +t t+
  gi|1179254  8741 VSVDGET--ANIKVTGTG    8756

EB_dh: domain 1 of 1, from 8742 to 8764: score -0.1, E = 7.3
                   *->gtegsradvkaeakewkdgGkWtVvf<-*
                      + +g+ a +k++++  ++ G+Wt +f
  gi|1179254  8742    SVDGETANIKVTGT--GN-GFWTITF    8764

DUF211: domain 1 of 1, from 8743 to 8757: score 0.1, E = 6.9
                   *->IDkeTeNIKvTIeGd<-*
                      +D eT NIKvT  G+
  gi|1179254  8743    VDGETANIKVTGTGN    8757

Glyco_hydro_3: domain 1 of 1, from 8765 to 8776: score 2.5, E = 1.7
                   *->aalnAGlDmeMp<-*
                      ++++AG+D++++
  gi|1179254  8765    DGALAGVDIDLM    8776

SPOR: domain 1 of 1, from 8810 to 8832: score 4.0, E = 1.5
                CS    - ----B----BS-HHHHHHHHH
                   *->a.ggyyvQlGafsneanAealaa<-*
                      ++g + vQlG++++ ++  a+a+
  gi|1179254  8810    GtGSFKVQLGSSGSISDTLAAAS    8832

PTS_EIIA_2: domain 1 of 1, from 8828 to 8844: score 2.3, E = 4.7
                CS    HHH---HHHHHHHHTT-
                   *->LatattdeEllalLsgt<-*
                      La+a+t+++l a L+g
  gi|1179254  8828    LAAASTPQALQAALEGM    8844

BiPBP_C: domain 1 of 1, from 8906 to 8924: score 2.9, E = 3.2
                   *->fhtLtVvDadGrsdrvVrf<-*
                      f tLt+vD +G+s++ Vr
  gi|1179254  8906    FATLTAVDIAGKSAQEVRL    8924

OpuAC: domain 1 of 1, from 9062 to 9091: score 1.2, E = 6.9
                CS    -HHHHHHHHHHHHT S---HHHHHHHHHHH
                   *->dtedlnelnaqvdv.egkdpeevAkdWLke<-*
                      d  +++++ +q +++ g + e++A dW +
  gi|1179254  9062    DAGKVSQYRLQFEDnSGTSYETAAIDWDAT    9091

Phage_Coat_Gp8: domain 1 of 1, from 9073 to 9087: score 1.3, E = 8.3
                CS    XHHHHHHHHHHHHHH
                   *->aeaddaTsyAkeAfd<-*
                      +e +  Tsy ++A+d
  gi|1179254  9073    FEDNSGTSYETAAID    9087

BMC: domain 1 of 2, from 9093 to 9116: score 0.2, E = 39
                CS    HHHHHHHHHHHHHHHSTT-EEEEEESS--
                   *->aAVkaAveAgvaaaeevgelvsshVIprP<-*
                      ++V++A+  ++ aa+ v       V ++P
  gi|1179254  9093    GEVQTALNNALGAAGSVTV-----VDTNP    9116

DUF2401: domain 1 of 1, from 9232 to 9244: score 1.0, E = 6.3
                   *->stlsastVnqwls<-*
                      ++lsa++V+q+l
  gi|1179254  9232    GGLSADEVSQLLT    9244

Urm1: domain 1 of 1, from 9254 to 9261: score -1.2, E = 4.3
                CS    EEEEEEES
                   *->kitvEFlG<-*
                       i +EF+G
  gi|1179254  9254    AIDIEFGG    9261

FeThRed_B: domain 1 of 1, from 9309 to 9322: score 1.1, E = 6.7
                CS    HHHHHHHHHHHHHHH
                   *->ksLeamrkFaetYAk<-*
                        +++m+kFae +Ak
  gi|1179254  9309    -KFNTMDKFAEVFAK    9322

DOMON: domain 1 of 1, from 9510 to 9532: score 4.3, E = 1.8
                   *->cdyevsWnvdgdkiqiefeltvk<-*
                      ++++++W +++ +++++fe +++
  gi|1179254  9510    EAVKINWDTSAQQQRFQFESRTS    9532

Fimbrial: domain 1 of 1, from 9579 to 9611: score 0.5, E = 9.4
                   *->kagkVgvtFsGnanttgpddlllansagtggaAtg<-*
                      + g++g++F+ +++++  + ++ a+sa+    A++
  gi|1179254  9579    SSGTAGIAFDLVVDGDSSNPFTIAVSAA--EIANN    9611

Cys_Met_Meta_PP: domain 1 of 1, from 9614 to 9626: score -0.2, E = 7.9
                CS    HHHHHHHHHHHHH
                   *->vdDLiaDLeqALe<-*
                      v+DL+aDL+ A +
  gi|1179254  9614    VEDLLADLQDAID    9626

PalI: domain 1 of 1, from 9674 to 9695: score 2.9, E = 4.3
                   *->ISvPviksigflnltLgsyrvriggvk<-*
                       S P+i+++gfln tL+++    +g++
  gi|1179254  9674    -SDPIINQLGFLNGTLAKT----SGLS    9695

PapG_C: domain 1 of 1, from 9775 to 9784: score 2.3, E = 2.6
                   *->HGdlsIdsAng<-*
                       Gd+sIdsA g
  gi|1179254  9775    -GDISIDSAGG    9784

NAD_binding_3: domain 1 of 1, from 9798 to 9820: score 4.2, E = 1.5
                CS    GCGGGSSHHHHHHHCCCCCCSS-
                   *->kgAlasDealreeLrelAeasgv<-*
                      +g +a+D++lr e+ e+A a+g+
  gi|1179254  9798    VGVMARDLGLRLEITEAAPAAGA    9820

SRP1_TIP1: domain 1 of 1, from 9849 to 9865: score 4.8, E = 0.77
                   *->LePaIssALasagista<-*
                      L +aI sAL++ag s
  gi|1179254  9849    LNSAIQSALSDAGLSQF    9865

DUF859: domain 1 of 1, from 9892 to 9904: score -1.2, E = 5.7
                   *->fkSpqlYmltins<-*
                      f++p +  lt+++
  gi|1179254  9892    FTAPASHLLTLAG    9904

Borrelia_rep: domain 1 of 1, from 9902 to 9915: score 3.1, E = 7.8
                   *->LlSrSllsdfisas<-*
                      L+ rSl+sdfi  +
  gi|1179254  9902    LAGRSLISDFITPL    9915

TMP: domain 6 of 6, from 9993 to 10003: score 3.2, E = 15
                   *->WngIkgffsga<-*
                      W++I ++++ +
  gi|1179254  9993    WSSIIDGIKMV    10003

Orthopox_F7: domain 1 of 1, from 10024 to 10046: score 2.0, E = 2.8
                   *->EKsDintLDiKRRYRHaiEsvYF<-*
                      +Ks +  LDi   + HaiE +
  gi|1179254 10024    DKSVVDMLDIASQFAHAIEEIEN    10046

Antimicrobial15: domain 4 of 4, from 10027 to 10043: score 0.6, E = 34
                   *->VlDILKnAaKdlLAHlvek<-*
                      V+D L  A     AH++e
  gi|1179254 10027    VVDMLDIASQ--FAHAIEE    10043

DUF2150: domain 1 of 1, from 10051 to 10068: score 8.0, E = 0.078
                   *->GiDSisaAmsgpevyeee<-*
                      GiDS+++A++++ ++ ++
  gi|1179254 10051    GIDSLQTALADGFGISDD    10068

Dala_Dala_lig_N: domain 1 of 1, from 10075 to 10083: score 0.1, E = 8.8
                CS    HHHHHHHHH
                   *->gVlaSAvsM<-*
                      +Vl++A+s+
  gi|1179254 10075    DVLGHAISI    10083

AmoC: domain 1 of 1, from 10107 to 10134: score 2.8, E = 1.5
                   *->ALfvgGvalQiitrysnLvdvewnkqlr<-*
                      AL   G++ Q+i+    Lvdv   +q r
  gi|1179254 10107    ALVGPGTIDQLIGTVQSLVDVGAAAQVR    10134

POC4: domain 1 of 1, from 10205 to 10215: score 1.3, E = 0.57
                   *->AAIGAQSGLYI<-*
                      A I AQ GLY
  gi|1179254 10205    ANIDAQAGLYL    10215

Bile_Hydr_Trans: domain 1 of 1, from 10229 to 10244: score 2.1, E = 4.9
                   *->RhymapGVrRieVrEg<-*
                      Rhy++  V  ++V Eg
  gi|1179254 10229    RHYLSSAVSVRQVAEG    10244

Chitin_bind_4: domain 1 of 2, from 10263 to 10276: score 0.8, E = 18
                   *->GqtrtVtYtADden<-*
                      G  +t++Y ADd++
  gi|1179254 10263    GNLYTLNYAADDAF    10276

zf-CHC2: domain 4 of 4, from 10274 to 10291: score 3.5, E = 2.9
                   *->daIkFlMkieklsFvEAV<-*
                      da+ FlM+ e+ ++++++
  gi|1179254 10274    DAFRFLMEVEGKTYTTSL    10291

Alpha-L-AF_C: domain 1 of 1, from 10283 to 10324: score 1.5, E = 6.2
                CS    TTEEEEEEEE--SSS-EEEEEE-TTSTT-EEEEEEEEE...-S-TT
                   *->dggkltifvvNrdpteaatvevdlrGlgnlrvvehstlevLtsddl<
                      +g++ t +++Nr +t a +v v+l+   n +  ++s++   t+ dl
  gi|1179254 10283    EGKTYTTSLCNRYMT-ADEVAVALQDAFNFEGLSGSVV---TGTDL  10324

                CS
                   -*

  gi|1179254     -    -

DUF1873: domain 1 of 1, from 10290 to 10295: score 1.4, E = 2.9
                   *->SLkaRY<-*
                      SL++RY
  gi|1179254 10290    SLCNRY    10295

PKD: domain 4 of 4, from 10309 to 10349: score 3.1, E = 2.1
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS.SSS
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdFGDggsp
                      ++ +        +  g  Vt t+++ +d+d G p+ +s +FG+
  gi|1179254 10309    FNFE--------GLSGSVVTGTDLA-LDGD-GLPTGWSFTFGG---- 10341

                CS EEEECSSEEE
                   gttstepnvt<-*
                      + +++vt
  gi|1179254 10342 --QLAGQTVT    10349

DNA_gyraseA_C: domain 4 of 4, from 10354 to 10372: score 0.1, E = 51
                CS    EGSGTS-TTTT-SEEEEEEECT
                   *->kainllkLkegdkvvsvlvvne<-*
                      k+i   ++ + d+v +v v+++
  gi|1179254 10354    KVI---DIAPTDEVQWVKVASG    10372

CUB: domain 1 of 1, from 10423 to 10435: score 0.7, E = 8.9
                CS    SSTTS----EEEE
                   *->DssiqkrGFkaty<-*
                      D+s+++ G+  t+
  gi|1179254 10423    DASNSSLGWDVTF    10435

Attacin_N: domain 2 of 4, from 10436 to 10458: score 8.2, E = 0.19
                   *->gpaTaGlaldvNvnGHGlSLtkth<-*
                      g a aG+al+ N +GHG  L++ +
  gi|1179254 10436    GGALAGVALE-NMRGHGDNLSHQG    10458

Attacin_N: domain 3 of 4, from 10470 to 10479: score 0.8, E = 23
                   *->qhGsvtvNsd<-*
                      ++Gsvt+N++
  gi|1179254 10470    TAGSVTTNTK    10479

SEA: domain 1 of 1, from 10483 to 10584: score 1.4, E = 9.3
                   *->pktqvfpgsfkitnvdgelqysedledpsSaeyqelardiesqlnei
                       ++   +gsf++   +g+  ys+  +   S+   +la++i+++l+++
  gi|1179254 10483    NVVAGTGGSFTLSYQEGSTTYSSA-AIAYSEDSATLAANIQQALQNA 10528

                   frkSslkpgyvgglrvqvvkfrpekekdngsvvvdfdviFrptteesavd
                   ++        +    ++ v+++       +s +  f+++F  + +    +
  gi|1179254 10529 YNA-------GM---SNTVSVT------ANSSRGGFNIEF--AGDLAGKA 10560

                   kteiseeleaalrsqsgnlkidss<-*
                   +t++ ++  + +   +g + +d++
  gi|1179254 10561 ITQLVADTTNLSAGIFGSIFRDVD    10584

L-fibroin: domain 1 of 1, from 10507 to 10529: score 5.1, E = 0.68
                   *->avAnggnaigaaakakselanAa<-*
                      a+A   + + +aa+ +++l nA+
  gi|1179254 10507    AIAYSEDSATLAANIQQALQNAY    10529

OmpA: domain 4 of 4, from 10509 to 10530: score 1.2, E = 14
                   *->lFdfdkatLkpegqqlLdaiAd<-*
                       +  d+atL+++ qq+L++ ++
  gi|1179254 10509    AYSEDSATLAANIQQALQNAYN    10530

SLT_beta: domain 1 of 1, from 10520 to 10553: score 2.1, E = 4.3
                CS    THHHHHHHHHHHT-EEEEE-SS-STTEB--EEEEE
                   *->nLqsLLlsAqltGmtvtiKssaCesGsGFaEviFr<-*
                      n+q  L+ A   Gm  t+   a  s +GF  + F
  gi|1179254 10520    NIQQALQNAYNAGMSNTVSVTANSSRGGF-NIEFA    10553

Peptidase_C69: domain 1 of 1, from 10526 to 10543: score 0.1, E = 4.6
                   *->iNeaNVAMSATETittNe<-*
                      +N++N +MS+T+++t+N+
  gi|1179254 10526    QNAYNAGMSNTVSVTANS    10543

Vac_Fusion: domain 1 of 1, from 10622 to 10643: score 2.4, E = 0.78
                   *->krikdlelRLlvLeklfqlivk<-*
                      ++  ++e+R++ L   fq +v+
  gi|1179254 10622    MDMGNVEIRITDLKSMFQALVD    10643

DUF1025: domain 1 of 1, from 10624 to 10633: score 1.3, E = 8.4
                   *->ldnVvIlVeD<-*
                      ++nV+I++ D
  gi|1179254 10624    MGNVEIRITD    10633

UPF0061: domain 1 of 1, from 10628 to 10645: score -1.0, E = 9
                   *->ELdtseLkkLyeklrnPy<-*
                      E+  + Lk  +++l+ P+
  gi|1179254 10628    EIRITDLKSMFQALVDPN    10645

CRT10: domain 1 of 1, from 10658 to 10669: score 1.8, E = 1.8
                   *->VytdgllvaYkI<-*
                      Vy d+++v+Y++
  gi|1179254 10658    VYDDAYIVNYQL    10669

DASH_Dad4: domain 1 of 1, from 10682 to 10694: score 0.9, E = 8.6
                   *->MENPHltatctPs<-*
                      MENP+l     Ps
  gi|1179254 10682    MENPFLRLLRDPS    10694

Utp13: domain 1 of 1, from 10700 to 10708: score 0.6, E = 9.2
                   *->LDYtlreMd<-*
                      +DY+l+ M+
  gi|1179254 10700    IDYVLKGMQ    10708

DUF583: domain 1 of 2, from 10725 to 10734: score 0.6, E = 17
                   *->eIeeGAqfeG<-*
                      + ++GAqf+G
  gi|1179254 10725    QLAQGAQFIG    10734

PHA_gran_rgn: domain 4 of 4, from 10736 to 10752: score 2.4, E = 9.2
                   *->fkgrIEqEIekaLDklL<-*
                      f+g++ q I++aLD +L
  gi|1179254 10736    FRGSVVQGIRDALDSAL    10752

FMN_bind: domain 4 of 4, from 10741 to 10755: score 0.0, E = 21
                   *->SrafkkavqrAldka<-*
                      ++++++a+  Ald +
  gi|1179254 10741    VQGIRDALDSALDEY    10755

Dockerin_1: domain 5 of 5, from 10773 to 10781: score 0.2, E = 63
                CS    -TT-SS--S
                   *->DvNgDGkVn<-*
                      D +gDG+++
  gi|1179254 10773    DTDGDGVID    10781

efhand: domain 5 of 6, from 10773 to 10792: score 5.3, E = 2.7
                CS    TTTSSSEEHHHHHHHHHHHH
                   *->DkDgDGkIsfeEfkaalkkl<-*
                      D+DgDG I+   ++++ + +
  gi|1179254 10773    DTDGDGVIDPASMVEWAAGT    10792

DUF915: domain 1 of 1, from 10801 to 10816: score 0.1, E = 7.6
                   *->dlengkqsDGiVpwaS<-*
                      ++ +++++DGiV++++
  gi|1179254 10801    NYLSDYDGDGIVSVDD    10816

ThiS: domain 1 of 1, from 10818 to 10828: score 0.7, E = 5.2
                CS    EEEEEEE----
                   *->evaiiPpVgGG<-*
                      +v+++ + +GG
  gi|1179254 10818    VVEFLAAAQGG    10828

Sigma70_r3: domain 1 of 1, from 10844 to 10866: score 6.4, E = 0.62
                   *->eeeDselgdlleDdeaespedav<-*
                      +++D+++gd+++   a +p d +
  gi|1179254 10844    SDGDDTPGDVIPTGGASDPFDVA    10866

Big_1: domain 1 of 1, from 10975 to 10993: score 0.5, E = 9.9
                CS    EEEEEEET.TECEEEEEEEE
                   *->ytVtAslanngatsvdaktV<-*
                      +tVtA ++ +g+ s+ ++t
  gi|1179254 10975    ATVTAGTE-GGSGSNESQTI    10993

PPC: domain 1 of 2, from 10989 to 11065: score 2.9, E = 3.9
                CS    -EEEEEEEESTTCEEEEEEECTSSS...S...CCEEEEEEECCCS E
                   *->dvdvysFtvpaggtlsisldggsslrslsgnGdadtlLywlldgd.p
                      ++++  +t+++ g+ +++ ++gs         +++t L+ + ++d++
  gi|1179254 10989    ESQTIAITAATQGSFTLKFNDGSR--------NFKT-LD-INYSDdG 11025

                CS SSSS          TTCE-.....ECCTTEEEEEECC.-SEEEEEEEEE
                   slsa..........ydaystTrdvdnggsdelisftapeaGtYyirVyg<
                   +++a++ ++  ++ ++ +          + + is+t++ +GtY ++  g
  gi|1179254 11026 NTQAsniqkalnkaFSRDL---------NGSDISVTNNGDGTYGVTFAG  11065

                CS
                   -*

  gi|1179254     -    -

Flagellin_IN: domain 3 of 6, from 11002 to 11065: score 1.2, E = 18
                   *->tltinggggkensvadgvdislsagdslaa..ladaIN....saaak
                      ++t++ ++g+ n  + + di++s++ ++ a+++ +a+N+  +++  +
  gi|1179254 11002    SFTLKFNDGSRN--FKTLDINYSDDGNTQAsnIQKALNkafsRDLNG 11046

                   tGVsAsvdadtnggrLvltstt<-*
                     +s + + d   g  ++t ++
  gi|1179254 11047 SDISVTNNGD---GTYGVTFAG    11065

STN: domain 1 of 1, from 11031 to 11064: score 4.6, E = 1.7
                CS    -HHHHHHHHHT    TS-EEEEE-SSSEEEEEE-
                   *->tlddALdrlLa....gsgLeyrrqgnntivigpa<-*
                      +++ AL+  + ++ +gs++++   g++t+ + +a
  gi|1179254 11031    NIQKALNKAFSrdlnGSDISVTNNGDGTYGVTFA    11064

Filamin: domain 1 of 1, from 11048 to 11063: score 6.1, E = 0.41
                CS    ....EEEE-SSSEEEEEE
                   *->evkvkveDngDGtYtVsY<-*
                      +++v+  +ngDGtY V++
  gi|1179254 11048    DISVT--NNGDGTYGVTF    11063

efhand: domain 6 of 6, from 11142 to 11154: score 1.0, E = 41
                CS    TTTSSSEEHHHHH
                   *->DkDgDGkIsfeEf<-*
                      D + DG+++f+E+
  gi|1179254 11142    DPNDDGRLTFKEM    11154

DUF946: domain 1 of 1, from 11180 to 11189: score -0.2, E = 0.91
                   *->pepetFslPs<-*
                      +++++Fs+Ps
  gi|1179254 11180    TIDAEFSFPS    11189

Herpes_gE: domain 1 of 1, from 11200 to 11214: score -0.2, E = 3.6
                   *->dvdgpssggSGytvWf<-*
                      ++ gp +g SGy+++f
  gi|1179254 11200    YA-GPAAGASGYDAYF    11214

BMC: domain 2 of 2, from 11338 to 11352: score 3.0, E = 7
                CS    EE-HHHHHHHHHHHH
                   *->vtGDVaAVkaAveAg<-*
                      ++GDV++V +A++ g
  gi|1179254 11338    LEGDVGDVDSAIDNG    11352

Hep_Hag: domain 2 of 3, from 11348 to 11367: score 1.3, E = 34
                CS    ECSTT-EEESTT-EE-STTE
                   *->AtganStAiGsnakAsgens<-*
                      A  ++St+ G++a+As ++s
  gi|1179254 11348    AIDNGSTSGGGDATASQAKS    11367

Monooxygenase_B: domain 1 of 1, from 11387 to 11406: score 0.7, E = 4
                CS    GG---EEE-TTS-EEETTTT
                   *->aDFtNPVtlLTGeTVDlETy<-*
                      +DF N + lLTG T Dl T+
  gi|1179254 11387    SDFSNIINLLTGKTADLVTF    11406

Opacity: domain 1 of 1, from 11487 to 11496: score 2.4, E = 5.2
                   *->eakaGvRykF<-*
                      ea +GvR++F
  gi|1179254 11487    EATIGVRVSF    11496

Linocin_M18: domain 1 of 1, from 11503 to 11524: score 2.9, E = 1.1
                   *->sgikGiLsasgnlREalsdwekvgni<-*
                      +g++G+ +++g     l +we+++++
  gi|1179254 11503    AGVEGGIKFKGD----LDLWEDPEEA    11524

DUF790: domain 1 of 1, from 11526 to 11538: score 1.3, E = 4.7
                   *->GKIpykeVikvLr<-*
                      GK++++e+i++L+
  gi|1179254 11526    GKLRVSEIIAALE    11538

RAMPs: domain 1 of 1, from 11526 to 11562: score 0.0, E = 8.9
                   *->grvifsDAPtdAlLlfPVrSigvfayvTsPlvlrflevlvgellevk
                      g++++s+
  gi|1179254 11526    GKLRVSE---------------------------------------- 11532

                   kqleakledlkkklikrlailsddlfsdlvk.yleektevain<-*
                                +i  l + ++++fs+++  +l +k++v in
  gi|1179254 11533 -------------IIAALECNPLNIFSIHIRvSLYIKAYVDIN    11562

Endonuc-HincII: domain 1 of 1, from 11554 to 11569: score 0.1, E = 8.6
                CS    -SGGGHHHHHHHHTTBEE
                   *->sFiKPiYqDinsiLiGqK<-*
                       +iK  Y Dinsi+ G K
  gi|1179254 11554    -YIKA-YVDINSIIAGWK    11569

ACP_syn_III: domain 1 of 1, from 11596 to 11611: score 5.3, E = 1.2
                CS    EE......SS--.B---EEEE-G
                   *->asdetgdeeepgailssvlgsDG<-*
                      as        +g +l+ ++gsDG
  gi|1179254 11596    AS------VNDG-VLDLHMGSDG    11611

PEP-utilizers: domain 1 of 1, from 11610 to 11621: score 2.6, E = 5.2
                CS    TTEEEEE.CTSEE
                   *->dGdiitvCDGstG<-*
                      dG  +tv DG+t
  gi|1179254 11610    DGTPVTV-DGYTA    11621

HemolysinCabind: domain 3 of 36, from 11676 to 11684: score 1.9, E = 21
                CS    EEESSCGEE
                   *->yGgaGnDtl<-*
                      y g+G+Dt+
  gi|1179254 11676    YTGSGDDTI    11684

HemolysinCabind: domain 4 of 36, from 11697 to 11714: score 18.9, E = 0.00015
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G+Gn+t+ Gg+G+D+l
  gi|1179254 11697    IAGEGNNTIIGGGGDDVL    11714

Gp5_C: domain 2 of 6, from 11701 to 11724: score 1.7, E = 21
                CS    S-EEEEESS-EEEEESSEEEEEES
                   *->GnesltVkGnrtvtVgGnqTtsVg<-*
                      Gn +++ +G   v++gG++ t ++
  gi|1179254 11701    GNNTIIGGGGDDVLIGGTELTILE    11724

HemolysinCabind: domain 5 of 36, from 11722 to 11732: score 6.1, E = 1.1
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      +L Gg+G+D+l
  gi|1179254 11722    ILEGGKGDDLL    11732

HemolysinCabind: domain 6 of 36, from 11740 to 11750: score 3.6, E = 6.3
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      tL+G+ G+Dt+
  gi|1179254 11740    TLRGDLGADTY    11750

CHASE4: domain 1 of 1, from 11748 to 11764: score 1.6, E = 6.3
                   *->DtYeFvqnrvrnpwaYiesN<-*
                      DtY+F+++   +  aYie N
  gi|1179254 11748    DTYRFLED--WDT-AYIEDN    11764

Reo_P9: domain 1 of 1, from 11774 to 11784: score -1.2, E = 9.1
                   *->kvDlSkidfdv<-*
                      +vD+S i +d
  gi|1179254 11774    TVDFSDIALDL    11784

WW: domain 1 of 1, from 11794 to 11806: score 2.7, E = 8.6
                CS    EETTTTEEESS-S
                   *->yNhnTkttqWekP<-*
                      ++ n+++  W++P
  gi|1179254 11794    FDANNNRVLWDDP    11806

Avian_gp85: domain 1 of 1, from 11799 to 11811: score 3.0, E = 1.1
                   *->LNvSLwDePqELqL<-*
                       N  LwD+P+EL L
  gi|1179254 11799    -NRVLWDDPSELGL    11811

HemolysinCabind: domain 7 of 36, from 11813 to 11830: score 2.2, E = 17
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG GnD ++  +   +l
  gi|1179254 11813    LGGSGNDFMDMSGDQERL    11830

Cytokin-bind: domain 1 of 1, from 11819 to 11830: score -0.9, E = 8.9
                CS    -HHHHHHHHHHH
                   *->DFaaFTeDQErL<-*
                      DF++++ DQErL
  gi|1179254 11819    DFMDMSGDQERL    11830

DUF583: domain 2 of 2, from 11870 to 11884: score 1.9, E = 7.1
                   *->hypsLeIeeGAqfeG<-*
                      h+++ +I++GA + G
  gi|1179254 11870    HSDAFVIDAGAAVSG    11884

HemolysinCabind: domain 8 of 36, from 11943 to 11960: score 9.1, E = 0.14
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG+G+D L G+   +++
  gi|1179254 11943    IGGGGDDLLIGNYMQNII    11960

T4_gp9_10: domain 1 of 1, from 11956 to 11967: score 4.3, E = 0.48
                CS    -----TT-STTS
                   *->KqlIdiGeiGdd<-*
                      +q+I+iG++G+d
  gi|1179254 11956    MQNIIIGNAGSD    11967

HemolysinCabind: domain 9 of 36, from 11961 to 11978: score 17.0, E = 0.00055
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+aG DtL G + +D++
  gi|1179254 11961    IGNAGSDTLEGRDADDLI    11978

DUF2095: domain 1 of 1, from 11998 to 12011: score 2.8, E = 2.4
                   *->PKKEWGWYERHGkH<-*
                      P +EW WYE   k
  gi|1179254 11998    PSREWTWYEHEVKN    12011

HemolysinCabind: domain 10 of 36, from 12014 to 12031: score 8.3, E = 0.24
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                         aG  tL G++GnD+l
  gi|1179254 12014    EASAGVQTLKGDEGNDIL    12031

HemolysinCabind: domain 11 of 36, from 12032 to 12049: score 16.0, E = 0.0011
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G +GnD+ y g+GnDt
  gi|1179254 12032    MGENGNDRFYTGNGNDTV    12049

Proteasome_A_N: domain 1 of 2, from 12052 to 12073: score 3.1, E = 8.7
                CS    TTSSTT---TTS--HHHHHHHHH
                   *->ydrslttFSpdGrlfQveYAlkA<-*
                       dr++  F + Grl+ ++ ++++
  gi|1179254 12052    -DRAALDFDSRGRLLEIDNSTRS    12073

RHS_repeat: domain 1 of 1, from 12058 to 12075: score 2.3, E = 8.4
                   *->YDanGrLtavtdpsgpvg<-*
                      +D++GrL+++ +++ ++g
  gi|1179254 12058    FDSRGRLLEIDNSTRSEG    12075

HemolysinCabind: domain 12 of 36, from 12072 to 12089: score 0.3, E = 64
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +  +G Dt++  +Gn ++
  gi|1179254 12072    RSEGGSDTITALNGNHLI    12089

HemolysinCabind: domain 13 of 36, from 12090 to 12107: score 6.6, E = 0.78
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GGaG D ++ g+Gn t+
  gi|1179254 12090    FGGAGGDNITSGSGNSTI    12107

RTX: domain 1 of 1, from 12109 to 12119: score -1.0, E = 3.7
                   *->tdtGaLTIDgt<-*
                      +d+G+L +D+
  gi|1179254 12109    GDVGKLSFDAS    12119

HemolysinCabind: domain 14 of 36, from 12139 to 12156: score 0.6, E = 52
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + + G +++ Gg   D++
  gi|1179254 12139    NVTTGSNVIIGGVAGDQI    12156

Plasmod_MYXSPDY: domain 1 of 1, from 12177 to 12192: score 4.7, E = 3.1
                   *->mYfsPdytLrlvqLpdt<-*
                       Y sPd    l+  p t
  gi|1179254 12177    -YASPDVLSSLIAAPQT    12192

DUF1391: domain 1 of 2, from 12199 to 12212: score 2.0, E = 8.4
                   *->etldlGnnEslvlG<-*
                      +t+ lGn +s+v G
  gi|1179254 12199    DTISLGNGDSIVAG    12212

HemolysinCabind: domain 15 of 36, from 12202 to 12219: score 3.0, E = 9.5
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G+G+ +  Gg G D++
  gi|1179254 12202    SLGNGDSIVAGGLGQDVI    12219

Glyco_hydro_65C: domain 2 of 3, from 12236 to 12254: score 1.3, E = 20
                   *->Gd.apLtirvaGkevtLdg<-*
                      Gd+ ++t +vaG+ v+L+
  gi|1179254 12236    GDhGAMTFDVAGELVQLET    12254

Proteasome_A_N: domain 2 of 2, from 12237 to 12253: score 1.4, E = 26
                CS    TTSSTT---TTS--HHHH
                   *->ydrslttFSpdGrlfQve<-*
                       d+ + tF   G l+Q e
  gi|1179254 12237    -DHGAMTFDVAGELVQLE    12253

PGA2: domain 1 of 1, from 12241 to 12249: score 2.0, E = 3.5
                   *->itfdVkGyl<-*
                      +tfdV+G l
  gi|1179254 12241    MTFDVAGEL    12249

Gp5_C: domain 3 of 6, from 12288 to 12299: score 1.0, E = 36
                CS    S-EEEEESS-EE
                   *->GnesltVkGnrt<-*
                      G++s+t+ G+ t
  gi|1179254 12288    GDDSVTIAGTTT    12299

HemolysinCabind: domain 16 of 36, from 12335 to 12340: score 0.7, E = 48
                CS    SSCGEE
                   *->aGnDtl<-*
                      +GnDt+
  gi|1179254 12335    GGNDTI    12340

CamS: domain 1 of 4, from 12340 to 12350: score 1.6, E = 3
                   *->iReAnedepfV<-*
                      iR+An+d++ V
  gi|1179254 12340    IRTANGDKVIV    12350

HemolysinCabind: domain 17 of 36, from 12341 to 12358: score 3.7, E = 6.1
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +  +G+ ++ Gg G D +
  gi|1179254 12341    RTANGDKVIVGGFGQDSI    12358

Flagellin_N: domain 1 of 3, from 12344 to 12376: score 0.6, E = 14
                CS    TB-TTTS-...EEEEEE-SSSTT-EEEEEE---ST
                   *->NGqklLdggttfknvsfqvganagetikvdlgsvs<-*
                      NG k+  g  +f++ s+ v a +++  +++ ++v
  gi|1179254 12344    NGDKVIVG--GFGQDSITVQATSNSNRHIGGDNVA    12376

Phage_HK97_TLTM: domain 1 of 1, from 12361 to 12372: score -0.8, E = 9.6
                   *->eAiRNkskskGG<-*
                      +A  N+ ++ GG
  gi|1179254 12361    QATSNSNRHIGG    12372

Calsarcin: domain 1 of 3, from 12394 to 12414: score 0.4, E = 2.1
                   *->vitvePtDDislPLDGESEeL<-*
                      v t+   D i++ LDG S +L
  gi|1179254 12394    VATTGAEDSITIGLDGDSSDL    12414

Rrp15p: domain 1 of 2, from 12422 to 12438: score 2.1, E = 5.9
                   *->gfAdaiakiLssklpat<-*
                      g Ad+++++L+s+++ +
  gi|1179254 12422    GMADDTVNVLGSTTSRD    12438

DUF1631: domain 1 of 1, from 12459 to 12473: score -1.7, E = 8.4
                   *->AleaVirrLRkLqGa<-*
                      Al +V  +LR L G+
  gi|1179254 12459    ALRSVTSTLRDLGGN    12473

HemolysinCabind: domain 18 of 36, from 12466 to 12476: score 1.0, E = 39
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      tL+  +GnDt+
  gi|1179254 12466    TLRDLGGNDTI    12476

CamS: domain 2 of 4, from 12476 to 12486: score 1.6, E = 3
                   *->iReAnedepfV<-*
                      iR+An+d++ V
  gi|1179254 12476    IRTANGDKVIV    12486

HemolysinCabind: domain 19 of 36, from 12477 to 12494: score 3.7, E = 6.1
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +  +G+ ++ Gg G D +
  gi|1179254 12477    RTANGDKVIVGGFGQDSI    12494

Flagellin_N: domain 2 of 3, from 12480 to 12512: score 0.6, E = 14
                CS    TB-TTTS-...EEEEEE-SSSTT-EEEEEE---ST
                   *->NGqklLdggttfknvsfqvganagetikvdlgsvs<-*
                      NG k+  g  +f++ s+ v a +++  +++ ++v
  gi|1179254 12480    NGDKVIVG--GFGQDSITVQATSNSNRHIGGDNVA    12512

Calsarcin: domain 2 of 3, from 12530 to 12550: score 0.4, E = 2.1
                   *->vitvePtDDislPLDGESEeL<-*
                      v t+   D i++ LDG S +L
  gi|1179254 12530    VATTGAEDSITIGLDGDSSDL    12550

HemolysinCabind: domain 20 of 36, from 12602 to 12612: score 1.0, E = 39
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      tL+  +GnDt+
  gi|1179254 12602    TLRDLGGNDTI    12612

CamS: domain 3 of 4, from 12612 to 12622: score 1.6, E = 3
                   *->iReAnedepfV<-*
                      iR+An+d++ V
  gi|1179254 12612    IRTANGDKVIV    12622

HemolysinCabind: domain 21 of 36, from 12613 to 12630: score 3.7, E = 6.1
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +  +G+ ++ Gg G D +
  gi|1179254 12613    RTANGDKVIVGGFGQDSI    12630

Flagellin_N: domain 3 of 3, from 12616 to 12648: score 0.6, E = 14
                CS    TB-TTTS-...EEEEEE-SSSTT-EEEEEE---ST
                   *->NGqklLdggttfknvsfqvganagetikvdlgsvs<-*
                      NG k+  g  +f++ s+ v a +++  +++ ++v
  gi|1179254 12616    NGDKVIVG--GFGQDSITVQATSNSNRHIGGDNVA    12648

Calsarcin: domain 3 of 3, from 12666 to 12686: score 0.4, E = 2.1
                   *->vitvePtDDislPLDGESEeL<-*
                      v t+   D i++ LDG S +L
  gi|1179254 12666    VATTGAEDSITIGLDGDSSDL    12686

Rrp15p: domain 2 of 2, from 12694 to 12710: score 2.1, E = 5.9
                   *->gfAdaiakiLssklpat<-*
                      g Ad+++++L+s+++ +
  gi|1179254 12694    GMADDTVNVLGSTTSRD    12710

Baculo_VP39: domain 1 of 1, from 12739 to 12754: score 0.1, E = 7.7
                   *->ivVPLfLGsQiintqn<-*
                      ++V Lf G+++i t n
  gi|1179254 12739    LYVELFGGNDTIRTAN    12754

HemolysinCabind: domain 22 of 36, from 12745 to 12750: score 0.7, E = 48
                CS    SSCGEE
                   *->aGnDtl<-*
                      +GnDt+
  gi|1179254 12745    GGNDTI    12750

CamS: domain 4 of 4, from 12750 to 12760: score 1.6, E = 3
                   *->iReAnedepfV<-*
                      iR+An+d++ V
  gi|1179254 12750    IRTANGDKVIV    12760

HemolysinCabind: domain 23 of 36, from 12751 to 12768: score 0.1, E = 74
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +  +G+ ++ Gg G D +
  gi|1179254 12751    RTANGDKVIVGGLGQDGI    12768

Myosin_N: domain 1 of 1, from 12766 to 12784: score 3.6, E = 4.5
                CS    TEEEEEETTT.TEEEEEETCC
                   *->dkVtVktedtSGktvtVkkDd<-*
                      d +tV+t     +++ ++ D+
  gi|1179254 12766    DGITVETNS--DSKRQISGDN    12784

Glyco_hydro_65C: domain 3 of 3, from 12781 to 12800: score 0.7, E = 29
                   *->gGd.apLtirvaGkevtLdg<-*
                      +Gd++ Lt +++G+ + L+
  gi|1179254 12781    SGDnVSLTYDTYGELYILQT    12800

DUF1177: domain 1 of 1, from 12792 to 12804: score -0.1, E = 7.6
                   *->YGkLshLqtlgke<-*
                      YG+L  Lqtl ++
  gi|1179254 12792    YGELYILQTLNQK    12804

HemolysinCabind: domain 24 of 36, from 12821 to 12838: score 5.8, E = 1.4
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + + G ++++Gg  +D++
  gi|1179254 12821    TSTLGENIITGGMFDDII    12838

Glyco_hydro_19: domain 1 of 1, from 12828 to 12839: score 1.3, E = 3.4
                CS    TS-HHHHHHHTT
                   *->ivteslFdqmlk<-*
                      i+t  +Fd+++k
  gi|1179254 12828    IITGGMFDDIIK    12839

TIP41: domain 1 of 1, from 12849 to 12855: score 2.4, E = 3.7
                   *->MvFGnNy<-*
                      M+FG+N+
  gi|1179254 12849    MIFGDNA    12855

TarH: domain 1 of 1, from 12856 to 12880: score 5.2, E = 0.81
                CS    HHHHHHHHHHHHHHHHHHHHHHHHH
                   *->etssyQqaalslsrvlllqArntLn<-*
                       ++++Q  a+s+++  +lqA++ +n
  gi|1179254 12856    YILRAQNEASSSDQNWMLQAKTLVN    12880

DUF30: domain 1 of 1, from 12857 to 12870: score 2.6, E = 3.6
                   *->lLRtpqdensknes<-*
                      +LR++++++s++ +
  gi|1179254 12857    ILRAQNEASSSDQN    12870

Gp5_C: domain 4 of 6, from 12884 to 12907: score 2.7, E = 11
                CS    S-EEEEESS-EEEEESSEEEEEES
                   *->GnesltVkGnrtvtVgGnqTtsVg<-*
                      G+++++ +  ++v+VgG  + s++
  gi|1179254 12884    GDDTIITGSGGKVLVGGFGADSIS    12907

HemolysinCabind: domain 25 of 36, from 12889 to 12906: score 3.6, E = 6.4
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G G  +L Gg G+D +
  gi|1179254 12889    ITGSGGKVLVGGFGADSI    12906

DUF1505: domain 1 of 1, from 12901 to 12910: score 0.7, E = 9.3
                   *->FGaeKLAnIe<-*
                      FGa+ +++I+
  gi|1179254 12901    FGADSISAIN    12910

HemolysinCabind: domain 26 of 36, from 12960 to 12967: score 0.9, E = 41
                CS    EESSCGEE
                   *->GgaGnDtl<-*
                      Gg G+D +
  gi|1179254 12960    GGYGDDEI    12967

HemolysinCabind: domain 27 of 36, from 13026 to 13038: score 0.3, E = 62
                CS    S-EEEEESSCGEE
                   *->nDtLyGgaGnDtl<-*
                      nD     +G+Dt+
  gi|1179254 13026    NDAVAAMGGDDTI    13038

Hep_Hag: domain 3 of 3, from 13034 to 13045: score 3.5, E = 8.5
                CS    STTEEEESTTTE
                   *->gensvAlGgnal<-*
                      g++++++G++a+
  gi|1179254 13034    GDDTISIGNRAT    13045

Fn_bind: domain 1 of 1, from 13052 to 13079: score 5.2, E = 1.9
                CS    ----------B..--------S...--EEE----
                   *->qpgmSGqsggtnqtevEDTkppepdviihfDGGq<-*
                      q  + G  ++t    vEDT +++ dvi+   G +
  gi|1179254 13052    QVLIGGMAADT--ITVEDTSTSQ-DVIF---GDN    13079

HemolysinCabind: domain 28 of 36, from 13053 to 13063: score 1.0, E = 39
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      +L Gg  +Dt+
  gi|1179254 13053    VLIGGMAADTI    13063

DUF2431: domain 1 of 1, from 13171 to 13177: score -0.3, E = 7.7
                   *->LLVGEGD<-*
                      L+VG+GD
  gi|1179254 13171    LVVGDGD    13177

HemolysinCabind: domain 29 of 36, from 13172 to 13189: score 6.9, E = 0.64
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                        G+G+ t  Gg+ nD l
  gi|1179254 13172    VVGDGDVTFIGGKDNDSL    13189

Prefoldin: domain 1 of 1, from 13217 to 13229: score 2.5, E = 5.4
                CS    ETTEEEEEEHHHH
                   *->GagyyvEksleeA<-*
                      G ++y+E+sl++A
  gi|1179254 13217    GDNVYLEYSLDDA    13229

HemolysinCabind: domain 30 of 36, from 13270 to 13279: score 2.6, E = 13
                CS    E--SSS-EEE
                   *->yGGaGnDtLy<-*
                       GG G Dt++
  gi|1179254 13270    VGGMGADTIN    13279

DUF844: domain 1 of 1, from 13281 to 13302: score 1.1, E = 4.1
                   *->cGnfvekvavgDsLniyLgsts<-*
                      +G+   +va+gD +ni +++ +
  gi|1179254 13281    SGLTADTVAAGDNINITRSTEG    13302

S-AdoMet_synt_C: domain 1 of 1, from 13330 to 13341: score 0.4, E = 6
                   *->iGGPqGDaGLtG<-*
                      iGG  GD+ LtG
  gi|1179254 13330    IGGMSGDTILTG    13341

DUF1547: domain 1 of 2, from 13340 to 13360: score 2.0, E = 6.6
                   *->tgsggivapkdqgeGvpsssa<-*
                      tgsg ++a +d+g+ v++s +
  gi|1179254 13340    TGSGNTIAMGDSGSLVFDSDT    13360

LTXXQ: domain 4 of 4, from 13376 to 13388: score 1.4, E = 23
                   *->LTpEQrqqlkrlk<-*
                      LT++Q q++kr
  gi|1179254 13376    LTEAQEQAVKRVN    13388

HemolysinCabind: domain 31 of 36, from 13419 to 13433: score 3.3, E = 7.8
                CS    SSS-EEEEESSCGEE
                   *->aGnDtLyGgaGnDtl<-*
                      +Gn +  Gg GnDt+
  gi|1179254 13419    DGNKVAVGGIGNDTI    13433

CbiD: domain 1 of 1, from 13437 to 13459: score 0.2, E = 9
                CS    T-EEEE-----------------
                   *->LaahavlaGaskelVteiqgadT<-*
                      +++  v+ +a   +V+ + g++T
  gi|1179254 13437    GTRSYVETDAAGNAVENVDGSNT    13459

Gp5_C: domain 5 of 6, from 13448 to 13463: score 0.4, E = 52
                CS    S-EEEEESSEEEEEES
                   *->GnrtvtVgGnqTtsVg<-*
                      Gn+  +V+G +T+ V
  gi|1179254 13448    GNAVENVDGSNTIVVT    13463

DUF1547: domain 2 of 2, from 13449 to 13475: score 4.9, E = 0.89
                   *->kdfengtgsggivapkdqgeGvpsssa<-*
                      +++en  gs +iv++  +++G++++ +
  gi|1179254 13449    NAVENVDGSNTIVVTERAVAGDNATMS    13475

Gp5_C: domain 6 of 6, from 13488 to 13511: score 1.4, E = 26
                CS    S-EEEEESS-EEEEESSEEEEEES
                   *->GnesltVkGnrtvtVgGnqTtsVg<-*
                      G+ ++   Gn t+ V+  +   ++
  gi|1179254 13488    GDSNIATAGNDTIKVDVSNDPVID    13511

HemolysinCabind: domain 32 of 36, from 13492 to 13500: score 2.7, E = 12
                CS    E--SSS-EE
                   *->yGGaGnDtL<-*
                      + +aGnDt+
  gi|1179254 13492    IATAGNDTI    13500

ClpB_D2-small: domain 1 of 1, from 13497 to 13510: score 1.5, E = 5.8
                CS    T-EEEEEE-.....SSSE
                   *->Gdtvrvdvddgeggelvf<-*
                      +dt++vdv  +   + v+
  gi|1179254 13497    NDTIKVDVS-N---DPVI    13510

Eapp_C: domain 1 of 1, from 13530 to 13535: score 0.9, E = 9.4
                   *->FNVLAS<-*
                      FNVLA+
  gi|1179254 13530    FNVLAG    13535

HemolysinCabind: domain 33 of 36, from 13531 to 13542: score 5.9, E = 1.2
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      ++L Gg GnD+l
  gi|1179254 13531    NVLAGGLGNDVL    13542

DUF2420: domain 1 of 1, from 13569 to 13582: score 2.6, E = 3.2
                   *->rYNeLvelvessas<-*
                      +YN L+ +v ss+s
  gi|1179254 13569    NYNHLYAEVKSSSS    13582

DUF1391: domain 2 of 2, from 13586 to 13599: score 0.4, E = 22
                   *->etldlGnnEslvlG<-*
                      +t+  Gn E+l++G
  gi|1179254 13586    DTIKTGNGEKLIFG    13599

HemolysinCabind: domain 34 of 36, from 13589 to 13606: score 6.8, E = 0.66
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                        G+G   ++Gg GnDtl
  gi|1179254 13589    KTGNGEKLIFGGVGNDTL    13606

Glucodextran_N: domain 1 of 1, from 13629 to 13648: score -1.3, E = 8.4
                CS    EE..ESEEEEEEE---SSSE
                   *->gdakGNValtGeIplgakgk<-*
                      ++a+G+V+l+++Ip+ + g+
  gi|1179254 13629    TNATGAVSLIASIPETDDGN    13648

Flagellin_IN: domain 4 of 6, from 13657 to 13681: score 3.4, E = 4.3
                   *->tltinggggkensvadgvdislsagdslaala<-*
                      +l + gggg+         +++sa+d++  ++
  gi|1179254 13657    DLYLFGGGGTDA-------LTVSANDTATRVV    13681

HemolysinCabind: domain 35 of 36, from 13660 to 13669: score 1.6, E = 26
                CS    EEEESSCGEE
                   *->LyGgaGnDtl<-*
                      L+Gg+G D l
  gi|1179254 13660    LFGGGGTDAL    13669

MspA: domain 2 of 2, from 13663 to 13681: score 1.9, E = 4.3
                   *->PDGwevGpglTVgakDEsavvv<-*
                      ++G+    +lTV+a D++ +vv
  gi|1179254 13663    GGGTD---ALTVSANDTATRVV    13681

Hum_adeno_E3A: domain 1 of 1, from 13682 to 13708: score 1.7, E = 3.1
                   *->mtdttnapttdyrnatAtGLtstlnlP<-*
                      m d+     t y ++ A G+t t  +P
  gi|1179254 13682    MGDSGQVNMTLYSYTDADGVTQTIGVP    13708

Chitin_bind_4: domain 2 of 2, from 13693 to 13705: score 4.2, E = 1.9
                   *->YSyvdPDGqtrtV<-*
                      YSy+d+DG t+t+
  gi|1179254 13693    YSYTDADGVTQTI    13705

CRC_subunit: domain 1 of 1, from 13724 to 13737: score 0.9, E = 8.4
                   *->rvrTFtlpCgRgdPErl<-*
                      r++TFtlp ++gd  +l
  gi|1179254 13724    RIDTFTLP-SKGD--NL    13737

HemolysinCabind: domain 36 of 36, from 13733 to 13747: score 5.5, E = 1.7
                CS    SSS-EEEEESSCGEE
                   *->aGnDtLyGgaGnDtl<-*
                      +G++ + Gg G D+l
  gi|1179254 13733    KGDNLIIGGLGTDLL    13747

DUF2026: domain 1 of 1, from 13765 to 13778: score 0.7, E = 2.7
                   *->kvtLkgekPviGAW<-*
                      +v L+++   +GAW
  gi|1179254 13765    QVSLANSADPTGAW    13778

NosD: domain 1 of 1, from 13794 to 13816: score 3.2, E = 5
                   *->GIgDtpYnippngniDylPLvaps<-*
                      GI D  Y + + +++D  P ++ +
  gi|1179254 13794    GITDGTYVL-SQDGVDTRPETTAT    13816

Fil_haemagg: domain 1 of 1, from 13814 to 13852: score 3.2, E = 3.5
                CS    EEESSEEEETT       TT--EE-SEEEEEE-STT-EE
                   *->vaaGaltlnaa.......alggldlnnggtlsagggltl<-*
                      +a+G+++++ +++++ +++lg  +ln+g ++ +++++tl
  gi|1179254 13814    TATGSGEVTEDgtqsvtgYLGLDALNGGKAIFTEATTTL    13852

PIN_2: domain 1 of 1, from 13838 to 13862: score 3.2, E = 3.7
                   *->vGeyiavwteavevlLyfEtteevra<-*
                      +++++a+ tea   lLy+ t+  ++
  gi|1179254 13838    LNGGKAIFTEATTTLLYG-TLTVKSD    13862

Como_SCP: domain 1 of 1, from 13852 to 13872: score 0.3, E = 7
                CS    TTTCCEEE-SSS.-SEEEE---
                   *->LlggtistDstgRnWntvlynS<-*
                      Ll gt+++ s+g +W  +l nS
  gi|1179254 13852    LLYGTLTVKSDG-GWTYTLNNS    13872

CBM_6: domain 1 of 1, from 13853 to 13866: score 1.6, E = 4.5
                CS    EEEEEEE---SSTT
                   *->lvGtvsVpsTGgWq<-*
                      l+Gt++V+s GgW+
  gi|1179254 13853    LYGTLTVKSDGGWT    13866

DUF1973: domain 1 of 1, from 13863 to 13879: score -0.4, E = 5.3
                   *->GtWtYsLnnahassQaL<-*
                      G WtY+Lnn   + QaL
  gi|1179254 13863    GGWTYTLNNSSSAVQAL    13879

PPC: domain 2 of 2, from 13885 to 13948: score 4.7, E = 1.2
                CS    -EEEEEEEESTTCEEEEEEECTSSS...S...CCEEEEEEECCCSES
                   *->dvdvysFtvpaggtlsisldggsslrslsgnGdadtlLywlldgdps
                      +  +++++ + g++ ++++   +           d      l+g++s
  gi|1179254 13885    RPETFQVNTTDGQQTTVTIRVKG---------ADD--VS-TLTGSSS 13919

                CS SSSTTCE-.....ECCTTEEEEEECC.-SEEEEEEEEE
                   lsaydaystTrdvdnggsdelisftapeaGtYyirVyg<-*
                   +s ++++          s  +++ t+++a +  ++V +
  gi|1179254 13920 ASLNEDDT---------SAVSGTLTVVDADVIDATVTA    13948

Flagellin_IN: domain 5 of 6, from 13888 to 13914: score 0.6, E = 26
                   *->tltinggggkensvadgvdislsagdslaal<-*
                      t++ n ++g  +    +v+i ++++d++++l
  gi|1179254 13888    TFQVNTTDGQQT----TVTIRVKGADDVSTL    13914

Haemagg_act: domain 1 of 1, from 13920 to 13965: score 5.7, E = 0.38
                CS    X---EE-TT-EEE-...-TTS--EEE-----TTSEEEEEEEE--B-T
                   *->aqslpdgglvtngtvtiqatgvpitggtipqtsgnlfisfssFnVgq
                      a  + d ++ + gt t+ +    ++++t  +t+ +++ ++ +F+Vg+
  gi|1179254 13920    ASLNEDDTSAVSGTLTVVDA--DVIDAT--VTAATSVGTYGTFSVGS 13962

                CS TEE
                   ggt<-*
                   +g+
  gi|1179254 13963 NGV    13965

gerPA: domain 1 of 1, from 13935 to 13950: score 1.5, E = 7.8
                   *->ntfDsDviDQpvigNa<-*
                      +++D+DviD +v++ +
  gi|1179254 13935    TVVDADVIDATVTAAT    13950

Peptidase_A4: domain 2 of 2, from 13975 to 13991: score 0.0, E = 5
                CS    EEEEECTTTEEEEEEE-
                   *->AtlENlTtGqkVThsFS<-*
                      A++  lT Gq V+ sF+
  gi|1179254 13975    AVVQGLTQGQQVSESFT    13991

OpcA: domain 1 of 1, from 13982 to 13994: score -0.8, E = 8.9
                CS    -------EEEEEE
                   *->qELqtAnEFtvHt<-*
                      q  q    FtvHt
  gi|1179254 13982    QGQQVSESFTVHT    13994

DUF1484: domain 1 of 1, from 14069 to 14081: score 1.7, E = 7.2
                   *->QLDgalndvqkmL<-*
                      QL  ++++vq+++
  gi|1179254 14069    QLNNSASQVQALI    14081

Flagellin_IN: domain 6 of 6, from 14089 to 14115: score 0.5, E = 27
                   *->tltinggggkensvadgvdislsagdslaal<-*
                      ++t   ++g+++    +v ++++++ ++a+l
  gi|1179254 14089    SFTVATVDGTAS----SVVVTVVGAQDAAQL    14115

TIR-like: domain 1 of 1, from 14160 to 14167: score 2.2, E = 4.6
                   *->kmDdsggW<-*
                      +mD+sg+W
  gi|1179254 14160    AMDSSGAW    14167

MIP-T3: domain 1 of 1, from 14170 to 14185: score 0.6, E = 3.1
                   *->ILkNe.akIqkllssi<-*
                      +L+Ne a+Iq++++++
  gi|1179254 14170    VLNNElAAIQQMIAGQ    14185

Attacin_N: domain 4 of 4, from 14188 to 14213: score 2.5, E = 7.2
                   *->qhGsvtvNsdGgsganaklpltGngkn<-*
                      ++  ++++sdG++ a + +++tG+ +n
  gi|1179254 14188    LESFTVSSSDGTQ-AQVSVTITGSQDN    14213

MyTH4: domain 1 of 1, from 14318 to 14328: score 2.5, E = 3.6
                   *->pPsrlEieAik<-*
                      pP ++EieA++
  gi|1179254 14318    PPTAEEIEAAR    14328

Radial_spoke: domain 1 of 1, from 14319 to 14335: score 0.7, E = 2.8
                   *->PtvEeEeAlkaaqeeae<-*
                      Pt+Ee eA ++a+e+ +
  gi|1179254 14319    PTAEEIEAARLAEEQRL    14335

MHC2-interact: domain 1 of 1, from 14330 to 14359: score 2.6, E = 2.7
                CS    XXXXX...X..XX.XXXXX..XXXXXXXXXXXXX
                   *->mdEQrQrddALLirsnseqtilpvLgarggsrrs<-*
                      ++EQr +++  L+ sn     ++++ga gg++++
  gi|1179254 14330    AEEQRLQQE--LQASNDLL--QGAIGAEGGNAGG    14359

Peptidase_C27: domain 1 of 1, from 14756 to 14767: score -0.6, E = 9.6
                   *->ARPEGGnPtGHF<-*
                      A PEGG P G
  gi|1179254 14756    AVPEGGDPAGAN    14767

DUF1388: domain 1 of 2, from 14788 to 14816: score 4.2, E = 2.4
                   *->PaenKsPgenKsPgenKsPgEnKsPaeak<-*
                      Pa+   P+e   P++   P+E   Pa+ +
  gi|1179254 14788    PADGEAPAEGQPPADGEAPAEGQVPADGE    14816

DUF1388: domain 2 of 2, from 14818 to 14846: score 8.0, E = 0.2
                   *->PaenKsPgenKsPgenKsPgEnKsPaeak<-*
                      Pae   P++   P+e  +P+    Pae +
  gi|1179254 14818    PAEGQAPADGEAPAEGQTPADGEAPAEGQ    14846

Phosducin: domain 1 of 1, from 14829 to 14846: score 0.7, E = 4.8
                   *->gekAkSssPAElEldfEGi<-*
                       ++A  ++PA+ E   EG+
  gi|1179254 14829    -APAEGQTPADGEAPAEGQ    14846

//