hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 126302671.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|126302671|ref|XP_001367423.1|
Accession: [none]
Description: PREDICTED: similar to nasal embryonic LHRH factor isoform 3 [Monodelphis domestica]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
Peptidase_M22 Glycoprotease family 7.5 0.049 1
UPF0547 Uncharacterised protein family UPF054 7.1 0.71 1
PRD PRD domain 3.7 2.6 1
Gemini_AL2 Geminivirus AL2 protein 2.8 3.3 1
DUF1183 Protein of unknown function (DUF1183) -1.8 3.4 1
AMP_N Aminopeptidase P, N-terminal domain 1.9 4.4 1
TIR TIR domain 0.9 5.4 1
c-SKI_SMAD_bind c-SKI Smad4 binding domain 1.6 6.1 1
Orthopox_N1 Orthopoxvirus N1 protein 0.7 6.4 1
NUP Purine nucleoside permease (NUP) -0.2 6.5 1
IFRD Interferon-related developmental regu -0.2 6.5 1
LuxS S-Ribosylhomocysteinase (LuxS) 0.8 8.9 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
Peptidase_M22 1/1 88 120 .. 267 308 .] 7.5 0.049
Gemini_AL2 1/1 100 149 .. 68 118 .. 2.8 3.3
UPF0547 1/1 162 173 .. 1 12 [. 7.1 0.71
LuxS 1/1 174 183 .. 1 10 [. 0.8 8.9
AMP_N 1/1 248 259 .. 1 12 [. 1.9 4.4
DUF1183 1/1 257 283 .. 362 396 .. -1.8 3.4
NUP 1/1 318 326 .. 1 9 [. -0.2 6.5
c-SKI_SMAD_bind 1/1 354 370 .. 82 98 .] 1.6 6.1
IFRD 1/1 355 366 .. 354 365 .] -0.2 6.5
PRD 1/1 359 371 .. 1 13 [. 3.7 2.6
TIR 1/1 406 421 .. 131 150 .] 0.9 5.4
Orthopox_N1 1/1 475 488 .. 100 113 .] 0.7 6.4
Alignments of top-scoring domains:
Peptidase_M22: domain 1 of 1, from 88 to 120: score 7.5, E = 0.049
*->aanklLkagltkdnve.feltgfvsfiePlvlYLrdnvAeiak<-*
a++k+ +g++ v+++ g eP+ +L+d++Ae++
gi|1263026 88 AGEKAASEGPK-PRVYtI--SG-----EPP--LLSDPEAEGIE 120
Gemini_AL2: domain 1 of 1, from 100 to 149: score 2.8, E = 3.3
*->RlYLggsKSPLFQdnqtrqetihleprhishpntVQPQPeESvGssQ
R+Y + ++PL+ d+++ ++ ++ ++++ Q+QP ++ ss
gi|1263026 100 RVYTISGEPPLLSDPEAEGIELSVMKGRHR-GEHHQSQPLQGSSSSE 145
vlse<-*
+ s+
gi|1263026 146 SVSR 149
UPF0547: domain 1 of 1, from 162 to 173: score 7.1, E = 0.71
*->KtCPeCdaivpl<-*
K+CP+C+++ p+
gi|1263026 162 KECPGCSQLAPA 173
LuxS: domain 1 of 1, from 174 to 183: score 0.8, E = 8.9
CS -SGGGGGSGT
*->plveSFtlDH<-*
p+ SF+lDH
gi|1263026 174 PSQQSFELDH 183
AMP_N: domain 1 of 1, from 248 to 259: score 1.9, E = 4.4
*->ipadefaaRRkr<-*
++a+ fa+RR+r
gi|1263026 248 VKAQTFAERRER 259
DUF1183: domain 1 of 1, from 257 to 283: score -1.8, E = 3.4
*->ygrnysntWgrPsyipseesrirswgyssdsgess<-*
+ r++s +W++P++i + +++ ds+ s+
gi|1263026 257 RERSFSRSWSDPTPIKT--------DSFHDSRDSH 283
NUP: domain 1 of 1, from 318 to 326: score -0.2, E = 6.5
*->iqpKVmvIt<-*
+pKVm+I+
gi|1263026 318 APPKVMLIS 326
c-SKI_SMAD_bind: domain 1 of 1, from 354 to 370: score 1.6, E = 6.1
CS CHHHHHHHHHHHHCC--
*->eeakLeqvLeevkekFd<-*
e+a+ e +Lee++ k +
gi|1263026 354 EHATFEDILEEIEKKLN 370
IFRD: domain 1 of 1, from 355 to 366: score -0.2, E = 6.5
*->RstFRDVlrfvE<-*
++tF D+l+ +E
gi|1263026 355 HATFEDILEEIE 366
PRD: domain 1 of 1, from 359 to 371: score 3.7, E = 2.6
CS HHHHHHHHHHHTS
*->eelleeiekklqi<-*
e++leeiekkl+i
gi|1263026 359 EDILEEIEKKLNI 371
TIR: domain 1 of 1, from 406 to 421: score 0.9, E = 5.4
CS SG.....GGCCHHHHHHHHH
*->dktersqsdrikfWkkalya<-*
+k+e d+i+fWk++
gi|1263026 406 EKEE----DMIHFWKRLSRL 421
Orthopox_N1: domain 1 of 1, from 475 to 488: score 0.7, E = 6.4
*->rmiekyfddlmidl<-*
+mie+yfd + l
gi|1263026 475 QMIETYFDFRLYRL 488
//