hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 12055376.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|12055376|emb|CAC20867.1|
Accession: [none]
Description: Jacob protein, alternatively spliced isoform delta1 [Rattus norvegicus]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
UPF0547 Uncharacterised protein family UPF054 8.5 0.28 1
PRD PRD domain 3.7 2.6 1
Agro_virD5 Agrobacterium VirD5 protein -0.8 3.6 1
AMP_N Aminopeptidase P, N-terminal domain 1.9 4.4 1
TIR TIR domain 0.9 5.4 1
IMPDH IMP dehydrogenase / GMP reductase dom 0.6 6 1
c-SKI_SMAD_bind c-SKI Smad4 binding domain 1.6 6.1 1
NUP Purine nucleoside permease (NUP) -0.2 6.3 1
Orthopox_N1 Orthopoxvirus N1 protein 0.7 6.4 1
IFRD Interferon-related developmental regu -0.2 6.5 1
PSI Plexin repeat 1.7 7.6 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
Agro_virD5 1/1 102 131 .. 740 769 .. -0.8 3.6
PSI 1/1 157 170 .. 50 63 .] 1.7 7.6
UPF0547 1/1 167 177 .. 1 11 [. 8.5 0.28
AMP_N 1/1 253 264 .. 1 12 [. 1.9 4.4
NUP 1/1 323 331 .. 1 9 [. -0.2 6.3
c-SKI_SMAD_bind 1/1 359 375 .. 82 98 .] 1.6 6.1
IFRD 1/1 360 371 .. 354 365 .] -0.2 6.5
PRD 1/1 364 376 .. 1 13 [. 3.7 2.6
TIR 1/1 411 426 .. 131 150 .] 0.9 5.4
Orthopox_N1 1/1 480 493 .. 100 113 .] 0.7 6.4
IMPDH 1/1 501 509 .] 1 9 [. 0.6 6
Alignments of top-scoring domains:
Agro_virD5: domain 1 of 1, from 102 to 131: score -0.8, E = 3.6
*->YtvsRDPvLsPPsKeqapqLLHLGpRGqtE<-*
Yt+sR+P L+P s +a +L + R q E
gi|1205537 102 YTISREPALLPGSEAEAIELAVVKGRRQRE 131
PSI: domain 1 of 1, from 157 to 170: score 1.7, E = 7.6
CS ..B..TT-BCCCSS
*->dqwldwswsssqCp<-*
++w ++ + s+ Cp
gi|1205537 157 QSWAGSRQGSKECP 170
UPF0547: domain 1 of 1, from 167 to 177: score 8.5, E = 0.28
*->KtCPeCdaivp<-*
K+CP+C +vp
gi|1205537 167 KECPGCAKLVP 177
AMP_N: domain 1 of 1, from 253 to 264: score 1.9, E = 4.4
*->ipadefaaRRkr<-*
++a+ fa+RR+r
gi|1205537 253 VKAQTFAERRER 264
NUP: domain 1 of 1, from 323 to 331: score -0.2, E = 6.3
*->iqpKVmvIt<-*
+pKVm+I+
gi|1205537 323 LPPKVMLIS 331
c-SKI_SMAD_bind: domain 1 of 1, from 359 to 375: score 1.6, E = 6.1
CS CHHHHHHHHHHHHCC--
*->eeakLeqvLeevkekFd<-*
e+a+ e +Lee++ k +
gi|1205537 359 EHATFEDILEEIEKKLN 375
IFRD: domain 1 of 1, from 360 to 371: score -0.2, E = 6.5
*->RstFRDVlrfvE<-*
++tF D+l+ +E
gi|1205537 360 HATFEDILEEIE 371
PRD: domain 1 of 1, from 364 to 376: score 3.7, E = 2.6
CS HHHHHHHHHHHTS
*->eelleeiekklqi<-*
e++leeiekkl+i
gi|1205537 364 EDILEEIEKKLNI 376
TIR: domain 1 of 1, from 411 to 426: score 0.9, E = 5.4
CS SG.....GGCCHHHHHHHHH
*->dktersqsdrikfWkkalya<-*
+k+e d+i+fWk++
gi|1205537 411 EKEE----DMIHFWKRLSRL 426
Orthopox_N1: domain 1 of 1, from 480 to 493: score 0.7, E = 6.4
*->rmiekyfddlmidl<-*
+mie+yfd + l
gi|1205537 480 QMIETYFDFRLYRL 493
IMPDH: domain 1 of 1, from 501 to 509: score 0.6, E = 6
CS EB-GGGGEE
RF xxxxxxxxx
*->egLTFDDVL<-*
+ L+FDDVL
gi|1205537 501 KLLDFDDVL 509
//