hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            119358104.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|119358104|ref|YP_912748.1|
Accession:      [none]
Description:    lipase, class 3 [Chlorobium phaeobacteroides DSM 266]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
HemolysinCabind Hemolysin-type calcium-binding repeat   396.4     5e-119  30
Lipase_3        Lipase (class 3)                         23.6    8.8e-07   1
Acetone_carb_G  Acetone carboxylase gamma subunit        16.2    0.00014   4
NAD4L           NADH dehydrogenase subunit 4L (NAD4L)     9.2      0.033   1
Peptidase_M10_C Peptidase M10 serralysin C terminal       6.2       0.16   1
Amidohydro_2    Amidohydrolase                            5.9       0.23   1
DRMBL           DNA repair metallo-beta-lactamase         6.0       0.37   1
CbbQ_C          CbbQ/NirQ/NorQ C-terminal                 6.3        0.4   4
DUF320          Small secreted domain (DUF320)            4.8        1.4   3
scADH           Short-chain alcohol dehydrogenase         2.1        1.5   1
Esterase        Putative esterase                         2.5        1.7   1
PaaX_C          PaaX-like protein C-terminal domain       2.8        2.1   1
DUF1696         Protein of unknown function (DUF1696)     3.1        2.4   4
DUF2190         Uncharacterized conserved protein (DU     2.8          3   2
TFR_dimer       Transferrin receptor-like dimerisatio     3.2        3.1   1
ATP-synt        ATP synthase                              0.4        3.2   1
TraH_2          TraH_2                                    0.2        3.9   1
Aminotran_1_2   Aminotransferase class I and II           1.1        4.3   1
Lactamase_B     Metallo-beta-lactamase superfamily        1.8        4.4   1
GDI             GDP dissociation inhibitor                0.2        4.9   1
G-patch         G-patch domain                            3.4        5.1   2
ASD2            Apx/Shroom domain ASD2                    0.3        5.3   1
GSPII_G         Bacterial type II secretion system pr     1.7        5.7   1
Orthopox_A49R   Orthopoxvirus A49R protein                1.2        5.7   1
DUF2325         Uncharacterized protein conserved in      1.2          7   1
NBP1            Fungal Nap binding protein NBP1          -0.6        7.2   1
Toxin_R_bind_N  Clostridium neurotoxin, N-terminal re    -0.1        8.3   1
CBM_17_28       Carbohydrate binding domain (family 1     0.3        8.3   1
NosD            Periplasmic copper-binding protein (N     2.3        8.9   2
VacA2           Putative vacuolating cytotoxin            1.7        9.3   1
Fib_alpha       Fibrinogen alpha chain                   -1.1        9.4   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
ASD2              1/1      82    91 ..   294   303 .]     0.3      5.3
ATP-synt          1/1     126   154 ..   210   236 ..     0.4      3.2
TFR_dimer         1/1     195   218 ..   124   147 .]     3.2      3.1
Lactamase_B       1/1     257   294 ..   124   161 .]     1.8      4.4
PaaX_C            1/1     266   281 ..   166   181 .]     2.8      2.1
Esterase          1/1     267   301 ..   115   151 ..     2.5      1.7
Lipase_3          1/1     267   304 ..    54   104 ..    23.6  8.8e-07
Aminotran_1_2     1/1     329   347 ..   394   413 .]     1.1      4.3
CBM_17_28         1/1     336   365 ..     1    41 [.     0.3      8.3
NBP1              1/1     357   366 ..   362   371 .]    -0.6      7.2
Amidohydro_2      1/1     401   436 ..   287   329 .]     5.9     0.23
Orthopox_A49R     1/1     415   426 ..   151   162 .]     1.2      5.7
VacA2             1/1     474   489 ..    41    56 ..     1.7      9.3
HemolysinCabind   1/30    492   504 ..     6    18 .]     8.1     0.28
DUF2325           1/1     513   520 ..     1     9 [.     1.2        7
HemolysinCabind   2/30    516   525 ..     9    18 .]     4.0        5
NAD4L             1/1     564   582 ..    68    86 .]     9.2    0.033
DRMBL             1/1     567   591 ..     1    25 [.     6.0     0.37
scADH             1/1     621   630 ..   384   393 .]     2.1      1.5
HemolysinCabind   3/30    642   659 ..     1    18 []    13.9    0.005
HemolysinCabind   4/30    660   677 ..     1    18 []    13.1   0.0082
HemolysinCabind   5/30    689   700 ..     7    18 .]     9.2     0.12
DUF1696           1/4     735   753 ..   107   125 .]     0.8       12
CbbQ_C            1/4     743   756 ..    73    86 .]     1.6      9.3
Acetone_carb_G    1/4     797   805 ..   112   120 .]     4.0     0.87
HemolysinCabind   6/30    851   863 ..     6    18 .]     4.7      2.9
HemolysinCabind   7/30    864   881 ..     1    18 []    17.8  0.00031
DUF320            1/3     880   892 ..    48    60 .]     1.6       11
HemolysinCabind   8/30    882   899 ..     1    18 []    13.1   0.0082
HemolysinCabind   9/30    911   922 ..     7    18 .]     9.2     0.12
DUF1696           2/4     957   975 ..   107   125 .]     0.8       12
CbbQ_C            2/4     965   978 ..    73    86 .]     1.6      9.3
Acetone_carb_G    2/4    1019  1027 ..   112   120 .]     4.0     0.87
HemolysinCabind  10/30   1073  1085 ..     6    18 .]     4.7      2.9
HemolysinCabind  11/30   1086  1103 ..     1    18 []    17.8  0.00031
DUF320            2/3    1102  1114 ..    48    60 .]     1.6       11
HemolysinCabind  12/30   1104  1121 ..     1    18 []    13.1   0.0082
HemolysinCabind  13/30   1133  1144 ..     7    18 .]     9.2     0.12
DUF1696           3/4    1179  1197 ..   107   125 .]     0.8       12
CbbQ_C            3/4    1187  1200 ..    73    86 .]     1.6      9.3
Acetone_carb_G    3/4    1241  1249 ..   112   120 .]     4.0     0.87
HemolysinCabind  14/30   1295  1307 ..     6    18 .]     4.7      2.9
HemolysinCabind  15/30   1308  1325 ..     1    18 []    17.8  0.00031
DUF320            3/3    1324  1336 ..    48    60 .]     1.6       11
HemolysinCabind  16/30   1326  1343 ..     1    18 []    13.1   0.0082
HemolysinCabind  17/30   1355  1366 ..     7    18 .]     9.2     0.12
DUF1696           4/4    1401  1419 ..   107   125 .]     0.8       12
CbbQ_C            4/4    1409  1422 ..    73    86 .]     1.6      9.3
Acetone_carb_G    4/4    1463  1471 ..   112   120 .]     4.0     0.87
Peptidase_M10_C   1/1    1481  2133 .]    70   166 .]     6.2     0.16
HemolysinCabind  18/30   1521  1538 ..     1    18 []    19.2  0.00012
HemolysinCabind  19/30   1539  1556 ..     1    18 []    13.1   0.0083
G-patch           1/2    1611  1620 ..     1    10 [.     1.7       16
HemolysinCabind  20/30   1620  1637 ..     1    18 []    22.3  1.4e-05
HemolysinCabind  21/30   1638  1655 ..     1    18 []    11.6    0.024
GDI               1/1    1657  1681 ..   452   476 .]     0.2      4.9
G-patch           2/2    1710  1719 ..     1    10 [.     1.7       16
HemolysinCabind  22/30   1719  1736 ..     1    18 []    18.5  0.00019
HemolysinCabind  23/30   1737  1754 ..     1    18 []    14.9   0.0024
NosD              1/2    1739  1762 ..    35    65 ..     1.1       18
DUF2190           1/2    1805  1819 ..    78    92 ..     0.8       12
Toxin_R_bind_N    1/1    1805  1818 ..     1    14 [.    -0.1      8.3
HemolysinCabind  24/30   1809  1826 ..     1    18 []    21.1  3.1e-05
HemolysinCabind  25/30   1827  1844 ..     1    18 []    17.4  0.00043
GSPII_G           1/1    1831  1848 ..    96   114 .]     1.7      5.7
Fib_alpha         1/1    1882  1913 ..   463   497 .]    -1.1      9.4
DUF2190           2/2    1895  1909 ..    78    92 ..     2.0      5.4
HemolysinCabind  26/30   1899  1916 ..     1    18 []    20.2    6e-05
HemolysinCabind  27/30   1917  1934 ..     1    18 []    14.9   0.0024
NosD              2/2    1919  1942 ..    35    65 ..     1.1       18
HemolysinCabind  28/30   1980  1997 ..     1    18 []     4.5      3.5
HemolysinCabind  29/30   1998  2015 ..     1    18 []    18.2  0.00024
HemolysinCabind  30/30   2016  2033 ..     1    18 []    17.6  0.00037
TraH_2            1/1    2060  2068 ..   201   209 .]     0.2      3.9

Alignments of top-scoring domains:
ASD2: domain 1 of 1, from 82 to 91: score 0.3, E = 5.3
                   *->EQLkcLrdsL<-*
                      EQL ++ +sL
  gi|1193581    82    EQLNAIGNSL    91

ATP-synt: domain 1 of 1, from 126 to 154: score 0.4, E = 3.2
                CS    ..-SGGGG................ . ..
                   *->AaedesfrlttkgGdFeVERetet.t.ed<-*
                      Aa+d++ + +++gGd + ER+t + ++++
  gi|1193581   126    AASDDVTGSASSGGDWKLERQTGViEtAP    154

TFR_dimer: domain 1 of 1, from 195 to 218: score 3.2, E = 3.1
                CS    HHHHHHHHHHHHHHHHHHHHHS--
                   *->aevqrQlsiaataLqgaAntLrev<-*
                      +e+ +Ql  ++++L+g A++ +++
  gi|1193581   195    GELNNQLQWIGWSLHGEARYHAFD    218

Lactamase_B: domain 1 of 1, from 257 to 294: score 1.8, E = 4.4
                CS    HHHHHCTTHSEETEHHHHHHHHHHHHTS..SEEEE.SS
                   *->klpggdaktlypslaelllesleklaalppdtivpPgH<-*
                      +++g ++  +y s +++  ++l++++a ++d i+  gH
  gi|1193581   257    DIVGYGFSLYYRSVRAEVVAWLKEAVAEKYDAIYITGH    294

PaaX_C: domain 1 of 1, from 266 to 281: score 2.8, E = 2.1
                   *->lyreLaaaaeqflaev<-*
                      +yr+++a++ ++l+e+
  gi|1193581   266    YYRSVRAEVVAWLKEA    281

Esterase: domain 1 of 1, from 267 to 301: score 2.5, E = 1.7
                CS    HHHHHTHHHHHHHHHH-B-SSS-BEEEEEETHHHHHH
                   *->YtfltqELlPlldanfptapdgdrravaGqSmGGlgA<-*
                      Y+ ++ E++ +l++    + d+    ++G+S+GG +A
  gi|1193581   267    YRSVRAEVVAWLKEAVAEKYDA--IYITGHSLGGAAA    301

Lipase_3: domain 1 of 1, from 267 to 304: score 23.6, E = 8.8e-07
                CS    HH.........HHHHHHHHHHHH.HHHHST..TSEEEEEEETHHHHH
                   *->ytskdqskfktsvrdqileelkrhLlekypdEdykivvTGHSLGGAl
                      y+         svr ++ + lk+++ eky      i++TGHSLGGA
  gi|1193581   267    YR---------SVRAEVVAWLKEAVAEKYD----AIYITGHSLGGAA 300

                CS HHHH
                   AsLa<-*
                   A +a
  gi|1193581   301 AQIA    304

Aminotran_1_2: domain 1 of 1, from 329 to 347: score 1.1, E = 4.3
                CS    EEEC-TSS-HHHHHHHHHHH
                   *->RitvtAggteeeleelleai<-*
                      Rit  Ag+t+eel ++ ++i
  gi|1193581   329    RITD-AGLTSEELSYVRSHI    347

CBM_17_28: domain 1 of 1, from 336 to 365: score 0.3, E = 8.3
                CS    ---GGGB-HHHHHHHHHHHT-----......--S-..S--T
                   *->VWapeELSvSGEYVRARIKGieYePikrdnkIdrtekeeft<-*
                          eELS    YVR+ I G+ +     d++Id++   +++
  gi|1193581   336    --TSEELS----YVRSHISGATFGA--PDVRIDPS---KYS    365

NBP1: domain 1 of 1, from 357 to 366: score -0.6, E = 7.2
                   *->vrvDYSkYsS<-*
                      vr+D SkYs
  gi|1193581   357    VRIDPSKYSA    366

Amidohydro_2: domain 1 of 1, from 401 to 436: score 5.9, E = 0.23
                CS    T-TT- TT--HHHHHHHHHHH--..-HHHHHHHHTHHHHHHTT-
                   *->Phppl.rslaalllldlllllllelseeerekilggNAarlygl<-*
                      P+  l+++++ +++ dl        se+++++  g N+ +++
  gi|1193581   401    PVAALgGEIGQFVAIDL--------SEDIKDRYWGLNPIAFLHS    436

Orthopox_A49R: domain 1 of 1, from 415 to 426: score 1.2, E = 5.7
                   *->LqLsdDiRERYL<-*
                      + Ls+Di++RY
  gi|1193581   415    IDLSEDIKDRYW    426

VacA2: domain 1 of 1, from 474 to 489: score 1.7, E = 9.3
                   *->naannininnAtinns<-*
                      ++ ++i++++A++n++
  gi|1193581   474    EGNDRIVLTQAKFNAQ    489

HemolysinCabind: domain 1 of 30, from 492 to 504: score 8.1, E = 0.28
                CS    S-EEEEESSCGEE
                   *->nDtLyGgaGnDtl<-*
                      nD+L+  aGnD+l
  gi|1193581   492    NDRLNAFAGNDIL    504

DUF2325: domain 1 of 1, from 513 to 520: score 1.2, E = 7
                   *->MSvLiVGAD<-*
                       S+Li+G+D
  gi|1193581   513    -SALIIGGD    520

HemolysinCabind: domain 2 of 30, from 516 to 525: score 4.0, E = 5
                CS    EEEESSCGEE
                   *->LyGgaGnDtl<-*
                      + Gg+G Dt+
  gi|1193581   516    IIGGDGHDTY    525

NAD4L: domain 1 of 1, from 564 to 582: score 9.2, E = 0.033
                   *->LvVLTRvwecsSlielVgf<-*
                      LvVL ++++ sS +e Vg+
  gi|1193581   564    LVVLITNYDESSRVEIVGW    582

DRMBL: domain 1 of 1, from 567 to 591: score 6.0, E = 0.37
                   *->vlTtdesesriHavpmnsieesfki<-*
                      ++T ++++sr+ +v ++s ee++ i
  gi|1193581   567    LITNYDESSRVEIVGWYSSEETYRI    591

scADH: domain 1 of 1, from 621 to 630: score 2.1, E = 1.5
                   *->ldgVDYsqDV<-*
                      ++g DYs DV
  gi|1193581   621    REGLDYSDDV    630

HemolysinCabind: domain 3 of 30, from 642 to 659: score 13.9, E = 0.005
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G +GnDt+ G +G+D +
  gi|1193581   642    NGYGGNDTMEGRGGDDEI    659

HemolysinCabind: domain 4 of 30, from 660 to 677: score 13.1, E = 0.0082
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G+GnDt + g+G+Dt
  gi|1193581   660    NPGGGNDTVDAGSGDDTV    677

HemolysinCabind: domain 5 of 30, from 689 to 700: score 9.2, E = 0.12
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D+L+Gg+G Dtl
  gi|1193581   689    DVLDGGSGTDTL    700

DUF1696: domain 1 of 4, from 735 to 753: score 0.8, E = 12
                   *->FkkdtniyeiqkvLAkyvL<-*
                      + +++++++iq++L+++v
  gi|1193581   735    LASGSSLNDIQTALSTAVK    753

CbbQ_C: domain 1 of 4, from 743 to 756: score 1.6, E = 9.3
                   *->dvreaLmeviaayF<-*
                      d++ aL  +++++F
  gi|1193581   743    DIQTALSTAVKTVF    756

Acetone_carb_G: domain 1 of 4, from 797 to 805: score 4.0, E = 0.87
                   *->dglyrdWlg<-*
                      d++y+dW g
  gi|1193581   797    DTFYADWSG    805

HemolysinCabind: domain 6 of 30, from 851 to 863: score 4.7, E = 2.9
                CS    S-EEEEESSCGEE
                   *->nDtLyGgaGnDtl<-*
                      nD  + gaGnDt+
  gi|1193581   851    NDDVRTGAGNDTI    863

HemolysinCabind: domain 7 of 30, from 864 to 881: score 17.8, E = 0.00031
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G GnD ++GgaGnD+l
  gi|1193581   864    SVGWGNDYIDGGAGNDVL    881

DUF320: domain 1 of 3, from 880 to 892: score 1.6, E = 11
                   *->llNPAfGNeCand<-*
                      +lNP  GN+ +++
  gi|1193581   880    VLNPGGGNDTVDA    892

HemolysinCabind: domain 8 of 30, from 882 to 899: score 13.1, E = 0.0082
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G+GnDt + g+G+Dt
  gi|1193581   882    NPGGGNDTVDAGSGDDTV    899

HemolysinCabind: domain 9 of 30, from 911 to 922: score 9.2, E = 0.12
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D+L+Gg+G Dtl
  gi|1193581   911    DVLDGGSGTDTL    922

DUF1696: domain 2 of 4, from 957 to 975: score 0.8, E = 12
                   *->FkkdtniyeiqkvLAkyvL<-*
                      + +++++++iq++L+++v
  gi|1193581   957    LASGSSLNDIQTALSTAVK    975

CbbQ_C: domain 2 of 4, from 965 to 978: score 1.6, E = 9.3
                   *->dvreaLmeviaayF<-*
                      d++ aL  +++++F
  gi|1193581   965    DIQTALSTAVKTVF    978

Acetone_carb_G: domain 2 of 4, from 1019 to 1027: score 4.0, E = 0.87
                   *->dglyrdWlg<-*
                      d++y+dW g
  gi|1193581  1019    DTFYADWSG    1027

HemolysinCabind: domain 10 of 30, from 1073 to 1085: score 4.7, E = 2.9
                CS    S-EEEEESSCGEE
                   *->nDtLyGgaGnDtl<-*
                      nD  + gaGnDt+
  gi|1193581  1073    NDDVRTGAGNDTI    1085

HemolysinCabind: domain 11 of 30, from 1086 to 1103: score 17.8, E = 0.00031
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G GnD ++GgaGnD+l
  gi|1193581  1086    SVGWGNDYIDGGAGNDVL    1103

DUF320: domain 2 of 3, from 1102 to 1114: score 1.6, E = 11
                   *->llNPAfGNeCand<-*
                      +lNP  GN+ +++
  gi|1193581  1102    VLNPGGGNDTVDA    1114

HemolysinCabind: domain 12 of 30, from 1104 to 1121: score 13.1, E = 0.0082
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G+GnDt + g+G+Dt
  gi|1193581  1104    NPGGGNDTVDAGSGDDTV    1121

HemolysinCabind: domain 13 of 30, from 1133 to 1144: score 9.2, E = 0.12
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D+L+Gg+G Dtl
  gi|1193581  1133    DVLDGGSGTDTL    1144

DUF1696: domain 3 of 4, from 1179 to 1197: score 0.8, E = 12
                   *->FkkdtniyeiqkvLAkyvL<-*
                      + +++++++iq++L+++v
  gi|1193581  1179    LASGSSLNDIQTALSTAVK    1197

CbbQ_C: domain 3 of 4, from 1187 to 1200: score 1.6, E = 9.3
                   *->dvreaLmeviaayF<-*
                      d++ aL  +++++F
  gi|1193581  1187    DIQTALSTAVKTVF    1200

Acetone_carb_G: domain 3 of 4, from 1241 to 1249: score 4.0, E = 0.87
                   *->dglyrdWlg<-*
                      d++y+dW g
  gi|1193581  1241    DTFYADWSG    1249

HemolysinCabind: domain 14 of 30, from 1295 to 1307: score 4.7, E = 2.9
                CS    S-EEEEESSCGEE
                   *->nDtLyGgaGnDtl<-*
                      nD  + gaGnDt+
  gi|1193581  1295    NDDVRTGAGNDTI    1307

HemolysinCabind: domain 15 of 30, from 1308 to 1325: score 17.8, E = 0.00031
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G GnD ++GgaGnD+l
  gi|1193581  1308    SVGWGNDYIDGGAGNDVL    1325

DUF320: domain 3 of 3, from 1324 to 1336: score 1.6, E = 11
                   *->llNPAfGNeCand<-*
                      +lNP  GN+ +++
  gi|1193581  1324    VLNPGGGNDTVDA    1336

HemolysinCabind: domain 16 of 30, from 1326 to 1343: score 13.1, E = 0.0082
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G+GnDt + g+G+Dt
  gi|1193581  1326    NPGGGNDTVDAGSGDDTV    1343

HemolysinCabind: domain 17 of 30, from 1355 to 1366: score 9.2, E = 0.12
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D+L+Gg+G Dtl
  gi|1193581  1355    DVLDGGSGTDTL    1366

DUF1696: domain 4 of 4, from 1401 to 1419: score 0.8, E = 12
                   *->FkkdtniyeiqkvLAkyvL<-*
                      + +++++++iq++L+++v
  gi|1193581  1401    LASGSSLNDIQTALSTAVK    1419

CbbQ_C: domain 4 of 4, from 1409 to 1422: score 1.6, E = 9.3
                   *->dvreaLmeviaayF<-*
                      d++ aL  +++++F
  gi|1193581  1409    DIQTALSTAVKTVF    1422

Acetone_carb_G: domain 4 of 4, from 1463 to 1471: score 4.0, E = 0.87
                   *->dglyrdWlg<-*
                      d++y+dW g
  gi|1193581  1463    DTFYADWSG    1471

Peptidase_M10_C: domain 1 of 1, from 1481 to 2133: score 6.2, E = 0.16
                CS    BS-EEE-TT----EE
                RF    xxxxxxxxxxxxxxx
                   *->kgnvsiAkGvtiEnA................................
                      +g+  i +Gvt+ n ++   +++++ +  +++  +++++ +++ +++
  gi|1193581  1481    TGEAYIYEGVTVSNVerlllqtgsgadvidntafstnddvrtgagdd 1527

                CS
                RF
                   ..................................................
                      ++ +++  +++++ ++  ++ ++++   + + +  +++ +++++  +
  gi|1193581  1528 allggagndildggsgadsmaggigddtyvvnysldvvtenadegtdlvk 1577

                CS
                RF
                   ..................................................
                   ++++ + +++ ++ + +++ ++++++++ +++ +++ +++   ++ ++++
  gi|1193581  1578 sstswtlgdhvehleltgtantrgtgneldnritgnigsnmlagdagkdt 1627

                CS
                RF
                   ..................................................
                     ++ ++++ +++++ ++  ++ ++++   ++  +  ++  +++++  ++
  gi|1193581  1628 llggagndtldggtgadsmaggigddtyvvddildvvteyagegtdlvks 1677

                CS
                RF
                   ..................................................
                   +++ + +++ ++ + +++ ++++++++ +++ +++ +++   ++ ++++
  gi|1193581  1678 stswtlgdhvehlelsgtantrgtgneldnritgnigsnmlagdagkdtl 1727

                CS
                RF
                   ..................................................
                    ++ +++  +++++ ++  ++ ++++   + + +  +++ +++ +  +++
  gi|1193581  1728 lggagndaldggsgadsmvggigddtyvvnysldvvtenadegidlvqss 1777

                CS
                RF
                   ..................................................
                   ++ + + + ++ + +++ ++++++++ +++ ++++++++  ++ ++++ +
  gi|1193581  1778 tgwtlganvehleltgtantrgtgneldnritgnsgkntlvggagndtld 1827

                CS
                RF
                   ..................................................
                   ++++ ++  ++++++    + + +  +++ +++ +  +++++ + + + +
  gi|1193581  1828 ggsgadsmaggegddvyvvnysldvvtenadegidlvqsstgwtlganve 1877

                CS
                RF
                   ..................................................
                   + + +++ ++++++++ +++ ++++++++  ++ ++++ +++++ ++  +
  gi|1193581  1878 nleltgtantrgtgndldnritgnsgkntliggagndtldggsgadsmvg 1927

                CS
                RF
                   ..................................................
                   + ++++   + + +  +++ +++ +  +++++ + + + ++ + +++ ++
  gi|1193581  1928 gigddtyvvnysldvvtenadegidlvqsstgwtlganvehleltgtant 1977

                CS
                RF
                   ..................................................
                   ++++++ ++  +++++++   ++++++   ++ + ++  ++ + ++ +++
  gi|1193581  1978 rgtgndldnvitgnsgknylageegedillggagadtlyggmgadeltgg 2027

                CS                  TTB-EEETT--TTTSEEE-HHHHHHHT    SE
                RF                  xxxxxxxxxxxxxxxxxxxxxxxxxxx    xx
                   .................saapdtirDFqsGeDkiDlsalnkgak....lk
                   ++++    +++++++ ++ a d i+DF+ G D++Dls ++++    ++ +
  gi|1193581  2028 tgrdvflynnssesgitEGAWDVITDFTAGFDRLDLSGIDANTGiagnQS 2077

                CS E-SSB-SSTTEE    EEEEETTTTEEEEEEESSSSSS-SEEEEE  ES-
                RF xxxxxxxxxxxx    xxxxxxxxxxxxxxxxxxxxxxxxxxxxx  xxx
                   fvdaftGkagea....llsydaesnvtdlaldlsgkeaadFlvki..vGq
                   f +++ G+++  ++ + l++d+ s v  l+ + +g++ a+F++k +++G
  gi|1193581  2078 FSSDILGSGDAFseagQLRFDSGSGV--LYGNTDGDADAEFAIKFtgIGS 2125

                CS --GTGGEE-
                RF xxxxxxxxx
                   aavasDiiv<-*
                    +  sDi++
  gi|1193581  2126 MSS-SDIVL    2133

HemolysinCabind: domain 18 of 30, from 1521 to 1538: score 19.2, E = 0.00012
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + GaG+D L GgaGnD+l
  gi|1193581  1521    RTGAGDDALLGGAGNDIL    1538

HemolysinCabind: domain 19 of 30, from 1539 to 1556: score 13.1, E = 0.0083
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG G D++ Gg G+Dt+
  gi|1193581  1539    DGGSGADSMAGGIGDDTY    1556

G-patch: domain 1 of 2, from 1611 to 1620: score 1.7, E = 16
                   *->tsniGfklLq<-*
                      t+niG+ +L+
  gi|1193581  1611    TGNIGSNMLA    1620

HemolysinCabind: domain 20 of 30, from 1620 to 1637: score 22.3, E = 1.4e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G+aG DtL GgaGnDtl
  gi|1193581  1620    AGDAGKDTLLGGAGNDTL    1637

HemolysinCabind: domain 21 of 30, from 1638 to 1655: score 11.6, E = 0.024
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG G D++ Gg G+Dt+
  gi|1193581  1638    DGGTGADSMAGGIGDDTY    1655

GDI: domain 1 of 1, from 1657 to 1681: score 0.2, E = 4.9
                CS    HHHHHHHHHHHHSS-----------
                   *->cnDVldIykrltGkaldlskspake<-*
                      ++D+ld+ ++++G+  dl ks +++
  gi|1193581  1657    VDDILDVVTEYAGEGTDLVKSSTSW    1681

G-patch: domain 2 of 2, from 1710 to 1719: score 1.7, E = 16
                   *->tsniGfklLq<-*
                      t+niG+ +L+
  gi|1193581  1710    TGNIGSNMLA    1719

HemolysinCabind: domain 22 of 30, from 1719 to 1736: score 18.5, E = 0.00019
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G+aG DtL GgaGnD l
  gi|1193581  1719    AGDAGKDTLLGGAGNDAL    1736

HemolysinCabind: domain 23 of 30, from 1737 to 1754: score 14.9, E = 0.0024
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG G D++ Gg G+Dt+
  gi|1193581  1737    DGGSGADSMVGGIGDDTY    1754

NosD: domain 1 of 2, from 1739 to 1762: score 1.1, E = 18
                   *->gtGFSqtcvntDlDgDGIgDtpYnippngni<-*
                      g+G        D++  GIgD  Y ++ +  +
  gi|1193581  1739    GSG-------ADSMVGGIGDDTYVVNYSLDV    1762

DUF2190: domain 1 of 2, from 1805 to 1819: score 0.8, E = 12
                   *->ekvvtttAtgNtliG<-*
                      ++++t+++++Ntl+G
  gi|1193581  1805    DNRITGNSGKNTLVG    1819

Toxin_R_bind_N: domain 1 of 1, from 1805 to 1818: score -0.1, E = 8.3
                CS    TEEEETSSSEEEEE
                   *->nNvliDiSGYnalV<-*
                      +N++   SG+n+lV
  gi|1193581  1805    DNRITGNSGKNTLV    1818

HemolysinCabind: domain 24 of 30, from 1809 to 1826: score 21.1, E = 3.1e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+ G +tL GgaGnDtl
  gi|1193581  1809    TGNSGKNTLVGGAGNDTL    1826

HemolysinCabind: domain 25 of 30, from 1827 to 1844: score 17.4, E = 0.00043
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG G D++ Gg+G+D++
  gi|1193581  1827    DGGSGADSMAGGEGDDVY    1844

GSPII_G: domain 1 of 1, from 1831 to 1848: score 1.7, E = 5.7
                CS    TTTS--...EEE--.TT-E
                   *->GaDGqpGGeGtdaDpIgnW<-*
                      GaD  +GGeG+d   ++n
  gi|1193581  1831    GADSMAGGEGDDVY-VVNY    1848

Fib_alpha: domain 1 of 1, from 1882 to 1913: score -1.1, E = 9.4
                CS    X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                   *->tvggltstntfneqdlGkfvtgkaeeDlpdfqaRs<-*
                      t g+  +++t+n  dl    tg++ ++++++ a+
  gi|1193581  1882    T-GTANTRGTGN--DLDNRITGNSGKNTLIGGAGN    1913

DUF2190: domain 2 of 2, from 1895 to 1909: score 2.0, E = 5.4
                   *->ekvvtttAtgNtliG<-*
                      ++++t+++++NtliG
  gi|1193581  1895    DNRITGNSGKNTLIG    1909

HemolysinCabind: domain 26 of 30, from 1899 to 1916: score 20.2, E = 6e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+ G +tL GgaGnDtl
  gi|1193581  1899    TGNSGKNTLIGGAGNDTL    1916

HemolysinCabind: domain 27 of 30, from 1917 to 1934: score 14.9, E = 0.0024
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG G D++ Gg G+Dt+
  gi|1193581  1917    DGGSGADSMVGGIGDDTY    1934

NosD: domain 2 of 2, from 1919 to 1942: score 1.1, E = 18
                   *->gtGFSqtcvntDlDgDGIgDtpYnippngni<-*
                      g+G        D++  GIgD  Y ++ +  +
  gi|1193581  1919    GSG-------ADSMVGGIGDDTYVVNYSLDV    1942

HemolysinCabind: domain 28 of 30, from 1980 to 1997: score 4.5, E = 3.5
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G++ +++++G++G + l
  gi|1193581  1980    TGNDLDNVITGNSGKNYL    1997

HemolysinCabind: domain 29 of 30, from 1998 to 2015: score 18.2, E = 0.00024
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G +G D+L GgaG+Dtl
  gi|1193581  1998    AGEEGEDILLGGAGADTL    2015

HemolysinCabind: domain 30 of 30, from 2016 to 2033: score 17.6, E = 0.00037
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      yGG G D L+Gg G D++
  gi|1193581  2016    YGGMGADELTGGTGRDVF    2033

TraH_2: domain 1 of 1, from 2060 to 2068: score 0.2, E = 3.9
                   *->RIDLSgIGa<-*
                      R DLSgI a
  gi|1193581  2060    RLDLSGIDA    2068

//