hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            126311142.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|126311142|ref|XP_001380846.1|
Accession:      [none]
Description:    PREDICTED: hypothetical protein [Monodelphis domestica]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
RhoGEF          RhoGEF domain                           120.8    2.2e-35   1
F-box           F-box domain                             28.2    4.8e-07   1
SMI1_KNR4       SMI1 / KNR4 family                        9.5      0.035   1
RPN7            26S proteasome subunit RPN7               4.0        1.2   1
IL6             Interleukin-6/G-CSF/MGF family            3.4        1.3   1
DUF444          Protein of unknown function (DUF444)      2.3        1.6   1
FdhD-NarQ       FdhD/NarQ family                          3.1        1.7   1
DUF1481         Protein of unknown function (DUF1481)     2.0        1.8   1
DUF645          Protein of unknown function, DUF645       3.9        1.9   1
Radical_SAM_N   Radical SAM N-terminal                    1.6        2.2   1
Pkinase_Tyr     Protein tyrosine kinase                   1.6        2.5   1
Pox_P4A         Poxvirus P4A protein                     -0.5        2.6   1
Pec_lyase_C     Pectate lyase                             3.3          3   1
RdRP            RNA dependent RNA polymerase              1.0        3.3   1
CSE2            RNA polymerase II transcription media     2.7        3.6   1
Hjc             Archaeal holliday junction resolvase      3.3        3.9   1
Dopey_N         Dopey, N-terminal                         0.7        4.4   1
LicD            LICD Protein Family                       0.9        4.5   1
Mo25            Mo25-like                                 0.2        5.2   1
DUF1284         Protein of unknown function (DUF1284)     0.8        5.6   1
GerE            Bacterial regulatory proteins, luxR f     2.9        6.2   1
BAG             BAG domain                                2.2        6.3   1
Herpes_UL6      Herpesvirus UL6 like                     -0.4        6.3   1
SBP_bac_3       Bacterial extracellular solute-bindin     0.5          7   1
mRNA_triPase    mRNA capping enzyme, beta chain          -0.3        7.5   1
PsbI            Photosystem II reaction centre I prot     2.1        7.8   1
DUF1357         Protein of unknown function (DUF1357)     0.1        7.8   1
DUF1479         Protein of unknown function (DUF1479)     0.3        8.3   1
Peptidase_M74   Penicillin-insensitive murein endopep    -0.2        8.4   1
Med18           Med18 protein                            -0.0        8.7   1
DUF2075         Uncharacterized conserved protein (DU     0.5        8.9   1
DUF1802         Domain of unknown function (DUF1802)      0.7        9.1   1
HTH_3           Helix-turn-helix                          2.6        9.1   1
Baculo_helicase Baculovirus DNA helicase                 -2.7        9.1   1
Kelch_1         Kelch motif                               2.4        9.4   1
Biliv-reduc_cat Biliverdin reductase, catalytic           1.1        9.8   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Dopey_N           1/1      18    31 ..   305   318 .]     0.7      4.4
Kelch_1           1/1      38    55 ..    28    45 .]     2.4      9.4
DUF645            1/1      88   102 ..     1    15 [.     3.9      1.9
PsbI              1/1     113   134 ..     1    24 [.     2.1      7.8
Baculo_helicase   1/1     115   127 ..  1271  1283 .]    -2.7      9.1
F-box             1/1     117   164 ..     1    46 []    28.2  4.8e-07
DUF1284           1/1     155   164 ..   106   115 .]     0.8      5.6
DUF1481           1/1     156   162 ..   218   224 .]     2.0      1.8
GerE              1/1     193   200 ..     1     8 [.     2.9      6.2
Hjc               1/1     222   234 ..     1    13 [.     3.3      3.9
Mo25              1/1     282   295 ..   376   389 .]     0.2      5.2
DUF1802           1/1     296   320 ..   162   186 .]     0.7      9.1
FdhD-NarQ         1/1     326   352 ..   192   217 ..     3.1      1.7
Radical_SAM_N     1/1     337   347 ..   344   354 .]     1.6      2.2
RdRP              1/1     345   352 ..   443   450 .]     1.0      3.3
Peptidase_M74     1/1     381   389 ..     1     9 [.    -0.2      8.4
SBP_bac_3         1/1     465   480 ..   205   221 .]     0.5        7
SMI1_KNR4         1/1     487   508 ..   117   142 .]     9.5    0.035
DUF2075           1/1     489   497 ..   277   289 .]     0.5      8.9
IL6               1/1     501   514 ..   141   154 .]     3.4      1.3
Pkinase_Tyr       1/1     518   528 ..   260   270 .]     1.6      2.5
Biliv-reduc_cat   1/1     520   531 ..     1    12 [.     1.1      9.8
HTH_3             1/1     586   608 ..    37    59 .]     2.6      9.1
CSE2              1/1     590   603 ..    79    92 .]     2.7      3.6
RhoGEF            1/1     612   795 ..     1   207 []   120.8  2.2e-35
mRNA_triPase      1/1     672   682 ..     1    11 [.    -0.3      7.5
RPN7              1/1     705   723 ..    85   103 ..     4.0      1.2
DUF444            1/1     724   735 ..   446   457 .]     2.3      1.6
Med18             1/1     745   765 ..     1    24 [.    -0.0      8.7
LicD              1/1     753   764 ..   264   275 .]     0.9      4.5
DUF1357           1/1     776   797 ..   202   226 .]     0.1      7.8
DUF1479           1/1     777   788 ..     1    14 [.     0.3      8.3
BAG               1/1     782   814 ..     1    39 [.     2.2      6.3
Pox_P4A           1/1     791   809 ..  1325  1343 .]    -0.5      2.6
Pec_lyase_C       1/1     819   825 ..   244   250 .]     3.3        3
Herpes_UL6        1/1     824   837 ..   587   600 .]    -0.4      6.3

Alignments of top-scoring domains:
Dopey_N: domain 1 of 1, from 18 to 31: score 0.7, E = 4.4
                   *->lglskdTelvvsdS<-*
                      +++ + Te +v dS
  gi|1263111    18    MNREISTEMSVRDS    31

Kelch_1: domain 1 of 1, from 38 to 55: score 2.4, E = 9.4
                CS    EEEEETTTTEEEEETTSS
                   *->vevYDpetntWtrlpsmp<-*
                      +e++ ++  tWt++++ +
  gi|1263111    38    IECFQTKFSTWTPITNKS    55

DUF645: domain 1 of 1, from 88 to 102: score 3.9, E = 1.9
                   *->lldvqhgkfgFtkgc<-*
                      l   +h+++ F+kgc
  gi|1263111    88    LQNCSHSQLTFVKGC    102

PsbI: domain 1 of 1, from 113 to 134: score 2.1, E = 7.8
                   *->mltLkifvYavvilFvsLFiFGfL<-*
                        + k+   +v+  F+sL+iF fL
  gi|1263111   113    --VAKVDFCTVLPRFISLYIFSFL    134

Baculo_helicase: domain 1 of 1, from 115 to 127: score -2.7, E = 9.1
                   *->kkDFntnvPkFKc<-*
                      k DF t+ P+F++
  gi|1263111   115    KVDFCTVLPRFIS    127

F-box: domain 1 of 1, from 117 to 164: score 28.2, E = 4.8e-07
                CS    -HHHHS-HHHHHHHHTTS-HHHHHHHTTT-HHHHHHHCT- HHH HH
                   *->fslldLPdellleIlsrLdpkdllrlslVSkrwrslvdsl.lwk.kl
                      +    LP  + l I+s+L+p+dl+++++V++ w+ l   + lw++k+
  gi|1263111   117    DFCTVLPRFISLYIFSFLNPMDLCAAAQVNWPWKFLTEQDcLWRpKC 163

                CS H
                   l<-*
                   +
  gi|1263111   164 I    164

DUF1284: domain 1 of 1, from 155 to 164: score 0.8, E = 5.6
                   *->ggCeWlelGy<-*
                      ++C W+++++
  gi|1263111   155    QDCLWRPKCI    164

DUF1481: domain 1 of 1, from 156 to 162: score 2.0, E = 1.8
                   *->DCrWqPk<-*
                      DC W+Pk
  gi|1263111   156    DCLWRPK    162

GerE: domain 1 of 1, from 193 to 200: score 2.9, E = 6.2
                CS    --SS-HHH
                   *->ldsLspRE<-*
                      ld+L+pRE
  gi|1263111   193    LDWLTPRE    200

Hjc: domain 1 of 1, from 222 to 234: score 3.3, E = 3.9
                CS    HHHHHHHHHHHHT
                   *->ryERELvkiLeer<-*
                      ++ER+L+ki ++r
  gi|1263111   222    QRERYLRKIIWGR    234

Mo25: domain 1 of 1, from 282 to 295: score 0.2, E = 5.2
                   *->EKefiikqIesLpp<-*
                      EK++++ ++e+Lp+
  gi|1263111   282    EKQLVLASLEALPK    295

DUF1802: domain 1 of 1, from 296 to 320: score 0.7, E = 9.1
                   *->nesislaesrPVlsDeeFaqlaqei<-*
                      ++++s + s+PVls++ +++  q+
  gi|1263111   296    KKNVSGSHSYPVLSNKHYHRADQKY    320

FdhD-NarQ: domain 1 of 1, from 326 to 352: score 3.1, E = 1.7
                   *->nlrksfllvSGRiS.semvqKaaraGv<-*
                      +++ s++l S+Ri+ +emv  +++ Gv
  gi|1263111   326    SVQTSLVLISSRIPaYEMVVDSVKTGV    352

Radical_SAM_N: domain 1 of 1, from 337 to 347: score 1.6, E = 2.2
                   *->kIPAyemIKfS<-*
                      +IPAyem+  S
  gi|1263111   337    RIPAYEMVVDS    347

RdRP: domain 1 of 1, from 345 to 352: score 1.0, E = 3.3
                   *->VDfpKtGv<-*
                      VD++KtGv
  gi|1263111   345    VDSVKTGV    352

Peptidase_M74: domain 1 of 1, from 381 to 389: score -0.2, E = 8.4
                   *->qSIGsYanG<-*
                      qSIG ++ G
  gi|1263111   381    QSIGIFSDG    389

SBP_bac_3: domain 1 of 1, from 465 to 480: score 0.5, E = 7
                RF    xxxxxxxxxxxxxxxxx
                   *->kadGtlakiyeKWgfge<-*
                      +a G+++ i+  W +g+
  gi|1263111   465    IATGSYQHILSDW-LGQ    480

SMI1_KNR4: domain 1 of 1, from 487 to 508: score 9.5, E = 0.035
                   *->gqvivvfwdhdeivvvAdSFeefLek<-*
                      +++  +f dh  + + + SF+efLe+
  gi|1263111   487    PSI--YFCDH--KLQTWHSFTEFLEE    508

DUF2075: domain 1 of 1, from 489 to 497: score 0.5, E = 8.9
                   *->iYaPpGatDpeLr<-*
                      iY+    +D++L+
  gi|1263111   489    IYF----CDHKLQ    497

IL6: domain 1 of 1, from 501 to 514: score 3.4, E = 1.3
                CS    HHHHHHHHHHHHHH
                   *->sLeeFLefslRAlR<-*
                      s+ eFLe +l ++R
  gi|1263111   501    SFTEFLEETLKSVR    514

Pkinase_Tyr: domain 1 of 1, from 518 to 528: score 1.6, E = 2.5
                CS    S-HHHHHHHHH
                   *->RPtFselveeL<-*
                      RP F+el++ +
  gi|1263111   518    RPHFKELQRNI    528

Biliv-reduc_cat: domain 1 of 1, from 520 to 531: score 1.1, E = 9.8
                   *->dFKqLKrEveGK<-*
                       FK L r ++GK
  gi|1263111   520    HFKELQRNISGK    531

HTH_3: domain 1 of 1, from 586 to 608: score 2.6, E = 9.1
                CS    SSTSBHHHHHHHHHHTTSHHHHH
                   *->krePsletlkklaeaLgvsldel<-*
                      + ++ le+l+kl++ L+ +l+e
  gi|1263111   586    EDDLKLEVLVKLERKLQMDLAEK    608

CSE2: domain 1 of 1, from 590 to 603: score 2.7, E = 3.6
                CS    HHHHHHHHHHHHHT
                   *->KedlLqkldkkLer<-*
                      K ++L+kl +kL++
  gi|1263111   590    KLEVLVKLERKLQM    603

RhoGEF: domain 1 of 1, from 612 to 795: score 120.8, E = 2.2e-35
                   *->vlkElleTEkkYvrdLeildnvymkpLreaaisskplLtpddietiF
                      ++ Ell +E+kY++ Lei+++vy  p+++a +s +++L++ di++iF
  gi|1263111   612    IAGELLKSERKYIQMLEIVRDVYVTPMKAALASNRAILSSTDIQIIF 658

                   sNiediyefhreFLkssLearisssnfedlDekkiepsaqrlGdlFlelk
                   s+i   ++++++FL+ +L++r++++            +aq+lG +F ++
  gi|1263111   659 SDILCVLDLNKHFLD-ELTKRLQEW-----------GPAQCLGEIFTKF- 695

                   aeflqvYgeYcsnkpyAqelleklrqaasnpqFaefldeveassntgAkd
                     +l+ Y+ + +n+p++ +++ek  +++ +p+F+ fl++  +   t
  gi|1263111   696 GLQLKTYTNFFNNYPVVLKTIEK--CREMIPAFRAFLKRQDKTIVTR--- 740

                   davkltLqsLLlkPvqRilrYpLLLkeLLkhtpegedssesedLkkalda
                        +Lq LLl+P  R   Y  LL  L +htp+  ++ ++edL  a+++
  gi|1263111   741 ---MMSLQELLLYPSRRFEEYLNLLYGLRLHTPS--EHGDREDLTTAIKQ 785

                   lqdlaksiNe<-*
                   +++ + +iN+
  gi|1263111   786 IKRYIGYINQ    795

mRNA_triPase: domain 1 of 1, from 672 to 682: score -0.3, E = 7.5
                CS    --HHHHHHHHH
                   *->pdsftksvadw<-*
                      +d++tk++++w
  gi|1263111   672    LDELTKRLQEW    682

RPN7: domain 1 of 1, from 705 to 723: score 4.0, E = 1.2
                   *->ffnDwdlVskyiekAksli<-*
                      ffn++++V+k iek++++i
  gi|1263111   705    FFNNYPVVLKTIEKCREMI    723

DUF444: domain 1 of 1, from 724 to 735: score 2.3, E = 1.6
                   *->pVfrelFqkeea<-*
                      p+fr +++++++
  gi|1263111   724    PAFRAFLKRQDK    735

Med18: domain 1 of 1, from 745 to 765: score -0.0, E = 8.7
                   *->qELlLygsVpdhslelllhrLagL<-*
                      qELlLy   p++++e+ l+ L gL
  gi|1263111   745    QELLLY---PSRRFEEYLNLLYGL    765

LicD: domain 1 of 1, from 753 to 764: score 0.9, E = 4.5
                   *->nnydeyLtreYG<-*
                      ++++eyL+ +YG
  gi|1263111   753    RRFEEYLNLLYG    764

DUF1357: domain 1 of 1, from 776 to 797: score 0.1, E = 7.8
                   *->fteLrkAmlNeweelkiqF.YcNkkk<-*
                      + +L+ A+    +++k+  +Y+N++k
  gi|1263111   776    REDLTTAI----KQIKRYIgYINQLK    797

DUF1479: domain 1 of 1, from 777 to 788: score 0.3, E = 8.3
                   *->dpLPDKsrfaelKq<-*
                      ++L+   +++++K+
  gi|1263111   777    EDLT--TAIKQIKR    788

BAG: domain 1 of 1, from 782 to 814: score 2.2, E = 6.3
                CS    HHHHHHHHHHHHC..CHHCHHHHHH..HHCCCCCHHHHH
                   *->siakinevlgeVlKlvrkieqevqssdadgkkddkeylr<-*
                      +i+ i +++g +    + ++q+v++   d+ +d ++  +
  gi|1263111   782    AIKQIKRYIGYI----NQLKQNVNR--KDQLSDVERSIC    814

Pox_P4A: domain 1 of 1, from 791 to 809: score -0.5, E = 2.6
                   *->pYFnsmKKNLNmnDgsavS<-*
                      +Y n++K N N++D ++
  gi|1263111   791    GYINQLKQNVNRKDQLSDV    809

Pec_lyase_C: domain 1 of 1, from 819 to 825: score 3.3, E = 3
                CS    EEES-EE
                   *->LSEgNsF<-*
                      LSEgN+F
  gi|1263111   819    LSEGNRF    825

Herpes_UL6: domain 1 of 1, from 824 to 837: score -0.4, E = 6.3
                   *->RLevYitdIgakyc<-*
                      R+++ ++d+++++c
  gi|1263111   824    RFLIRVQDVAQLFC    837

//