hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            126655037.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|126655037|ref|ZP_01726476.1|
Accession:      [none]
Description:    hypothetical protein CY0110_15537 [Cyanothece sp. CCY0110]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
PKD             PKD domain                              324.2    4.5e-99   8
HemolysinCabind Hemolysin-type calcium-binding repeat   311.3    3.4e-93  37
PA14            PA14 domain                              57.8    4.5e-16   3
He_PIG          Putative Ig domain                       43.3    1.7e-11   7
Dockerin_1      Dockerin type I repeat                   40.4    2.6e-11   5
Calx-beta       Calx-beta domain                         41.7    1.3e-10   2
Collagen        Collagen triple helix repeat (20 copi    21.3    7.7e-05   2
Cadherin        Cadherin domain                          14.7     0.0017   6
Reg_prop        Two component regulator propeller        15.7      0.013   6
PPC             Bacterial pre-peptidase C-terminal do    11.5      0.014   2
Y_Y_Y           Y_Y_Y domain                             10.9      0.016   3
Baculo_LEF-3    Nucleopolyhedrovirus late expression      8.9      0.031   1
Hydrophobin     Fungal hydrophobin                        9.1      0.033   1
DAP_epimerase   Diaminopimelate epimerase                 9.8      0.059   3
Flagellin_IN    Flagellin hook IN motif                   9.8      0.065   3
Cuticle_1       Crustacean cuticle protein repeat         7.7      0.079   2
Pea-VEAacid     Pea-VEAacid family                        8.7       0.12   2
SoxZ            Sulphur oxidation protein SoxZ            7.0       0.14   2
Adeno_E3_CR1    Adenovirus E3 region protein CR1          6.4       0.15   1
YjeF_N          YjeF-related protein N-terminus           5.8       0.21   1
Glyco_hydro_18  Glycosyl hydrolases family 18             4.7       0.22   2
tRNA_Me_trans   tRNA methyl transferase                   3.9       0.32   1
PmbA_TldD       Putative modulator of DNA gyrase          5.5       0.36   1
TRAUB           TRAUB (NUC102) domain                     5.5        0.4   1
DUF734          Protein of unknown function (DUF734)      5.8       0.42   2
Glyco_hydro_2   Glycosyl hydrolases family 2, immunog     3.9       0.42   1
EFP             Elongation factor P (EF-P) OB domain      6.8       0.44   2
ATP-synt_ab_N   ATP synthase alpha/beta family, beta-     5.6       0.47   1
DUF1884         Domain of unknown function (DUF1884)      4.9       0.49   1
VanW            VanW like protein                         5.3       0.52   2
PEP-utilizers   PEP-utilising enzyme, mobile domain       5.7       0.68   2
CRPV_capsid     CRPV capsid protein like                  3.7       0.74   1
DUF282          Caenorhabditis protein of unknown fun     3.5       0.78   1
CPSase_L_D2     Carbamoyl-phosphate synthase L chain,     3.9       0.79   1
V-set           Immunoglobulin V-set domain               4.9       0.81   2
DUF368          Domain of unknown function (DUF368)       2.8       0.89   1
Flagellin_N     Bacterial flagellin N-terminus            4.9       0.93   2
PilS            PilS N terminal                           3.7          1   1
Aha1_N          Activator of Hsp90 ATPase, N-terminal     4.2        1.1   1
Glyco_hydro_30  O-Glycosyl hydrolase family 30            3.0        1.1   1
Calmodulin_bind Calmodulin binding protein-like           2.9        1.2   1
Phage_GPD       Phage late control gene D protein (GP     3.1        1.2   1
TPP_enzyme_N    Thiamine pyrophosphate enzyme, N-term     3.6        1.3   1
LEF-8           Late expression factor 8 (LEF-8)          0.8        1.3   1
DASH_Dad2       DASH complex subunit Dad2                 4.2        1.3   1
MED14           Mediator complex subunit MED14            3.4        1.4   1
SfsA            Sugar fermentation stimulation protei     3.2        1.4   1
Peptidase_A4    Peptidase A4 family                       1.7        1.5   1
POLO_box        POLO box duplicated region                4.6        1.5   1
mRNA_cap_enzyme mRNA capping enzyme, catalytic domain     0.0        1.5   1
Big_3           Bacterial Ig-like domain (group 3)        5.3        1.5   1
GKAP            Guanylate-kinase-associated protein (     2.4        1.5   1
AXH             Ataxin-1 and HBP1 module (AXH)            2.9        1.7   1
PhosphMutase    2,3-bisphosphoglycerate-independent p     2.4        1.7   1
DUF2135         Uncharacterized protein conserved in      4.7        1.7   1
DUF322          Protein of unknown function (DUF322)      4.1        1.8   1
Telo_bind       Telomere-binding protein alpha subuni     4.0        1.8   1
L27_1           L27_1                                     2.6          2   1
Nbs1_C          DNA damage repair protein Nbs1            1.7          2   1
AIPR            AIPR protein                              2.4        2.2   1
DUF354          Protein of unknown function (DUF354)      1.0        2.2   1
SpoVS           Stage V sporulation protein S (SpoVS)     4.5        2.2   1
L27_N           L27_N                                     4.2        2.3   1
DUF2394         Domain of unknown function (DUF2394)      4.0        2.3   1
I-set           Immunoglobulin I-set domain               3.7        2.4   1
SBP_bac_9       Periplasmic solute binding protein fa     2.3        2.5   1
TSP_3           Thrombospondin type 3 repeat              5.1        2.5   1
Pollen_allerg_1 Pollen allergen                           3.1        2.5   2
GBS_Bsp-like    GBS Bsp-like repeat                       2.9        2.6   1
VWA_N           VWA N-terminal                            2.0        2.6   1
DUF2525         Protein of unknown function (DUF2525)     3.9        2.7   1
ATP-synt_DE     ATP synthase, Delta/Epsilon chain, lo     4.6        2.7   1
SCPU            Spore Coat Protein U domain               3.8        2.7   2
Pertussis_S1    Pertussis toxin, subunit 1                1.1        2.8   1
Lipoprotein_3   Lipoprotein                               3.0        2.9   1
HMA             Heavy-metal-associated domain             3.4        2.9   1
DNA_pol3_beta_3 DNA polymerase III beta subunit, C-te     4.1          3   1
SBP56           56kDa selenium binding protein (SBP56     0.4          3   1
EcoEI_R_C       EcoEI R protein C-terminal                1.9          3   1
DUF552          Protein of unknown function (DUF552)      3.8          3   1
Cor1            Cor1/Xlr/Xmr conserved region             3.0          3   1
DUF1290         Protein of unknown function (DUF1290)     2.5          3   1
Orthopox_C10L   Orthopoxvirus C10L protein                2.0        3.1   1
Peptidase_U32   Peptidase family U32                      2.3        3.2   1
Kunitz_legume   Trypsin and protease inhibitor            2.8        3.2   1
Transposase_20  Transposase IS116/IS110/IS902 family      3.3        3.3   1
Autotransporter Autotransporter beta-domain               2.1        3.3   1
DUF11           Domain of unknown function DUF11          4.0        3.3   2
Anophelin       Thrombin inhibitor from mosquito          2.2        3.3   1
eIF_4EBP        Eukaryotic translation initiation fac     0.3        3.3   1
Microcin        Colicin E1 (microcin) immunity protei     3.3        3.4   1
Baculo_19       Baculovirus 19 kDa protein conserved      2.7        3.4   1
Haemagg_act     haemagglutination activity domain         2.4        3.4   1
ATP-synt_DE_N   ATP synthase, Delta/Epsilon chain, be     3.7        3.5   1
Tir_receptor_C  Translocated intimin receptor (Tir) C     1.3        3.5   1
Acetate_kinase  Acetokinase family                        0.4        3.5   1
DUF1916         Domain of unknown function (DUF1916)      1.6        3.5   1
DUF348          Domain of unknown function (DUF348)       4.1        3.6   2
DUF1135         Protein of unknown function (DUF1135)     0.1        3.6   1
Avidin          Avidin family                             2.3        3.6   1
SLT_beta        Shiga-like toxin beta subunit             2.4        3.7   1
Cas_CT1975      CT1975-like protein                       2.4        3.7   1
FlgD            Flagellar hook capping protein            2.0        3.7   2
Sigma70_r3      Sigma-70 region 3                         3.6        3.7   1
FTP             Fungalysin/Thermolysin Propeptide Mot     3.6        3.8   2
COesterase      Carboxylesterase                         -1.0        3.9   1
DUF920          Bacterial protein of unknown function     2.0          4   1
Diphthamide_syn Putative diphthamide synthesis protei     0.5          4   1
Peptidase_S9_N  Prolyl oligopeptidase, N-terminal bet     0.4          4   1
B1              Protein L b1 domain                       1.6        4.1   1
EthD            EthD protein                              2.0        4.1   1
Caudal_act      Caudal like protein activation region     0.6        4.1   1
FlbD            Flagellar protein (FlbD)                  2.0        4.1   1
Raffinose_syn   Raffinose synthase or seed inhibition    -0.3        4.2   1
DUF1735         Domain of unknown function (DUF1735)      3.2        4.2   3
CoA_trans       Coenzyme A transferase                    1.6        4.2   1
zf-C3H1         Putative zinc-finger domain               5.7        4.2   1
HYR             HYR domain                                2.4        4.3   1
PA14_2          GLEYA domain                              2.6        4.3   1
DUF124          Protein of unknown function DUF124        1.5        4.3   1
DUF371          Domain of unknown function (DUF371)       2.4        4.4   1
Cu-oxidase_4    Multi-copper polyphenol oxidoreductas     0.9        4.4   1
Gp5_C           Gp5 C-terminal repeat (3 copies)          3.9        4.5   4
DUF601          Protein of unknown function, DUF601       0.2        4.7   1
Fimbrial        Fimbrial protein                          1.5        4.7   1
Peptidase_C25_C Peptidase family C25, C terminal ig-l     2.0        4.8   1
DAHP_synth_1    DAHP synthetase I family                  0.6        4.8   1
APC_crr         APC cysteine-rich region                  4.0        4.8   1
Rhodanese       Rhodanese-like domain                     1.5        4.9   1
Herpes_ICP4_C   Herpesvirus ICP4-like protein C-termi    -0.5        4.9   1
Paf67           RNA polymerase I-associated factor PA     0.6        4.9   1
RA              Ras association (RalGDS/AF-6) domain      3.2          5   2
RE_CfrBI        CfrBI restriction endonuclease           -0.4          5   1
efhand          EF hand                                   4.3          5   1
Phage_attach    Phage Head-Tail Attachment               -0.3        5.1   1
Bgal_small_N    Beta galactosidase small chain            1.2        5.1   1
DUF2490         Protein of unknown function (DUF2490)     1.8        5.1   1
MreC            rod shape-determining protein MreC        1.7        5.2   1
Flocculin       Flocculin repeat                          3.9        5.2   2
Erythro_esteras Erythromycin esterase                     0.2        5.3   1
HCR             Alpha helical coiled-coil rod protein    -1.0        5.4   1
MdoG            Periplasmic glucan biosynthesis prote    -1.2        5.4   1
CheY-binding    CheY binding                              3.2        5.4   1
RTX             RTX N-terminal domain                    -1.4        5.5   1
Pyocin_S        S-type Pyocin                             1.2        5.5   1
Dfp1_Him1_M     Dfp1/Him1, central region                 1.3        5.9   1
Motilin_assoc   Motilin/ghrelin-associated peptide        1.5          6   1
Flp_Fap         Flp/Fap pilin component                   3.5        6.2   1
TehB            Tellurite resistance protein TehB         0.6        6.2   1
PurS            Phosphoribosylformylglycinamidine (FG     1.8        6.3   1
RmuC            RmuC family                               0.7        6.3   1
Rrp15p          Rrp15p                                    2.0        6.3   1
YajC            Preprotein translocase subunit            2.6        6.6   1
ART             NAD:arginine ADP-ribosyltransferase       0.1        6.6   1
HrpF            HrpF protein                              2.0        6.6   1
DUF1539         Domain of Unknown Function (DUF1539)      1.7        6.6   1
Pathogen_betaC1 Beta-satellite pathogenicity beta C1      2.2        6.7   1
DUF1869         Domain of unknown function (DUF1869)     -0.5        6.9   1
RIP             Ribosome inactivating protein             0.4        6.9   1
CBM_6           Carbohydrate binding module (family 6     1.0          7   1
HK              Hydroxyethylthiazole kinase family        0.5          7   1
TFIIH_BTF_p62_N TFIIH p62 subunit, N-terminal domain      2.2        7.1   1
RnaseH          RNase H                                   0.6        7.1   1
GP46            Phage protein GP46                        0.9        7.2   1
LVIVD           LVIVD repeat                              2.5        7.2   1
PRC             PRC-barrel domain                         2.3        7.2   2
Retinin_C       Drosophila Retinin like protein           2.3        7.2   1
UPF0197         Uncharacterised protein family (UPF01     1.3        7.2   1
HDOD            HDOD domain                               0.9        7.2   1
Binary_toxB     Clostridial binary toxin B/anthrax to    -0.8        7.5   1
CRA             Circumsporozoite-related antigen (CRA     0.1        7.9   1
Cauli_AT        Aphid transmission protein               -0.4        7.9   1
UIM             Ubiquitin interaction motif               4.6        7.9   1
Peptidase_C7    Peptidase C7 family                      -0.7          8   1
DHHA1           DHHA1 domain                              2.3        8.1   1
DUF24           HxlR-like helix-turn-helix                0.8        8.1   2
DUF1433         Protein of unknown function (DUF1433)     0.8        8.1   1
DUF406          Protein of unknown function (DUF406)      2.2        8.2   1
COPI_assoc      COPI associated protein                   1.1        8.2   1
Glyco_hydro_32C Glycosyl hydrolases family 32 C termi     1.2        8.2   1
Glyco_hydro_28  Glycosyl hydrolases family 28            -0.2        8.4   1
PepSY           Peptidase propeptide and YPEB domain      2.6        8.4   1
WD40            WD domain, G-beta repeat                  1.9        8.5   2
FFD_TFG         FFD and TFG box motifs                    1.9        8.5   1
DUF823          Salmonella repeat of unknown function    -0.2        8.5   1
Fascin          Fascin domain                             1.5        8.6   1
Arginosuc_synth Arginosuccinate synthase                 -1.2        8.6   1
Pox_F11         Poxvirus F11 protein                     -0.8        8.7   1
Hexapep         Bacterial transferase hexapeptide (th     3.4        8.8   2
ig              Immunoglobulin domain                     1.8        8.8   1
MucBP           MucBP domain                              1.9        9.1   1
RE_XamI         XamI restriction endonuclease            -0.3        9.1   1
Peptidase_U4    Sporulation factor SpoIIGA               -0.4        9.2   1
GSPII_N         Bacterial type II secretion system pr    -0.3        9.2   1
Galactosyl_T_2  Galactosyltransferase                    -0.5        9.3   1
DUF1410         DUF1410 domain                            1.7        9.3   1
Peptidase_S24   Peptidase S24-like                        1.4        9.3   1
Peptidase_S3    Alphavirus core protein                   0.6        9.3   1
tRNA-synt_1d    tRNA synthetases class I (R)             -0.5        9.3   1
DSHCT           DSHCT (NUC185) domain                     0.3        9.3   1
NIL             NIL domain                                1.5        9.4   2
Apc13p          Apc13p protein                            0.5        9.4   1
CARDB           CARDB                                     1.6        9.4   1
NAPRTase        Nicotinate phosphoribosyltransferase      0.2        9.7   1
DUF2581         Protein of unknown function (DUF2581)     1.0        9.7   1
DUF1641         Protein of unknown function (DUF1641)     2.9        9.7   1
DUF587          Protein of unknown function (DUF587)      0.2        9.7   1
DUF231          Arabidopsis proteins of unknown funct    -0.0        9.9   1
DUF1716         Eukaryotic domain of unknown function     0.7        9.9   1
CcdA            Post-segregation antitoxin CcdA           1.5         10   2

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
EthD              1/1      44    58 ..    97   111 .]     2.0      4.1
Aha1_N            1/1      57    82 ..   126   150 .]     4.2      1.1
Paf67             1/1     131   144 ..   426   439 .]     0.6      4.9
DUF2581           1/1     161   170 ..     1    10 [.     1.0      9.7
DUF11             1/2     175   200 ..     1    26 [.     2.6      7.8
Flagellin_IN      1/3     253   269 ..     1    23 [.     4.8      1.7
SLT_beta          1/1     257   283 ..     1    27 [.     2.4      3.7
Peptidase_S3      1/1     270   286 ..     1    20 [.     0.6      9.3
DUF1433           1/1     294   305 ..    86   100 .]     0.8      8.1
HemolysinCabind   1/37    350   361 ..     7    18 .]     2.7       12
DUF1716           1/1     380   389 ..   102   111 .]     0.7      9.9
Baculo_19         1/1     383   397 ..   136   150 .]     2.7      3.4
Gp5_C             1/4     393   409 ..     8    24 .]     0.7       45
YjeF_N            1/1     394   406 ..   182   194 .]     5.8     0.21
Orthopox_C10L     1/1     409   419 ..    88    98 .]     2.0      3.1
HemolysinCabind   2/37    423   440 ..     1    18 []     5.8      1.4
HemolysinCabind   3/37    441   458 ..     1    18 []    16.5  0.00077
HemolysinCabind   4/37    468   485 ..     1    18 []    17.9   0.0003
TFIIH_BTF_p62_N   1/1     476   489 ..    64    82 .]     2.2      7.1
PepSY             1/1     492   539 ..    19    68 .]     2.6      8.4
CcdA              1/2     513   526 ..     1    14 [.     0.8       15
RE_CfrBI          1/1     600   611 ..   310   321 .]    -0.4        5
Pox_F11           1/1     605   634 ..   417   451 .]    -0.8      8.7
Cauli_AT          1/1     620   626 ..   164   170 .]    -0.4      7.9
PurS              1/1     660   669 ..     1    10 [.     1.8      6.3
HemolysinCabind   5/37    711   728 ..     1    18 []     3.8      5.7
HemolysinCabind   6/37    730   747 ..     1    18 []    13.1   0.0084
HemolysinCabind   7/37    748   765 ..     1    18 []    14.2   0.0038
HemolysinCabind   8/37    766   783 ..     1    18 []    22.1  1.5e-05
HemolysinCabind   9/37    785   792 ..    11    18 .]     2.4       15
HemolysinCabind  10/37    793   810 ..     1    18 []    14.4   0.0034
HemolysinCabind  11/37    811   828 ..     1    18 []    19.8  7.9e-05
HemolysinCabind  12/37    829   846 ..     1    18 []    17.4  0.00042
GP46              1/1     845   852 ..   117   124 .]     0.9      7.2
PPC               1/2     910   945 ..     1    45 [.     5.6     0.66
DUF348            1/2     915   933 ..     1    19 [.     1.8       16
Flagellin_IN      2/3     915   945 ..     1    38 [.     4.4      2.3
VanW              1/2     918   933 ..   128   143 .]     0.1       17
Hexapep           1/2     982   994 ..     6    18 .]     1.2       41
DUF368            1/1    1002  1028 ..   259   288 .]     2.8     0.89
Haemagg_act       1/1    1029  1044 ..   124   139 .]     2.4      3.4
HemolysinCabind  13/37   1030  1041 ..     7    18 .]     2.3       16
Flagellin_N       1/2    1076  1090 ..   127   141 .]     4.6      1.2
DUF1916           1/1    1103  1131 ..   138   166 .]     1.6      3.5
Peptidase_U4      1/1    1220  1231 ..   289   300 .]    -0.4      9.2
DUF354            1/1    1222  1240 ..   251   270 ..     1.0      2.2
RmuC              1/1    1247  1261 ..   174   192 ..     0.7      6.3
Lipoprotein_3     1/1    1333  1348 ..    90   105 .]     3.0      2.9
MreC              1/1    1341  1366 ..     1    26 [.     1.7      5.2
HemolysinCabind  14/37   1374  1391 ..     1    18 []     6.6     0.77
GSPII_N           1/1    1385  1397 ..   245   257 .]    -0.3      9.2
DAHP_synth_1      1/1    1393  1408 ..   187   204 ..     0.6      4.8
Peptidase_U32     1/1    1439  1455 ..     1    17 [.     2.3      3.2
TPP_enzyme_N      1/1    1439  1456 ..     1    18 [.     3.6      1.3
TehB              1/1    1489  1508 ..   115   137 ..     0.6      6.2
DUF231            1/1    1587  1612 ..     1    28 [.    -0.0      9.9
DUF282            1/1    1590  1631 ..   415   461 ..     3.5     0.78
DUF2490           1/1    1616  1634 ..   182   202 .]     1.8      5.1
HemolysinCabind  15/37   1667  1679 ..     1    13 [.     6.0      1.2
Raffinose_syn     1/1    1724  1742 ..     1    20 [.    -0.3      4.2
DUF823            1/1    1753  1776 ..   116   142 ..    -0.2      8.5
Pyocin_S          1/1    1756  1783 ..     1    31 [.     1.2      5.5
Dockerin_1        1/5    1816  1836 ..     1    21 []     6.2     0.89
Dfp1_Him1_M       1/1    1939  1947 ..   141   149 .]     1.3      5.9
AIPR              1/1    1949  1986 ..   308   353 .]     2.4      2.2
ATP-synt_DE_N     1/1    1965  1975 ..    71    81 .]     3.7      3.5
HCR               1/1    1968  2006 ..   722   760 .]    -1.0      5.4
HrpF              1/1    1972  1990 ..    22    41 ..     2.0      6.6
Retinin_C         1/1    2066  2077 ..     1    14 [.     2.3      7.2
Diphthamide_syn   1/1    2106  2121 ..   326   347 .]     0.5        4
Flp_Fap           1/1    2175  2189 ..    36    50 .]     3.5      6.2
HDOD              1/1    2222  2230 ..   189   197 .]     0.9      7.2
L27_N             1/1    2248  2267 ..     1    21 [.     4.2      2.3
DUF1290           1/1    2286  2301 ..    40    55 ..     2.5        3
DUF406            1/1    2286  2304 ..    19    37 ..     2.2      8.2
Rhodanese         1/1    2322  2341 ..     1    23 [.     1.5      4.9
Sigma70_r3        1/1    2322  2342 ..    63    83 .]     3.6      3.7
NIL               1/2    2353  2373 ..     1    21 [.     0.2       25
Microcin          1/1    2367  2379 ..     1    13 [.     3.3      3.4
DSHCT             1/1    2373  2384 ..   186   197 .]     0.3      9.3
Rrp15p            1/1    2415  2439 ..     1    28 [.     2.0      6.3
SpoVS             1/1    2435  2447 ..    47    59 ..     4.5      2.2
UIM               1/1    2497  2507 ..     1    11 [.     4.6      7.9
ATP-synt_DE       1/1    2526  2539 ..     1    14 [.     4.6      2.7
GKAP              1/1    2532  2537 ..   360   365 .]     2.4      1.5
Flocculin         1/2    2541  2554 ..    29    42 ..     3.5      6.4
Calx-beta         1/2    2598  2614 ..    93   109 .]     1.0       15
Cu-oxidase_4      1/1    2650  2661 ..     1    12 [.     0.9      4.4
DUF601            1/1    2666  2685 ..   182   201 ..     0.2      4.7
Binary_toxB       1/1    2767  2777 ..     1    11 [.    -0.8      7.5
TSP_3             1/1    2768  2777 ..     1    12 [.     5.1      2.5
DUF1641           1/1    2802  2815 ..    11    24 ..     2.9      9.7
Phage_attach      1/1    2861  2874 ..   104   117 .]    -0.3      5.1
DUF371            1/1    2868  2895 ..    45    72 ..     2.4      4.4
RnaseH            1/1    2893  2904 ..     1    12 [.     0.6      7.1
PA14_2            1/1    2902  2937 ..    95   134 .]     2.6      4.3
Flagellin_N       2/2    2903  2925 ..   119   141 .]     0.4       17
POLO_box          1/1    2905  2925 ..    14    35 ..     4.6      1.5
Dockerin_1        2/5    2993  3004 ..     1    12 [.     8.8     0.14
mRNA_cap_enzyme   1/1    3005  3016 ..     1    13 [.     0.0      1.5
Motilin_assoc     1/1    3071  3090 ..     1    23 [.     1.5        6
Acetate_kinase    1/1    3080  3088 ..   389   397 .]     0.4      3.5
DUF2394           1/1    3260  3278 ..    23    44 .]     4.0      2.3
Cas_CT1975        1/1    3261  3301 ..   383   422 .]     2.4      3.7
DHHA1             1/1    3269  3289 ..    51    72 .]     2.3      8.1
Nbs1_C            1/1    3387  3391 ..    61    65 .]     1.7        2
Calmodulin_bind   1/1    3392  3411 ..     1    20 [.     2.9      1.2
Hydrophobin       1/1    3476  3513 ..    67   107 ..     9.1    0.033
Peptidase_C7      1/1    3515  3533 ..   249   267 .]    -0.7        8
Erythro_esteras   1/1    3517  3525 ..   361   369 .]     0.2      5.3
zf-C3H1           1/1    3535  3544 ..     1    10 [.     5.7      4.2
UPF0197           1/1    3553  3559 ..    73    79 .]     1.3      7.2
Cor1              1/1    3563  3573 ..     1    11 [.     3.0        3
Anophelin         1/1    3613  3628 ..    51    66 .]     2.2      3.3
L27_1             1/1    3621  3629 ..    56    64 .]     2.6        2
AXH               1/1    3639  3654 ..     1    16 [.     2.9      1.7
Caudal_act        1/1    3663  3671 ..   181   189 .]     0.6      4.1
PPC               2/2    3671  3695 ..     1    34 [.     5.9     0.56
DAP_epimerase     1/3    3705  3726 ..     1    22 [.     5.3     0.96
HemolysinCabind  16/37   3708  3717 ..     1    10 [.     2.8       11
FlbD              1/1    3715  3727 ..     1    13 [.     2.0      4.1
Dockerin_1        3/5    3720  3724 ..     1     5 [.     0.1       70
HemolysinCabind  17/37   3728  3736 ..     1     9 [.     2.2       17
Pathogen_betaC1   1/1    3742  3750 ..     1     9 [.     2.2      6.7
Reg_prop          1/6    3766  3790 ..     1    23 []     2.6       27
HemolysinCabind  18/37   3775  3785 ..     8    18 .]     4.9      2.6
HemolysinCabind  19/37   3786  3803 ..     1    18 []    17.9  0.00029
RTX               1/1    3789  3813 ..   629   653 ..    -1.4      5.5
HemolysinCabind  20/37   3804  3821 ..     1    18 []    18.5   0.0002
HemolysinCabind  21/37   3822  3839 ..     1    18 []    18.1  0.00025
HemolysinCabind  22/37   3840  3857 ..     1    18 []    17.6  0.00035
HemolysinCabind  23/37   3858  3875 ..     1    18 []    12.7    0.011
DUF348            2/2    3910  3924 ..    29    43 .]     2.2       12
HMA               1/1    3915  3951 ..    25    64 .]     3.4      2.9
PRC               1/2    3920  3936 ..    75    91 .]     1.8      9.8
Cuticle_1         1/2    3928  3938 ..    34    44 .]     0.9       13
Kunitz_legume     1/1    3985  3992 ..     1     8 [.     2.8      3.2
PRC               2/2    4005  4027 ..    69    91 .]     0.5       23
HemolysinCabind  24/37   4060  4070 ..     8    18 .]     0.3       62
DNA_pol3_beta_3   1/1    4065  4086 ..    42    66 ..     4.1        3
PEP-utilizers     1/2    4109  4118 ..    82    92 .]     4.6      1.4
HemolysinCabind  25/37   4112  4122 ..     8    18 .]     4.0      4.7
HemolysinCabind  26/37   4140  4157 ..     1    18 []    12.3    0.014
HemolysinCabind  27/37   4158  4175 ..     1    18 []    10.6    0.047
Arginosuc_synth   1/1    4217  4235 ..   226   248 ..    -1.2      8.6
DASH_Dad2         1/1    4259  4283 ..   108   132 .]     4.2      1.3
SBP_bac_9         1/1    4263  4285 ..   300   322 .]     2.3      2.5
CPSase_L_D2       1/1    4321  4332 ..    96   107 ..     3.9     0.79
DUF2525           1/1    4337  4346 ..     1    10 [.     3.9      2.7
HemolysinCabind  28/37   4381  4389 ..    10    18 .]     6.2      1.1
HemolysinCabind  29/37   4401  4409 ..    10    18 .]     4.1      4.4
HemolysinCabind  30/37   4440  4448 ..    10    18 .]     2.6       13
HemolysinCabind  31/37   4459  4468 ..     9    18 .]     4.9      2.6
HemolysinCabind  32/37   4517  4536 ..     1    18 []     1.5       27
VanW              2/2    4533  4555 ..   121   143 .]     5.2     0.54
Tir_receptor_C    1/1    4542  4552 ..     1    11 [.     1.3      3.5
CcdA              2/2    4557  4576 ..    48    67 ..     0.7       17
HemolysinCabind  33/37   4572  4578 ..    12    18 .]     0.7       49
eIF_4EBP          1/1    4603  4613 ..   117   127 .]     0.3      3.3
DUF1884           1/1    4623  4637 ..     1    17 [.     4.9     0.49
Baculo_LEF-3      1/1    4652  4679 ..   347   374 .]     8.9    0.031
TRAUB             1/1    4656  4668 ..    75    87 .]     5.5      0.4
Glyco_hydro_30    1/1    4671  4693 ..    70    92 ..     3.0      1.1
HemolysinCabind  34/37   4722  4731 ..     9    18 .]     0.6       51
DUF734            1/2    4796  4810 ..    66    83 .]     2.9      3.1
HemolysinCabind  35/37   4826  4835 ..     9    18 .]     0.8       46
RIP               1/1    4832  4855 ..     1    27 [.     0.4      6.9
YajC              1/1    4923  4936 ..    59    75 ..     2.6      6.6
DUF1135           1/1    4927  4959 ..   235   267 .]     0.1      3.6
PilS              1/1    5011  5048 ..   104   142 ..     3.7        1
PA14              1/3    5016  5070 ..     1    66 [.     1.3      6.3
FFD_TFG           1/1    5047  5055 ..    42    50 .]     1.9      8.5
Gp5_C             2/4    5050  5070 ..     1    20 [.     0.5       49
SfsA              1/1    5072  5090 ..   128   146 ..     3.2      1.4
PA14              2/3    5142  5239 ..    52   169 ..    18.5  7.8e-05
DAP_epimerase     2/3    5210  5226 ..    56    77 ..     0.3       20
DUF124            1/1    5232  5248 ..     1    17 [.     1.5      4.3
Autotransporter   1/1    5275  5350 ..   208   296 .]     2.1      3.3
B1                1/1    5279  5300 ..    49    70 .]     1.6      4.1
PmbA_TldD         1/1    5284  5295 ..   302   313 .]     5.5     0.36
NIL               2/2    5289  5302 ..     1    14 [.     1.3       11
PhosphMutase      1/1    5315  5322 ..   234   241 .]     2.4      1.7
Gp5_C             3/4    5324  5341 ..     4    21 ..     2.1       16
Hexapep           2/2    5324  5332 ..     1     9 [.     2.3       20
Collagen          1/2    5387  5399 ..     1    13 [.     4.2      2.6
Collagen          2/2    5459  5489 ..    30    60 .]    17.0    0.001
Fimbrial          1/1    5726  5737 ..     1    12 [.     1.5      4.7
CRPV_capsid       1/1    5769  5782 ..   242   255 .]     3.7     0.74
Pertussis_S1      1/1    5845  5857 ..     1    13 [.     1.1      2.8
Pea-VEAacid       1/2    5853  5867 ..     1    15 []     3.9      3.9
Glyco_hydro_32C   1/1    5865  5887 ..     1    57 [.     1.2      8.2
HemolysinCabind  36/37   5908  5925 ..     1    18 []     2.7       12
Fascin            1/1    5995  6022 ..     1    37 [.     1.5      8.6
CRA               1/1    6001  6033 ..   130   162 .]     0.1      7.9
Reg_prop          2/6    6030  6052 ..     1    23 []     4.4      9.1
LVIVD             1/1    6032  6056 ..     1    25 [.     2.5      7.2
WD40              1/2    6033  6060 ..    11    38 .]     1.5       12
APC_crr           1/1    6058  6069 ..    15    27 .]     4.0      4.8
PA14              3/3    6188  6255 ..    78   171 ..    38.0  2.1e-10
tRNA_Me_trans     1/1    6190  6216 ..   235   264 ..     3.9     0.32
CBM_6             1/1    6215  6232 ..    92   109 ..     1.0        7
RE_XamI           1/1    6221  6228 ..     1     8 [.    -0.3      9.1
Pea-VEAacid       2/2    6222  6235 ..     1    15 []     4.8        2
DAP_epimerase     3/3    6224  6241 ..    56    78 ..     4.2      1.8
Reg_prop          3/6    6287  6311 ..     1    23 []     0.2  1.1e+02
Peptidase_A4      1/1    6289  6307 ..   208   228 .]     1.7      1.5
Flocculin         2/2    6301  6311 ..    36    46 .]     0.3       45
DUF1410           1/1    6305  6329 ..    60    86 .]     1.7      9.3
DUF1735           1/3    6323  6354 ..    30    65 .]     0.9       19
SBP56             1/1    6338  6352 ..   323   337 ..     0.4        3
Bgal_small_N      1/1    6342  6370 ..     1    28 [.     1.2      5.1
DUF587            1/1    6415  6428 ..   215   228 .]     0.2      9.7
Peptidase_S9_N    1/1    6416  6433 ..   447   464 .]     0.4        4
Transposase_20    1/1    6431  6440 ..     1    10 [.     3.3      3.3
Reg_prop          4/6    6435  6458 ..     1    23 []     5.1      6.2
HK                1/1    6444  6454 ..   164   176 ..     0.5        7
GBS_Bsp-like      1/1    6448  6462 ..    83    97 .]     2.9      2.6
CheY-binding      1/1    6478  6486 ..    57    65 .]     3.2      5.4
DUF734            2/2    6482  6497 ..    66    83 .]     2.9        3
Flagellin_IN      3/3    6514  6535 ..     1    27 [.     0.7       25
Apc13p            1/1    6656  6672 ..    35    53 ..     0.5      9.4
Peptidase_S24     1/1    6712  6734 ..    61    87 .]     1.4      9.3
HemolysinCabind  37/37   6730  6740 ..     8    18 .]     0.2       68
ART               1/1    6739  6763 ..   239   265 .]     0.1      6.6
PEP-utilizers     2/2    6739  6760 ..    70    92 .]     1.1       14
Adeno_E3_CR1      1/1    6828  6839 ..     1    12 [.     6.4     0.15
DUF920            1/1    6828  6840 ..   159   171 .]     2.0        4
DUF1735           2/3    6877  6908 ..    36    65 .]     2.1      8.6
PKD               1/8    6899  6927 ..    65    92 .]    12.1   0.0034
Cadherin          1/6    6902  6927 ..    72   103 ..     2.5      5.3
He_PIG            1/7    6903  6916 ..    48    61 .]     4.0      2.4
RA                1/2    6905  6938 ..     1    33 [.     0.8       22
V-set             1/2    6933  7018 ..     1   115 [.     2.6      3.6
PKD               2/8    6937  7013 ..     1    92 []    51.6  2.5e-15
Cuticle_1         2/2    6939  6952 ..    31    44 .]     6.8     0.16
EcoEI_R_C         1/1    6989  7032 ..     1    50 [.     1.9        3
FTP               1/2    6991  7016 ..     1    26 [.     3.4      4.5
PKD               3/8    7020  7099 ..     1    92 []    35.4  2.4e-10
DUF552            1/1    7031  7048 ..    39    56 .]     3.8        3
Avidin            1/1    7039  7050 ..   116   127 .]     2.3      3.6
Phage_GPD         1/1    7066  7088 ..   340   362 .]     3.1      1.2
V-set             2/2    7070  7100 ..   114   142 .]     2.3      4.2
Cadherin          2/6    7074  7100 ..    72   107 .]     1.0       15
He_PIG            2/7    7075  7088 ..    48    61 .]     0.4       25
DUF322            1/1    7089  7103 ..    97   111 .]     4.1      1.8
Glyco_hydro_28    1/1    7095  7123 ..   331   362 .]    -0.2      8.4
Y_Y_Y             1/3    7130  7196 ..     1    69 []     7.8     0.14
NAPRTase          1/1    7132  7148 ..   294   310 .]     0.2      9.7
FlgD              1/2    7146  7192 ..   100   155 .]     0.9        8
PKD               4/8    7160  7195 ..    53    92 .]    21.3  5.1e-06
Glyco_hydro_2     1/1    7165  7196 ..    41    80 ..     3.9     0.42
He_PIG            3/7    7166  7184 ..    40    61 .]     4.6      1.6
Cadherin          3/6    7170  7196 ..    72   103 ..     3.9      2.1
MED14             1/1    7173  7183 ..   215   225 .]     3.4      1.4
Pollen_allerg_1   1/2    7191  7200 ..    77    86 .]     2.0      5.7
I-set             1/1    7200  7224 ..     1    25 [.     3.7      2.4
Peptidase_C25_C   1/1    7200  7212 ..     1    13 [.     2.0      4.8
PKD               5/8    7207  7281 ..     1    92 []    63.2  6.8e-19
ig                1/1    7214  7272 ..     1    62 [.     1.8      8.8
FlgD              2/2    7253  7280 ..   126   155 .]     1.1      7.1
DUF1869           1/1    7254  7264 ..     1    11 [.    -0.5      6.9
Cadherin          4/6    7256  7282 ..    72   103 ..     3.4      2.9
He_PIG            4/7    7257  7270 ..    48    61 .]     9.1    0.086
Y_Y_Y             2/3    7257  7282 ..    41    69 .]     0.3       23
FTP               2/2    7258  7272 ..     1    15 [.     0.2       36
RA                2/2    7259  7287 ..     1    28 [.     2.4      8.2
SoxZ              1/2    7260  7281 ..    83   104 .]     3.2        2
DUF11             2/2    7262  7288 ..     1    27 [.     1.4       17
PKD               6/8    7288  7367 ..     1    92 []    46.5  9.7e-14
WD40              2/2    7312  7322 ..    28    38 .]     0.4       28
He_PIG            5/7    7338  7356 ..    42    61 .]     7.0     0.33
Cadherin          5/6    7342  7368 ..    72   107 .]     0.6       18
SCPU              1/2    7343  7352 ..    60    69 .]     1.0       17
COPI_assoc        1/1    7372  7389 ..   133   150 .]     1.1      8.2
PKD               7/8    7375  7454 ..     1    92 []    43.7  6.9e-13
ATP-synt_ab_N     1/1    7383  7393 ..    59    69 .]     5.6     0.47
Herpes_ICP4_C     1/1    7406  7418 ..   438   451 .]    -0.5      4.9
He_PIG            6/7    7414  7443 ..    31    61 .]     9.0    0.092
Telo_bind         1/1    7428  7461 ..     1    37 [.     4.0      1.8
Cadherin          6/6    7429  7455 ..    72   107 .]     3.2      3.2
Big_3             1/1    7430  7454 ..    49    70 .]     5.3      1.5
SCPU              2/2    7443  7453 ..    60    69 .]     2.8      5.1
PKD               8/8    7491  7543 ..    34    92 .]    50.3  6.7e-15
He_PIG            7/7    7505  7531 ..    38    61 .]     9.1    0.083
Y_Y_Y             3/3    7513  7544 ..    36    69 .]     2.8      4.1
HYR               1/1    7518  7543 ..    60    86 .]     2.4      4.3
Pollen_allerg_1   2/2    7532  7548 ..    70    86 .]     1.1       11
DUF1735           3/3    7543  7567 ..    38    65 .]     0.2       29
Gp5_C             4/4    7554  7567 ..     1    14 [.     0.6       47
MdoG              1/1    7574  7588 ..   355   370 ..    -1.2      5.4
Glyco_hydro_18    1/2    7577  7608 ..     1    41 [.     2.3      1.1
VWA_N             1/1    7583  7607 ..    89   114 ..     2.0      2.6
EFP               1/2    7602  7611 ..     1    10 [.     1.2       17
DUF1539           1/1    7605  7619 ..   120   134 .]     1.7      6.6
Galactosyl_T_2    1/1    7635  7645 ..   271   282 .]    -0.5      9.3
tRNA-synt_1d      1/1    7676  7682 ..   369   375 .]    -0.5      9.3
DUF24             1/2    7681  7691 ..    82    92 .]     0.4       11
Reg_prop          5/6    7694  7719 ..     1    23 []     1.7       45
CARDB             1/1    7738  7764 ..     1    30 [.     1.6      9.4
Glyco_hydro_18    2/2    7768  7799 ..     1    41 [.     2.4        1
Reg_prop          6/6    7789  7814 ..     1    23 []     1.7       45
DUF24             2/2    7871  7881 ..    82    92 .]     0.4       11
MucBP             1/1    7883  7923 ..     1    68 [.     1.9      9.1
EFP               2/2    7888  7900 ..     1    13 [.     5.5     0.98
SoxZ              2/2    7906  7924 ..    86   104 .]     3.8      1.3
LEF-8             1/1    7908  7929 ..   873   894 .]     0.8      1.3
CoA_trans         1/1    7923  7939 ..   228   244 .]     1.6      4.2
Calx-beta         2/2    7961  8003 ..    48    94 ..    40.7  2.3e-10
COesterase        1/1    7975  8016 ..     1    55 [.    -1.0      3.9
DUF2135           1/1    7987  8001 ..    47    61 .]     4.7      1.7
Dockerin_1        4/5    8008  8023 ..     1    16 [.    13.9   0.0038
efhand            1/1    8008  8027 ..    10    29 .]     4.3        5
Dockerin_1        5/5    8068  8083 ..     1    16 [.    11.4    0.022

Alignments of top-scoring domains:
EthD: domain 1 of 1, from 44 to 58: score 2.0, E = 4.1
                   *->ggnvltlligDetde<-*
                      ++n+ + +++Det+
  gi|1266550    44    PDNQMMVVTFDETED    58

Aha1_N: domain 1 of 1, from 57 to 82: score 4.2, E = 1.1
                CS    HHTHHHHHHHHHHHHHHHHHHH .T-
                   *->kkgvpklreklgkFvkeLkeeh.isk<-*
                      ++g++k+ e lg++ +e+ + h i+
  gi|1266550    57    EDGIEKISETLGQYEQEIEAIHlIGH    82

Paf67: domain 1 of 1, from 131 to 144: score 0.6, E = 4.9
                   *->rygDfFlrqinKle<-*
                      + g++F++q++Kl+
  gi|1266550   131    TIGSQFINQLAKLT    144

DUF2581: domain 1 of 1, from 161 to 170: score 1.0, E = 9.7
                   *->skpWeLevrP<-*
                      + +W+Lev++
  gi|1266550   161    GGDWDLEVTT    170

DUF11: domain 1 of 2, from 175 to 200: score 2.6, E = 7.8
                   *->ttgatddlppnnnanatvtvtpvadl<-*
                      t++++ddl+ n ++++ v+ ++++ +
  gi|1266550   175    TGLVFDDLTLNSYQSVLVNINNNSAQ    200

Flagellin_IN: domain 1 of 3, from 253 to 269: score 4.8, E = 1.7
                   *->tltinggggkensvadgvdisls<-*
                      tlt++g++++e+      +i+ls
  gi|1266550   253    TLTFTGNDKDET------KIDLS    269

SLT_beta: domain 1 of 1, from 257 to 283: score 2.4, E = 3.7
                CS    X--EEEEEEEEEEEE-TTS-EEEEETT
                   *->AapDCvkGKvEysKYneDDtFtvKvdd<-*
                         D  + K++ s  n D tFtv  d+
  gi|1266550   257    TGNDKDETKIDLSNLNTDKTFTVENDG    283

Peptidase_S3: domain 1 of 1, from 270 to 286: score 0.6, E = 9.3
                   *->alKlEaDktFpvkledGkvn<-*
                         l  DktF v + dG ++
  gi|1266550   270    --NLNTDKTFTVEN-DGTII    286

DUF1433: domain 1 of 1, from 294 to 305: score 0.8, E = 8.1
                   *->daKnklSVdEIIeKk<-*
                      ++K  l+V++I  K+
  gi|1266550   294    TPK-SLTVSDI--KN    305

HemolysinCabind: domain 1 of 37, from 350 to 361: score 2.7, E = 12
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D L Gg+G +t+
  gi|1266550   350    DNLKGGQGKNTY    361

DUF1716: domain 1 of 1, from 380 to 389: score 0.7, E = 9.9
                   *->eNtDIaiaVv<-*
                      +N+DI+++ +
  gi|1266550   380    QNNDIVNEII    389

Baculo_19: domain 1 of 1, from 383 to 397: score 2.7, E = 3.4
                   *->DiINyLIsnGyvkig<-*
                      Di+N +I++G ++ +
  gi|1266550   383    DIVNEIIYQGSADRT    397

Gp5_C: domain 1 of 4, from 393 to 409: score 0.7, E = 45
                CS    SS-EEEEESSEEEEEES
                   *->kGnrtvtVgGnqTtsVg<-*
                      +++rt+t  G++T + +
  gi|1266550   393    SADRTITFTGDKTGNAN    409

YjeF_N: domain 1 of 1, from 394 to 406: score 5.8, E = 0.21
                   *->AdyTvTFgapKpG<-*
                      Ad T+TF + K+G
  gi|1266550   394    ADRTITFTGDKTG    406

Orthopox_C10L: domain 1 of 1, from 409 to 419: score 2.0, E = 3.1
                   *->nGGVngGigKI<-*
                      nG +n+G  KI
  gi|1266550   409    NGLINSGFTKI    419

HemolysinCabind: domain 2 of 37, from 423 to 440: score 5.8, E = 1.4
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G+G D ++G +GnD +
  gi|1266550   423    TTGKGEDNITGFGGNDNF    440

HemolysinCabind: domain 3 of 37, from 441 to 458: score 16.5, E = 0.00077
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG+ nD L G+ GnD l
  gi|1266550   441    VGGEDNDNLVGNTGNDSL    458

HemolysinCabind: domain 4 of 37, from 468 to 485: score 17.9, E = 0.0003
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG GnDtL Gg+  Dt+
  gi|1266550   468    SGGTGNDTLVGGDDSDTY    485

TFIIH_BTF_p62_N: domain 1 of 1, from 476 to 489: score 2.2, E = 7.1
                CS    EE-....SSS-CCEEETTT
                   *->lvlkpeaknddpatfvfsn<-*
                      lv+     +dd++t++f++
  gi|1266550   476    LVG-----GDDSDTYQFED    489

PepSY: domain 1 of 1, from 492 to 539: score 2.6, E = 8.4
                   *->eviksielddedkkdealglggtvvyvvv.dddg.rlevyvDaytGe
                      + ++++eld+e+++d      +++ ++ + +++ ++ +v+vD +t +
  gi|1266550   492    GEDTVVELDNEGTADTL----DFSSVTQDiTVTIgSKNVLVDSNTNK 534

                   vlgve<-*
                   v g +
  gi|1266550   535 VRGNN    539

CcdA: domain 1 of 2, from 513 to 526: score 0.8, E = 15
                   *->tkQrvTVTVDrdlv<-*
                       +Q +TVT+ +  v
  gi|1266550   513    VTQDITVTIGSKNV    526

RE_CfrBI: domain 1 of 1, from 600 to 611: score -0.4, E = 5
                   *->ifIaDtLsdqnk<-*
                      i+I D  s+++k
  gi|1266550   600    IIIIDKTSETSK    611

Pox_F11: domain 1 of 1, from 605 to 634: score -0.8, E = 8.7
                   *->krceavkkRdkLvdilkyiidveNlLalssigvpv<-*
                      k +e+ kk +k+        +v N + +s+i+  +
  gi|1266550   605    KTSETSKKNNKI-----TALGVKNIIGSSGINSYI    634

Cauli_AT: domain 1 of 1, from 620 to 626: score -0.4, E = 7.9
                   *->gLKkiIG<-*
                      g+K+iIG
  gi|1266550   620    GVKNIIG    626

PurS: domain 1 of 1, from 660 to 669: score 1.8, E = 6.3
                CS    EEEEEEEEE-
                   *->YkveVyikLK<-*
                      Yk++V + LK
  gi|1266550   660    YKADVAVNLK    669

HemolysinCabind: domain 5 of 37, from 711 to 728: score 3.8, E = 5.7
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG  nD+L  ++ n++
  gi|1266550   711    KGGSFNDHLLADSDNNVT    728

HemolysinCabind: domain 6 of 37, from 730 to 747: score 13.1, E = 0.0084
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+ G+D L G + +D+l
  gi|1266550   730    SGNRGDDYLEGSNQDDVL    747

HemolysinCabind: domain 7 of 37, from 748 to 765: score 14.2, E = 0.0038
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+aG Dt++G++G+D +
  gi|1266550   748    SGDAGLDTIFGHQGDDDI    765

HemolysinCabind: domain 8 of 37, from 766 to 783: score 22.1, E = 1.5e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG+ nD+L+GgaGnDt+
  gi|1266550   766    EGGNQNDSLDGGAGNDTI    783

HemolysinCabind: domain 9 of 37, from 785 to 792: score 2.4, E = 15
                CS    EESSCGEE
                   *->GgaGnDtl<-*
                      Gg+G+Dt
  gi|1266550   785    GGSGDDTV    792

HemolysinCabind: domain 10 of 37, from 793 to 810: score 14.4, E = 0.0034
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + Ga nD+ +GgaG D l
  gi|1266550   793    IAGADNDSVDGGAGEDSL    810

HemolysinCabind: domain 11 of 37, from 811 to 828: score 19.8, E = 7.9e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG+G+Dt+ Gg+ +Dt+
  gi|1266550   811    EGGEGDDTIKGGDDDDTI    828

HemolysinCabind: domain 12 of 37, from 829 to 846: score 17.4, E = 0.00042
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG GnD L G  G Dt+
  gi|1266550   829    IGGTGNDELKGETGSDTY    846

GP46: domain 1 of 1, from 845 to 852: score 0.9, E = 7.2
                   *->pitFddiW<-*
                      +++F+d+W
  gi|1266550   845    TYIFEDNW    852

PPC: domain 1 of 2, from 910 to 945: score 5.6, E = 0.66
                CS    -EEEEEEEESTTCE EEEEEECTSSS...S...CCEEEEEEECCCS
                   *->dvdvysFtvpaggt.lsisldggsslrslsgnGdadtlLywlldgd<
                           +F+++ +gt++++++++++         d ++l++ +l+++
  gi|1266550   910    FPTLSTFSLKVNGTtVTVNISSST---------DINSLIT-ILNKN  945

                CS
                   -*

  gi|1266550     -    -

DUF348: domain 1 of 2, from 915 to 933: score 1.8, E = 16
                   *->pVtvvvDGkektvwTtAtT<-*
                      + +++v+G+++tv+  ++T
  gi|1266550   915    TFSLKVNGTTVTVNISSST    933

Flagellin_IN: domain 2 of 3, from 915 to 945: score 4.4, E = 2.3
                   *->tltinggggkensvadgvdislsagdslaaladaINsa<-*
                      t++++++g++ +       +++s+ +++  l++ +N++
  gi|1266550   915    TFSLKVNGTTVT-------VNISSSTDINSLITILNKN    945

VanW: domain 1 of 2, from 918 to 933: score 0.1, E = 17
                   *->aslddghltgeiysdg<-*
                      +  +++ +t++i+s++
  gi|1266550   918    LKVNGTTVTVNISSST    933

Hexapep: domain 1 of 2, from 982 to 994: score 1.2, E = 41
                CS    TTEEEETTEEEET
                   *->dnvvIgpgvvIgd<-*
                      +n+ + p++vI d
  gi|1266550   982    NNTEVDPNAVIFD    994

DUF368: domain 1 of 1, from 1002 to 1028: score 2.8, E = 0.89
                   *->KevlswrinsdGeqvplseangvtlsPiaf<-*
                      +e l +++ s+Ge++   +++   l++ ++
  gi|1266550  1002    QESLKGTTISSGEVLTETSQA---LLFGQL    1028

Haemagg_act: domain 1 of 1, from 1029 to 1044: score 2.4, E = 3.4
                CS    EEEEEEE-SEEEEETT
                   *->vgglfvtTgaisikff<-*
                      ++++++ Tg++s+k+
  gi|1266550  1029    TNSITAGTGDDSLKHI    1044

HemolysinCabind: domain 13 of 37, from 1030 to 1041: score 2.3, E = 16
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      ++++ g G+D l
  gi|1266550  1030    NSITAGTGDDSL    1041

Flagellin_N: domain 1 of 2, from 1076 to 1090: score 4.6, E = 1.2
                CS    STT-EEEEEE---ST
                   *->anagetikvdlgsvs<-*
                      an+++ti++d +s+s
  gi|1266550  1076    ANKNQTITIDTQSIS    1090

DUF1916: domain 1 of 1, from 1103 to 1131: score 1.6, E = 3.5
                   *->vqkALDevLsedkntsakskpknedaika<-*
                      v k L +v+++++ ++  +++k+ + i++
  gi|1266550  1103    VNKELEFVFKQEEDGHTSLTIKKAAEIED    1131

Peptidase_U4: domain 1 of 1, from 1220 to 1231: score -0.4, E = 9.2
                   *->ndYnAilhpkli<-*
                      +d++Ai+  k i
  gi|1266550  1220    GDFEAIIPEKVI    1231

DUF354: domain 1 of 1, from 1222 to 1240: score 1.0, E = 2.2
                   *->fdNviIPkkpvDtLsLlyys<-*
                      f+ +iIP+k ++tL+ + +s
  gi|1266550  1222    FE-AIIPEKVINTLDISGRS    1240

RmuC: domain 1 of 1, from 1247 to 1261: score 0.7, E = 6.3
                   *->seKdYwdkFLagpeTtDFv<-*
                      seKdY    La+ ++++Fv
  gi|1266550  1247    SEKDY----LAELFSPNFV    1261

Lipoprotein_3: domain 1 of 1, from 1333 to 1348: score 3.0, E = 2.9
                   *->FvKAFGsGkskedVeP<-*
                      F  +FGs+ +  +V+P
  gi|1266550  1333    FDRTFGSNTFSIGVNP    1348

MreC: domain 1 of 1, from 1341 to 1366: score 1.7, E = 5.2
                   *->AeVIsrspdpwsqtivIdkGskdGvk<-*
                      +  I+++p +   +++++ G+k G++
  gi|1266550  1341    TFSIGVNPVSATLSPLVNNGFKEGLE    1366

HemolysinCabind: domain 14 of 37, from 1374 to 1391: score 6.6, E = 0.77
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G+ G   +yGg G+Dt+
  gi|1266550  1374    VGDLGLHLIYGGTGADTY    1391

GSPII_N: domain 1 of 1, from 1385 to 1397: score -0.3, E = 9.2
                   *->eQGrrPlrfQGrL<-*
                      ++G+ +++f G++
  gi|1266550  1385    GTGADTYNFEGKW    1397

DAHP_synth_1: domain 1 of 1, from 1393 to 1408: score 0.6, E = 4.8
                CS    EEEE.TTSBEEEEEE--E
                   *->flGvtKdGvvAIvstkgv<-*
                      f+G  K+G++AIv+t+++
  gi|1266550  1393    FEG--KWGATAIVETPNI    1408

Peptidase_U32: domain 1 of 1, from 1439 to 1455: score 2.3, E = 3.2
                   *->leeleeylddLaelGvD<-*
                      ++++e ++ddL+++Gv+
  gi|1266550  1439    FDGAEITVDDLRKIGVE    1455

TPP_enzyme_N: domain 1 of 1, from 1439 to 1456: score 3.6, E = 1.3
                CS    EBHHHHHHHHHHHTT-SE
                   *->atgadylverLeqqGVdt<-*
                      ++ga+++v+ L+++GV++
  gi|1266550  1439    FDGAEITVDDLRKIGVEI    1456

TehB: domain 1 of 1, from 1489 to 1508: score 0.6, E = 6.2
                   *->eIIaNMQehTnvGGYNLIVaAMs<-*
                      +IIaN    T++GGY   VaAM+
  gi|1266550  1489    QIIANGNSGTLSGGY---VAAMD    1508

DUF231: domain 1 of 1, from 1587 to 1612: score -0.0, E = 9.9
                   *->WtrpkkykelwevvGcyfqeGdpv.nyte<-*
                      +++p + ++l+ vvG+    G+ + n+te
  gi|1266550  1587    FNTPVGTYQLGNVVGVQ---GNRFwNVTE    1612

DUF282: domain 1 of 1, from 1590 to 1631: score 3.5, E = 0.78
                   *->PtGTtarldlgGsseiaGtsvGFtEvlayCretGadaGkWftGVPdf
                      P GT+   +  G   ++   v  tE+l y +e+G d+  Wf    d+
  gi|1266550  1590    PVGTYQLGNVVGVQGNRFWNV--TEALSYLDEFGVDTPDWFN---DI 1631

                   <-*

  gi|1266550     -     -

DUF2490: domain 1 of 1, from 1616 to 1634: score 1.8, E = 5.1
                   *->Ylnqfinrsdtpdrsnhilgl<-*
                      Yl  f    dtpd++n+i+gl
  gi|1266550  1616    YLDEFGV--DTPDWFNDIVGL    1634

HemolysinCabind: domain 15 of 37, from 1667 to 1679: score 6.0, E = 1.2
                CS    E--SSS-EEEEES
                   *->yGGaGnDtLyGga<-*
                       G++GnD+ yG a
  gi|1266550  1667    VGNGGNDVVYGAA    1679

Raffinose_syn: domain 1 of 1, from 1724 to 1742: score -0.3, E = 4.2
                   *->fslsdgklvvkngktiLtdV<-*
                      ++ls++ ++v++  t+L+d+
  gi|1266550  1724    VDLSQD-FAVQGNETVLSDI    1742

DUF823: domain 1 of 1, from 1753 to 1776: score -0.2, E = 8.5
                   *->gSaeylPtlndLqaLYsahPggaiaTa<-*
                      g ++ lP+ +dL+a  +a+  ++++T+
  gi|1266550  1753    G-VNPLPLNSDLEAIAAAN--STLNTT    1776

Pyocin_S: domain 1 of 1, from 1756 to 1783: score 1.2, E = 5.5
                   *->aLsppltadLnavAaakGTVdlPvRlriver<-*
                       L  pl  dL a+Aaa  T  + +Rl+++e+
  gi|1266550  1756    PL--PLNSDLEAIAAANSTLNT-TRLYSIEG    1783

Dockerin_1: domain 1 of 5, from 1816 to 1836: score 6.2, E = 0.89
                CS    -TT-SS--SHHHHHHHHHHH-
                   *->DvNgDGkVnalDlallkkyll<-*
                      D+N++++ n lD++ + k l
  gi|1266550  1816    DLNNNNSKNILDFSGVTKKLD    1836

Dfp1_Him1_M: domain 1 of 1, from 1939 to 1947: score 1.3, E = 5.9
                   *->lGRCPFigd<-*
                      lG++PF+++
  gi|1266550  1939    LGKIPFLDE    1947

AIPR: domain 1 of 1, from 1949 to 1986: score 2.4, E = 2.2
                   *->ldeiwskqleaacadlsnklldalleiiaekvnevitnspeglgns<
                      l e+w+ +         + + d++ e +++ v+ev+tns++++ n+
  gi|1266550  1949    LSELWNLT--------GGTISDKINEQVTVLVDEVFTNSEGDITNA  1986

                   -*

  gi|1266550     -    -

ATP-synt_DE_N: domain 1 of 1, from 1965 to 1975: score 3.7, E = 3.5
                CS    SEEEEEESSEE
                   *->pnkVtiLAdtA<-*
                      +++Vt+L+d++
  gi|1266550  1965    NEQVTVLVDEV    1975

HCR: domain 1 of 1, from 1968 to 2006: score -1.0, E = 5.4
                   *->LsvLLDdLqGLsEAiskeEdvCveDnldrkksknPqsds<-*
                      ++vL+D++   sE    + d+   Dn ++  s+nP+
  gi|1266550  1968    VTVLVDEVFTNSEGDITNADIAALDNIEQSFSSNPREFV    2006

HrpF: domain 1 of 1, from 1972 to 1990: score 2.0, E = 6.6
                   *->lDdaameaSEGeysveDsfA<-*
                      +D++  + SEG+ + +D+ A
  gi|1266550  1972    VDEVFTN-SEGDITNADIAA    1990

Retinin_C: domain 1 of 1, from 2066 to 2077: score 2.3, E = 7.2
                   *->vvhePvlAKVGavV<-*
                       ++eP+l  VG+v+
  gi|1266550  2066    YIYEPTL--VGSVS    2077

Diphthamide_syn: domain 1 of 1, from 2106 to 2121: score 0.5, E = 4
                   *->leiaLgsDvsrNnrekYamDEi<-*
                      +++ Lg      ++ k+++DEi
  gi|1266550  2106    ASVSLG------SDGKLTFDEI    2121

Flp_Fap: domain 1 of 1, from 2175 to 2189: score 3.5, E = 6.2
                   *->taLktkFtkigtalt<-*
                      t+L+++F++++++l+
  gi|1266550  2175    TTLSGFFSEVASSLS    2189

HDOD: domain 1 of 1, from 2222 to 2230: score 0.9, E = 7.2
                   *->eaiayHHdP<-*
                      ++iay+H P
  gi|1266550  2222    DGIAYQHIP    2230

L27_N: domain 1 of 1, from 2248 to 2267: score 4.2, E = 2.3
                   *->elEeLllSLKqvqhcLtDsQS<-*
                       +E L+++   vq  L D QS
  gi|1266550  2248    -IEGLQQAIDIVQDGLSDIQS    2267

DUF1290: domain 1 of 1, from 2286 to 2301: score 2.5, E = 3
                   *->FGGiRAsledkFdnrv<-*
                      FG+ +A le  Fdn v
  gi|1266550  2286    FGATKAELETAFDNLV    2301

DUF406: domain 1 of 1, from 2286 to 2304: score 2.2, E = 8.2
                   *->vyatkaeAeaaLaklteKA<-*
                      + atkae+e a+++l+ +A
  gi|1266550  2286    FGATKAELETAFDNLVSLA    2304

Rhodanese: domain 1 of 1, from 2322 to 2341: score 1.5, E = 4.9
                CS    HHHHHHCHTT.TTEEEEEESSHH
                   *->tagelkallesapkliliDvRsp<-*
                         +++++le   ++ ++D+R++
  gi|1266550  2322    DDTQVQDILE---DVAIVDARDN    2341

Sigma70_r3: domain 1 of 1, from 2322 to 2342: score 3.6, E = 3.7
                   *->eDselgdlleDdeaespedav<-*
                      +D++ +d+leD  ++++ d +
  gi|1266550  2322    DDTQVQDILEDVAIVDARDNL    2342

NIL: domain 1 of 2, from 2353 to 2373: score 0.2, E = 25
                   *->dgkivrLtFtGesaqePiise<-*
                      d +i+ + F+ +++   ++s+
  gi|1266550  2353    DDQIIDVLFDDQTTFNSLVSD    2373

Microcin: domain 1 of 1, from 2367 to 2379: score 3.3, E = 3.4
                   *->yyfLasdkmLyai<-*
                      + +L+sd+ L+a+
  gi|1266550  2367    FNSLVSDRNLVAA    2379

DSHCT: domain 1 of 1, from 2373 to 2384: score 0.3, E = 9.3
                   *->kRDIVFaASLYL<-*
                      +R  V+a+S+Y
  gi|1266550  2373    DRNLVAANSDYI    2384

Rrp15p: domain 1 of 1, from 2415 to 2439: score 2.0, E = 6.3
                   *->gfAdaiakiLssklpatdrkdTPilarn<-*
                      +fA+++++iL+    +t +k   ++arn
  gi|1266550  2415    AFAEETVAILNDADADTYEK---AIARN    2439

SpoVS: domain 1 of 1, from 2435 to 2447: score 4.5, E = 2.2
                   *->AIARGflapsGiD<-*
                      AIAR fl+p G+D
  gi|1266550  2435    AIARNFLTPYGLD    2447

UIM: domain 1 of 1, from 2497 to 2507: score 4.6, E = 7.9
                   *->mdEEedLqlAL<-*
                      ++E++d++ AL
  gi|1266550  2497    NSEDDDIKFAL    2507

ATP-synt_DE: domain 1 of 1, from 2526 to 2539: score 4.6, E = 2.7
                CS    GG--HHHHHHHHHH
                   *->seIDvseAkaalek<-*
                      s+ID++eA+++l++
  gi|1266550  2526    SDIDPDEAQTRLDA    2539

GKAP: domain 1 of 1, from 2532 to 2537: score 2.4, E = 1.5
                   *->EAQTRL<-*
                      EAQTRL
  gi|1266550  2532    EAQTRL    2537

Flocculin: domain 1 of 2, from 2541 to 2554: score 3.5, E = 6.4
                   *->GTnGlpTtETiivv<-*
                      G++G +T E i+v+
  gi|1266550  2541    GVDGDSTAEAIYVI    2554

Calx-beta: domain 1 of 2, from 2598 to 2614: score 1.0, E = 15
                   *->iDDdvyEgdEnFfvrLs<-*
                      i+    Eg E F+++L
  gi|1266550  2598    IEEIDIEGQEEFSLNLR    2614

Cu-oxidase_4: domain 1 of 1, from 2650 to 2661: score 0.9, E = 4.4
                CS    TS-S----SSSS
                   *->PydSLNLGlHVG<-*
                        +SLNLGl V+
  gi|1266550  2650    ALASLNLGLDVD    2661

DUF601: domain 1 of 1, from 2666 to 2685: score 0.2, E = 4.7
                   *->FNsvFlSHEDQLfDKDkEIE<-*
                      FN  F+ H D  fD D E+E
  gi|1266550  2666    FNPTFYVHDDTVFDFDLELE    2685

Binary_toxB: domain 1 of 1, from 2767 to 2777: score -0.8, E = 7.5
                   *->dlDtDnDgIPD<-*
                        DtDnDgI D
  gi|1266550  2767    TEDTDNDGIAD    2777

TSP_3: domain 1 of 1, from 2768 to 2777: score 5.1, E = 2.5
                CS    --TT-SSS-..G
                   *->eDsDnDgvgdnD<-*
                      eD+DnDg+   D
  gi|1266550  2768    EDTDNDGIA--D    2777

DUF1641: domain 1 of 1, from 2802 to 2815: score 2.9, E = 9.7
                   *->vglfgLlkaLkDPD<-*
                      v+  +L+++L+DPD
  gi|1266550  2802    VSAADLFALLNDPD    2815

Phage_attach: domain 1 of 1, from 2861 to 2874: score -0.3, E = 5.1
                   *->wLgrGtPPadnRRR<-*
                      +Lg    P+d RRR
  gi|1266550  2861    LLGTEASPTDFRRR    2874

DUF371: domain 1 of 1, from 2868 to 2895: score 2.4, E = 4.4
                   *->seeFKealrdgdaiitvtLevggltDei<-*
                      + +F++ l+ ++ ++t+++e +++t+e+
  gi|1266550  2868    PTDFRRRLQAPELTVTTLIEGDDTTQEV    2895

RnaseH: domain 1 of 1, from 2893 to 2904: score 0.6, E = 7.1
                CS    -----EEEEEEE
                   *->peavtvYTDGSs<-*
                       e  t+YTDG+s
  gi|1266550  2893    QEVQTIYTDGGS    2904

PA14_2: domain 1 of 1, from 2902 to 2937: score 2.6, E = 4.3
                   *->agiGgfdfsftspdgnaiattsGsakdvvsyfYsvdtstc<-*
                      +g+G f ++f+++++++i +t  +    + ++   ++ t
  gi|1266550  2902    GGSGTFQIAFNDESTILIDST--ASNSEIETAL--ENLTI    2937

Flagellin_N: domain 2 of 2, from 2903 to 2925: score 0.4, E = 17
                CS    EEEEE-SSSTT-EEEEEE---ST
                   *->knvsfqvganagetikvdlgsvs<-*
                      ++++fq++ n+++ti +d  +
  gi|1266550  2903    GSGTFQIAFNDESTILIDSTASN    2925

POLO_box: domain 1 of 1, from 2905 to 2925: score 4.6, E = 1.5
                CS    S-EEEEECTTS-EEEEETTTTE
                   *->gsvgVnFFnDhtklillpdgee<-*
                      g++++  FnD +++++++++++
  gi|1266550  2905    GTFQIA-FNDESTILIDSTASN    2925

Dockerin_1: domain 2 of 5, from 2993 to 3004: score 8.8, E = 0.14
                CS    -TT-SS--SHHH
                   *->DvNgDGkVnalD<-*
                      D NgDG +nalD
  gi|1266550  2993    DENGDGLINALD    3004

mRNA_cap_enzyme: domain 1 of 1, from 3005 to 3016: score 0.0, E = 1.5
                CS    EEEE--CHCHHCH
                   *->qPvSfsraenlkl<-*
                       PvS+++ +nl++
  gi|1266550  3005    VPVSLED-DNLQF    3016

Motilin_assoc: domain 1 of 1, from 3071 to 3090: score 1.5, E = 6
                   *->pldPddageaegeEeeleIklnA<-*
                       +d++      ++ eel+I+lnA
  gi|1266550  3071    YIDTE---GTSDTGEELVIQLNA    3090

Acetate_kinase: domain 1 of 1, from 3080 to 3088: score 0.4, E = 3.5
                CS    --HHHHHHH
                   *->TNEElaIAr<-*
                      T+EEl+I+
  gi|1266550  3080    TGEELVIQL    3088

DUF2394: domain 1 of 1, from 3260 to 3278: score 4.0, E = 2.3
                   *->LGtDrvrvYrldaaadGkLtpa<-*
                      LG D++r+ +l    + kLt++
  gi|1266550  3260    LGFDEIRLLDLA---QLKLTET    3278

Cas_CT1975: domain 1 of 1, from 3261 to 3301: score 2.4, E = 3.7
                   *->Gdtaipvesaaslsvldgegafta.gisekgsldeLvewva<-*
                      G+++i + ++a l +++ e+  ++++i++ ++++e v+ v
  gi|1266550  3261    GFDEIRLLDLAQLKLTETEFSNLEkAIDALVTFGEFVDTVK    3301

DHHA1: domain 1 of 1, from 3269 to 3289: score 2.3, E = 8.1
                   *->dAAGaggkdgskleealellee<-*
                      d+A++++++ + + ++ +++++
  gi|1266550  3269    DLAQLKLTETE-FSNLEKAIDA    3289

Nbs1_C: domain 1 of 1, from 3387 to 3391: score 1.7, E = 2
                   *->DLFRY<-*
                      DLFRY
  gi|1266550  3387    DLFRY    3391

Calmodulin_bind: domain 1 of 1, from 3392 to 3411: score 2.9, E = 1.2
                   *->rmpkLkFvfrkrpelPlFTG<-*
                       mp L++vf      P+FTG
  gi|1266550  3392    DMPGLNLVFDYTQSFPIFTG    3411

Hydrophobin: domain 1 of 1, from 3476 to 3513: score 9.1, E = 0.033
                   *->spqaglllGLLGivglgglgglgglVGltCsKldL.vldPIs<-*
                      + +ag++lGL G+  +g+lgg+ +++G++ +  d+++  PI+
  gi|1266550  3476    AIAAGASLGLSGLAEAGVLGGIEANIGFDLN--DVpD--PIT    3513

Peptidase_C7: domain 1 of 1, from 3515 to 3533: score -0.7, E = 8
                   *->EQDGallyqaisdlaekdP<-*
                      E DG l+ ++i + + ++P
  gi|1266550  3515    EEDGLLFIDEIAQRLQQEP    3533

Erythro_esteras: domain 1 of 1, from 3517 to 3525: score 0.2, E = 5.3
                   *->DaliwfdeT<-*
                      D+l+++de+
  gi|1266550  3517    DGLLFIDEI    3525

zf-C3H1: domain 1 of 1, from 3535 to 3544: score 5.7, E = 4.2
                   *->pLCpyEltGG<-*
                      pLC+++++G+
  gi|1266550  3535    PLCLFDTSGE    3544

UPF0197: domain 1 of 1, from 3553 to 3559: score 1.3, E = 7.2
                   *->LwVGIYV<-*
                      LwVGI V
  gi|1266550  3553    LWVGIRV    3559

Cor1: domain 1 of 1, from 3563 to 3573: score 3.0, E = 3
                   *->NKtLqekRkrm<-*
                       KtL ekR+r+
  gi|1266550  3563    EKTLYEKRERF    3573

Anophelin: domain 1 of 1, from 3613 to 3628: score 2.2, E = 3.3
                   *->itDddyeefdpSLlee<-*
                      ++Dd+  + + SLlee
  gi|1266550  3613    QPDDTGVAYEVSLLEE    3628

L27_1: domain 1 of 1, from 3621 to 3629: score 2.6, E = 2
                   *->YEltlldnq<-*
                      YE++ll+++
  gi|1266550  3621    YEVSLLEED    3629

AXH: domain 1 of 1, from 3639 to 3654: score 2.9, E = 1.7
                   *->FlkGtrlqladGelkr<-*
                      F +G ++++a+G++++
  gi|1266550  3639    FAAGDYIEVASGSNVE    3654

Caudal_act: domain 1 of 1, from 3663 to 3671: score 0.6, E = 4.1
                   *->tvqststgk<-*
                      t+q+t+t++
  gi|1266550  3663    TIQATGTSQ    3671

PPC: domain 2 of 2, from 3671 to 3695: score 5.9, E = 0.56
                CS    -EEEEEEEESTTCEEEEEEECTSSS...S...CC
                   *->dvdvysFtvpaggtlsisldggsslrslsgnGda<-*
                      + d+y ++  +g++++++++ggs         d+
  gi|1266550  3671    QADTYEISGLTGTNINLATGGGS---------DL    3695

DAP_epimerase: domain 1 of 3, from 3705 to 3726: score 5.3, E = 0.96
                CS    EEEECCTCEEEEEECCTTTS-H
                   *->fakmhGnphdvvvVddvesadl<-*
                      +++m G+++d +++ dv++++l
  gi|1266550  3705    VTVMGGSGNDMIFLTDVNGDVL    3726

HemolysinCabind: domain 16 of 37, from 3708 to 3717: score 2.8, E = 11
                CS    E--SSS-EEE
                   *->yGGaGnDtLy<-*
                       GG GnD ++
  gi|1266550  3708    MGGSGNDMIF    3717

FlbD: domain 1 of 1, from 3715 to 3727: score 2.0, E = 4.1
                   *->MIkLTRLNGkeFv<-*
                      MI LT  NG  +v
  gi|1266550  3715    MIFLTDVNGDVLV    3727

Dockerin_1: domain 3 of 5, from 3720 to 3724: score 0.1, E = 70
                CS    -TT-S
                   *->DvNgD<-*
                      DvNgD
  gi|1266550  3720    DVNGD    3724

HemolysinCabind: domain 17 of 37, from 3728 to 3736: score 2.2, E = 17
                CS    E--SSS-EE
                   *->yGGaGnDtL<-*
                       G +GnD++
  gi|1266550  3728    QGEEGNDSI    3736

Pathogen_betaC1: domain 1 of 1, from 3742 to 3750: score 2.2, E = 6.7
                   *->TIkYnNkkG<-*
                      T +Y+N+kG
  gi|1266550  3742    TVTYSNGKG    3750

Reg_prop: domain 1 of 6, from 3766 to 3790: score 2.6, E = 27
                   *->slpgg.vtfalledsdG.rlWigt.n<-*
                       + +++ t  +l++++G+++ +g+++
  gi|1266550  3766    IGGDNdRT-RILRGGEGsDFILGSeG    3790

HemolysinCabind: domain 18 of 37, from 3775 to 3785: score 4.9, E = 2.6
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      +L+Gg+G D +
  gi|1266550  3775    ILRGGEGSDFI    3785

HemolysinCabind: domain 19 of 37, from 3786 to 3803: score 17.9, E = 0.00029
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G +G+D +yG+aG D++
  gi|1266550  3786    LGSEGDDEIYGDAGEDLI    3803

RTX: domain 1 of 1, from 3789 to 3813: score -1.4, E = 5.5
                   *->dgdDkVFvgSGStevdAGeGHDvVy<-*
                      +gdD ++  +G   ++AGeG D+V+
  gi|1266550  3789    EGDDEIYGDAGEDLINAGEGNDTVS    3813

HemolysinCabind: domain 20 of 37, from 3804 to 3821: score 18.5, E = 0.0002
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      + G+GnDt +Gg G+D++
  gi|1266550  3804    NAGEGNDTVSGGTGDDQI    3821

HemolysinCabind: domain 21 of 37, from 3822 to 3839: score 18.1, E = 0.00025
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG+G+D + G+aG D++
  gi|1266550  3822    LGGEGDDQIQGDAGEDVI    3839

HemolysinCabind: domain 22 of 37, from 3840 to 3857: score 17.6, E = 0.00035
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G aGnDt+ Gg  nD l
  gi|1266550  3840    LGEAGNDTIQGGTDNDYL    3857

HemolysinCabind: domain 23 of 37, from 3858 to 3875: score 12.7, E = 0.011
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG   D   G aGnDt+
  gi|1266550  3858    VGGLDSDNVQGEAGNDTI    3875

DUF348: domain 2 of 2, from 3910 to 3924: score 2.2, E = 12
                   *->islgeeDkvspsrda<-*
                      ++ g+ D+v++s+++
  gi|1266550  3910    VDTGSVDTVTVSANE    3924

HMA: domain 1 of 1, from 3915 to 3951: score 3.4, E = 2.9
                CS    EEEEEEETTTTEEEEEESTTTSCHHHHHHHHHHTTSEEEE
                   *->VtsveVdletgkltVtgdedlpklkklveaveiigydarl<-*
                      V+ v+V+ +++k+ V++d+   +   l+ ++e  g+d ++
  gi|1266550  3915    VDTVTVSANEDKVIVDWDG---DNVTLENTIESLGVDLGK    3951

PRC: domain 1 of 2, from 3920 to 3936: score 1.8, E = 9.8
                CS    EEECSSCEEESSSTGGG
                   *->vdlggdriivdapkell<-*
                      v++ +d++ivd++ +++
  gi|1266550  3920    VSANEDKVIVDWDGDNV    3936

Cuticle_1: domain 1 of 2, from 3928 to 3938: score 0.9, E = 13
                   *->iVtsdGkNvQl<-*
                      iV  dG+Nv+l
  gi|1266550  3928    IVDWDGDNVTL    3938

Kunitz_legume: domain 1 of 1, from 3985 to 3992: score 2.8, E = 3.2
                CS    B-BETTSC
                   *->pVLDtdGn<-*
                      pVLD++Gn
  gi|1266550  3985    PVLDANGN    3992

PRC: domain 2 of 2, from 4005 to 4027: score 0.5, E = 23
                CS    ...G-CEEECSSCEEESSSTGGG
                   *->eaivlevdlggdriivdapkell<-*
                      + +v+  d+++++++v+++ ++
  gi|1266550  4005    KEWVNTTDIEDGWVVVEEDGDQS    4027

HemolysinCabind: domain 24 of 37, from 4060 to 4070: score 0.3, E = 62
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      t+ Gg  nD l
  gi|1266550  4060    TIIGGTNNDEL    4070

DNA_pol3_beta_3: domain 1 of 1, from 4065 to 4086: score 4.1, E = 3
                CS    EE.TTEEEEEEE-TTS-EEEE..EE
                   *->iePegqLkltannpEiGeaeEFFev<-*
                      ++ +++L+lt++ +E+Ge+ E  ++
  gi|1266550  4065    TN-NDELTLTSDQDEDGETGE--AI    4086

PEP-utilizers: domain 1 of 2, from 4109 to 4118: score 4.6, E = 1.4
                CS    EEEEE.CTSEE
                   *->diitvCDGstG<-*
                      d+i++ DG tG
  gi|1266550  4109    DTIII-DGNTG    4118

HemolysinCabind: domain 25 of 37, from 4112 to 4122: score 4.0, E = 4.7
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      +++G+ G+D++
  gi|1266550  4112    IIDGNTGDDVI    4122

HemolysinCabind: domain 26 of 37, from 4140 to 4157: score 12.3, E = 0.014
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G+ GnD + G + + t+
  gi|1266550  4140    LGNSGNDEILGSDHDETI    4157

HemolysinCabind: domain 27 of 37, from 4158 to 4175: score 10.6, E = 0.047
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG G Dt++ ++G D +
  gi|1266550  4158    IGGTGADTITANEGVDGF    4175

Arginosuc_synth: domain 1 of 1, from 4217 to 4235: score -1.2, E = 8.6
                   *->GVPVsldyvddGeklsvalelIk<-*
                      G+PVsl+    Ge+ s+ ++l++
  gi|1266550  4217    GIPVSLN---TGETESL-YNLFE    4235

DASH_Dad2: domain 1 of 1, from 4259 to 4283: score 4.2, E = 1.3
                   *->ksyqsrdededeppLPEtLVRirvd<-*
                      ++++ ++ed+  ++  EtL+Ri+ +
  gi|1266550  4259    ELDGKGQEDTYYVAMNETLPRINGG    4283

SBP_bac_9: domain 1 of 1, from 4263 to 4285: score 2.3, E = 2.5
                CS    CCHHGSHHHHHHHHHHHHHHHH-
                   *->gtsgdTYysmmkhNidtIaealk<-*
                      ++++dTYy  m+ ++ +I+ + +
  gi|1266550  4263    KGQEDTYYVAMNETLPRINGGVF    4285

CPSase_L_D2: domain 1 of 1, from 4321 to 4332: score 3.9, E = 0.79
                CS    EEEEEEECTSSE
                   *->IEyeVlrDahGN<-*
                      +Ey+Vl+Da +N
  gi|1266550  4321    VEYQVLSDAFDN    4332

DUF2525: domain 1 of 1, from 4337 to 4346: score 3.9, E = 2.7
                   *->dvDALLaAIn<-*
                      dvDALLa ++
  gi|1266550  4337    DVDALLANVE    4346

HemolysinCabind: domain 28 of 37, from 4381 to 4389: score 6.2, E = 1.1
                CS    EEESSCGEE
                   *->yGgaGnDtl<-*
                      yGg+GnD++
  gi|1266550  4381    YGGSGNDLF    4389

HemolysinCabind: domain 29 of 37, from 4401 to 4409: score 4.1, E = 4.4
                CS    EEESSCGEE
                   *->yGgaGnDtl<-*
                      yG +GnD++
  gi|1266550  4401    YGEEGNDQF    4409

HemolysinCabind: domain 30 of 37, from 4440 to 4448: score 2.6, E = 13
                CS    EEESSCGEE
                   *->yGgaGnDtl<-*
                      +Gg+G+D +
  gi|1266550  4440    HGGEGDDYF    4448

HemolysinCabind: domain 31 of 37, from 4459 to 4468: score 4.9, E = 2.6
                CS    EEEESSCGEE
                   *->LyGgaGnDtl<-*
                      L+G++G+D++
  gi|1266550  4459    LNGNSGDDIF    4468

HemolysinCabind: domain 32 of 37, from 4517 to 4536: score 1.5, E = 27
                CS    E--SSS-EEE  EESSCGEE
                   *->yGGaGnDtLy..GgaGnDtl<-*
                      +GG G D+L   G+a +Dt+
  gi|1266550  4517    DGGSGFDSLVvaGTAIDDTF    4536

VanW: domain 2 of 2, from 4533 to 4555: score 5.2, E = 0.54
                   *->dypiyIeaslddghltgeiysdg<-*
                      d ++yI+++++++ ++ ++y+ g
  gi|1266550  4533    DDTFYIYTEIENNTQVQRLYGAG    4555

Tir_receptor_C: domain 1 of 1, from 4542 to 4552: score 1.3, E = 3.5
                   *->iEsNAQAQqkY<-*
                      iE+N Q Q+ Y
  gi|1266550  4542    IENNTQVQRLY    4552

CcdA: domain 2 of 2, from 4557 to 4576: score 0.7, E = 17
                   *->NaEaiAelarlidetGsFaD<-*
                      N E iA + rli  tG+ +D
  gi|1266550  4557    NVENIANVERLILLTGAGSD    4576

HemolysinCabind: domain 33 of 37, from 4572 to 4578: score 0.7, E = 49
                CS    ESSCGEE
                   *->gaGnDtl<-*
                      gaG Dt+
  gi|1266550  4572    GAGSDTI    4578

eIF_4EBP: domain 1 of 1, from 4603 to 4613: score 0.3, E = 3.3
                   *->tGddeQFeMDI<-*
                      +G + QF +D+
  gi|1266550  4603    GGGEQQFNIDL    4613

DUF1884: domain 1 of 1, from 4623 to 4637: score 4.9, E = 0.49
                   *->MstvkRgdlirIleiiE<-*
                      M++  ++dl++ ++++E
  gi|1266550  4623    MPE--NNDLSQLKGLVE    4637

Baculo_LEF-3: domain 1 of 1, from 4652 to 4679: score 8.9, E = 0.031
                   *->tvDnnkknnyNVL.GlTKyDiDnneYefl<-*
                      tvD+n+ n  N+ +Gl+K D+++n Y+++
  gi|1266550  4652    TVDTNDENISNLFeGLLKADEEDN-YQTI    4679

TRAUB: domain 1 of 1, from 4656 to 4668: score 5.5, E = 0.4
                   *->sDeqidELFasLF<-*
                      +De+i+ LF++L+
  gi|1266550  4656    NDENISNLFEGLL    4668

Glyco_hydro_30: domain 1 of 1, from 4671 to 4693: score 3.0, E = 1.1
                CS    EEEEEEEE--EEEEE--HHHHHH
                   *->dsskkyQtiqGFGstfsDAsgaN<-*
                      d +  yQtiqGFG   s   g+N
  gi|1266550  4671    DEEDNYQTIQGFGVVTSETQGLN    4693

HemolysinCabind: domain 34 of 37, from 4722 to 4731: score 0.6, E = 51
                CS    EEEESSCGEE
                   *->LyGgaGnDtl<-*
                      ++Gg+ +D++
  gi|1266550  4722    IDGGGQDDQI    4731

DUF734: domain 1 of 2, from 4796 to 4810: score 2.9, E = 3.1
                   *->tLnislnpgdqndlnala<-*
                      +L+i ln   + d+n+++
  gi|1266550  4796    QLDIQLN---DGDDNVTV    4810

HemolysinCabind: domain 35 of 37, from 4826 to 4835: score 0.8, E = 46
                CS    EEEESSCGEE
                   *->LyGgaGnDtl<-*
                      + G +GnDt
  gi|1266550  4826    IQGLGGNDTV    4835

RIP: domain 1 of 1, from 4832 to 4855: score 0.4, E = 6.9
                CS    -EEE....EEESTT- -HHHHHHHHHHH
                   *->kptvKFTEtFtlega.tsssYstFIesl<-*
                       +tv    +++leg++t+ +Y +F+++l
  gi|1266550  4832    NDTV----EVNLEGSpTQTKYQNFLDNL    4855

YajC: domain 1 of 1, from 4923 to 4936: score 2.6, E = 6.6
                   *->vdedddtvtlEiadDgv<-*
                      +  dddtvtlE+++ +v
  gi|1266550  4923    L--DDDTVTLETGG-NV    4936

DUF1135: domain 1 of 1, from 4927 to 4959: score 0.1, E = 3.6
                   *->tvtLsCGRPsvpamAsEDYiWFqAPvtlKGFhE<-*
                      tvtL  G   + +  sE Y +F   + + G
  gi|1266550  4927    TVTLETGGNVLSSNGSENYNYFENEINFEGIEN    4959

PilS: domain 1 of 1, from 5011 to 5048: score 3.7, E = 1
                   *->ikLatklsasG..sssgitIngtsatdgngevttanAtmIt<-*
                      i+La++++ s++  ++g++ ng+++t++ ++v+  +++  t
  gi|1266550  5011    IDLANSMAGSQsiTFTGTKLNGDTVTTS-VTVDSQTVE--T    5048

PA14: domain 1 of 3, from 5016 to 5070: score 1.3, E = 6.3
                CS    ---SE.EEEEESSTTS-SEEEEE.............EESSSB--B-G
                   *->gkpGlstgyyfengkfsgdpeltrlapgindwdfdyedtdpvntfys
                      + +G+   + f+++k++gd +     ++++      +d+++v tf +
  gi|1266550  5016    SMAGS-QSITFTGTKLNGDTVT----TSVT------VDSQTVETFGD 5051

                CS GGGTTS-GGGGC--EEEEE
                   dsdkpgfgeapdnfsvrwt<-*
                    + +p f++ ++ +sv+wt
  gi|1266550  5052 ETVNPVFADFKQLVSVTWT    5070

FFD_TFG: domain 1 of 1, from 5047 to 5055: score 1.9, E = 8.5
                   *->ETFGqasvr<-*
                      ETFG++ v+
  gi|1266550  5047    ETFGDETVN    5055

Gp5_C: domain 2 of 4, from 5050 to 5070: score 0.5, E = 49
                CS    S-EEEEES S-EEEEESSEEE
                   *->GnesltVk.GnrtvtVgGnqT<-*
                      G+e+++   ++++++V  ++T
  gi|1266550  5050    GDETVNPVfADFKQLVSVTWT    5070

SfsA: domain 1 of 1, from 5072 to 5090: score 3.2, E = 1.4
                   *->svTLskdgvAvAmFPDApT<-*
                      ++TL++++vA+  FPD pT
  gi|1266550  5072    GTTLVDNIVAQEVFPDIPT    5090

PA14: domain 2 of 3, from 5142 to 5239: score 18.5, E = 7.8e-05
                CS    TS-GGGGC--EEEEEEEEEBSS-E    EEEEEETTGGGEEEEETTE
                   *->pgfgeapdnfsvrwtGylkppesG....tYtFaiasddgarlwvDGk
                      p+ +++ d+f ++w G+l +   +++  + tF+++sddg+rl +DG
  gi|1266550  5142    PASSIPTDDFAAQWKGTLNVTSPDqeavKVTFYLTSDDGSRLIIDGD 5188

                CS E  EEESS.......................XX---EEE-CT-EEEEEEE
                   l..vidnwgagkheeestiipigksfakarpstsstlyllaGgtYpirie
                    + ++d++  g h+                ++ s+t yl+ G +++i+++
  gi|1266550  5189 SdfTLDHG--GIHG---------------FSEKSQTFYLTPG-EHDIEVD 5220

                CS EE-S---SSCB--.....BEEEE-TTS
                   YfeaggggsllpekihgtslsWtspdg<-*
                   +fe+gg++          +l+++ +++
  gi|1266550  5221 FFERGGNAGI--------KLEYEIDGY    5239

DAP_epimerase: domain 2 of 3, from 5210 to 5226: score 0.3, E = 20
                CS    .CCCTTCEEEE.....EEETTT
                   *->lvsgeadikmRgWyMdifnrdg<-*
                      l++ge+di+++     +f+r+g
  gi|1266550  5210    LTPGEHDIEVD-----FFERGG    5226

DUF124: domain 1 of 1, from 5232 to 5248: score 1.5, E = 4.3
                CS    -EEEEESSSSS-EEEEE
                   *->mpyeilhgessqlLeVe<-*
                      ++yei++ +s qlL+V+
  gi|1266550  5232    LEYEIDGYQSRQLLAVT    5248

Autotransporter: domain 1 of 1, from 5275 to 5350: score 2.1, E = 3.3
                CS    ECT.........TEEEE EEEEEEEESS--- ------------.--
                   *->fslggsialgrrslppy.aglgvayefsgsr.vpvnsallaagslfg
                      +s + +i+    ++ + + g+ v+ +f+g +  p+n+         +
  gi|1266550  5275    VSGTEGIF----TTELIeNGTIVQFRFAGNIvIPDNT---------T 5308

                CS -------EEEEEEEEEEEEECTTEEEEEEEEEE.... TTEEEEE
                   vasgtpldrtalslgaGlelklgsnlslflnysaefg.sqlsdng<-*
                   ++     ++  +s+ aG++  +g+n+++ + ++++ ++ ++ +
  gi|1266550  5309 ITG---VGSKGISIYAGNNVVVGDNVTFDVAGDGTTAgAGGGSAF    5350

B1: domain 1 of 1, from 5279 to 5300: score 1.6, E = 4.1
                CS    H--EEEEEEGGGTEEEEEE-XX
                   *->nGeYtaDleDgGytinikFAGK<-*
                      +G +t +l + G  +  +FAG
  gi|1266550  5279    EGIFTTELIENGTIVQFRFAGN    5300

PmbA_TldD: domain 1 of 1, from 5284 to 5295: score 5.5, E = 0.36
                   *->tvLIenGvLkgy<-*
                      t+LIenG ++++
  gi|1266550  5284    TELIENGTIVQF    5295

NIL: domain 2 of 2, from 5289 to 5302: score 1.3, E = 11
                   *->dgkivrLtFtGesa<-*
                      +g+iv+ +F+G+ +
  gi|1266550  5289    NGTIVQFRFAGNIV    5302

PhosphMutase: domain 1 of 1, from 5315 to 5322: score 2.4, E = 1.7
                   *->KGIgryaG<-*
                      KGI++yaG
  gi|1266550  5315    KGISIYAG    5322

Gp5_C: domain 3 of 4, from 5324 to 5341: score 2.1, E = 16
                CS    EEEESS-EEEEESSEEEE
                   *->sltVkGnrtvtVgGnqTt<-*
                      +++V++n+t++V+G+ Tt
  gi|1266550  5324    NVVVGDNVTFDVAGDGTT    5341

Hexapep: domain 2 of 2, from 5324 to 5332: score 2.3, E = 20
                CS    TEEECTTEE
                   *->gviIGdnvv<-*
                      +v++Gdnv+
  gi|1266550  5324    NVVVGDNVT    5332

Collagen: domain 1 of 2, from 5387 to 5399: score 4.2, E = 2.6
                   *->GppGppGppGppG<-*
                      G +G++G  G++G
  gi|1266550  5387    GDRGSAGDDGERG    5399

Collagen: domain 2 of 2, from 5459 to 5489: score 17.0, E = 0.001
                   *->pGppGepGpPGppGppGppGppGapGapGpp<-*
                      +G pG++G  G  G++G +G +G+ G++G +
  gi|1266550  5459    NGSPGDAGDNGNNGVNGDKGDDGNNGSAGSN    5489

Fimbrial: domain 1 of 1, from 5726 to 5737: score 1.5, E = 4.7
                   *->GtvtFkGeVVda<-*
                      Gt+++ G+V da
  gi|1266550  5726    GTIKLYGSVLDA    5737

CRPV_capsid: domain 1 of 1, from 5769 to 5782: score 3.7, E = 0.74
                   *->wLvGtPpliigaaq<-*
                      +L+GtP +++gaa+
  gi|1266550  5769    QLAGTPNTVTGAAS    5782

Pertussis_S1: domain 1 of 1, from 5845 to 5857: score 1.1, E = 2.8
                CS    ---SEEEEEESS-
                   *->dPvafVYRvDlRs<-*
                      d va VYR Dl +
  gi|1266550  5845    DAVAAVYRLDLGP    5857

Pea-VEAacid: domain 1 of 2, from 5853 to 5867: score 3.9, E = 3.9
                   *->LdLtPGsHvDsYvEA<-*
                      LdL P   vD Y +
  gi|1266550  5853    LDLGPTGYVDDYFDI    5867

Glyco_hydro_32C: domain 1 of 1, from 5865 to 5887: score 1.2, E = 8.2
                CS    EEEEEETT-SSSE...........................EEEEEEE
                   *->FelasleidaesldpwetDaqdlgYnCssGGAavrGgLGPFGLlvlA
                      F++     d ++                            F+  ++
  gi|1266550  5865    FDI-----DSDVD---------------------------FDMVLF- 5878

                CS -TTSSS-EEE
                   sddlsEqTav<-*
                     +lsEqT++
  gi|1266550  5879 -MNLSEQTLL    5887

HemolysinCabind: domain 36 of 37, from 5908 to 5925: score 2.7, E = 12
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG   D+++Gg+G+ tl
  gi|1266550  5908    TGGWSQDSIFGGDGDLTL    5925

Fascin: domain 1 of 1, from 5995 to 6022: score 1.5, E = 8.6
                CS    TEEEEETTTCCBEEEEESSSCCCCESS..TCCC.EEE
                   *->angylvarkrgakLnAnaesEsavdrdvPWGvDslft<-*
                      +++y + +++ a +  na+++s ++         lft
  gi|1266550  5995    NHLYGINTEQNALVVVNADDLSQRQ---------LFT    6022

CRA: domain 1 of 1, from 6001 to 6033: score 0.1, E = 7.9
                   *->nGEPnAdPqvtAqDvtPEqPqGDDnnLvsGpEH<-*
                      n E nA   v A D    q   D+ n + G+E
  gi|1266550  6001    NTEQNALVVVNADDLSQRQLFTDEENGITGLEG    6033

Reg_prop: domain 2 of 6, from 6030 to 6052: score 4.4, E = 9.1
                   *->slpgg.vtfalledsdG.rlWigt.n<-*
                      +l g +++ ++    dG+++++++ +
  gi|1266550  6030    GLEGVsAI-SISD--DGnYVYVASaE    6052

LVIVD: domain 1 of 1, from 6032 to 6056: score 2.5, E = 7.2
                   *->gGdaqdvsVs..GNYAYVAdgdngLvI<-*
                      +G ++ +s+s++GNY+YVA +  + vI
  gi|1266550  6032    EG-VSAISISddGNYVYVASA-EDQVI    6056

WD40: domain 1 of 2, from 6033 to 6060: score 1.5, E = 12
                CS    CEEEEEEETTSSSEEEEEETTSEEEEEE
                   *->tVtcvafspdsgpllasgSrDgtikiWd<-*
                      +V+++++s d+  + + + +D  i +++
  gi|1266550  6033    GVSAISISDDGNYVYVASAEDQVISVFS    6060

APC_crr: domain 1 of 1, from 6058 to 6069: score 4.0, E = 4.8
                CS    ------.------
                   *->nfSrrSPSlSSLt<-*
                      +fSr S S+ +Lt
  gi|1266550  6058    VFSRNS-SNGNLT    6069

PA14: domain 3 of 3, from 6188 to 6255: score 38.0, E = 2.1e-10
                CS    EEEETTGGGEEEEETTEEEEESS.......................X
                   *->tFaiasddgarlwvDGklvidnwgagkheeestiipigksfakarps
                      tF++ sddg+ l++DG++v++++  g h+                ++
  gi|1266550  6188    TFHLGSDDGSILYIDGVEVLNHD--GIHG----------------FT 6216

                CS X---EEE-CT-EEEEEEEEE-S---SSCB--.....BEEEE-TTS-E
                   tsstlyllaGgtYpirieYfeaggggsllpekihgtslsWtspdgak<-*
                   t+   + l  g ++ir+eYfe+ggg+          +l +  +++++
  gi|1266550  6217 TETQTVNLTPGSHDIRVEYFERGGGAGI--------ELDYQISGQSQ    6255

tRNA_Me_trans: domain 1 of 1, from 6190 to 6216: score 3.9, E = 0.32
                   *->yLpvkkpGdIididtGevlGeHeGHiwfYT<-*
                      +L++  +G I+ id G ++ +H+G i+++T
  gi|1266550  6190    HLGSD-DGSILYID-GVEVLNHDG-IHGFT    6216

CBM_6: domain 1 of 1, from 6215 to 6232: score 1.0, E = 7
                CS    EEEEEEEEEEESEEEEEE
                   *->wqtvtanVtlptGvhdly<-*
                      ++t t +V+l++G hd++
  gi|1266550  6215    FTTETQTVNLTPGSHDIR    6232

RE_XamI: domain 1 of 1, from 6221 to 6228: score -0.3, E = 9.1
                   *->TsnLTPGa<-*
                      T+nLTPG+
  gi|1266550  6221    TVNLTPGS    6228

Pea-VEAacid: domain 2 of 2, from 6222 to 6235: score 4.8, E = 2
                   *->LdLtPGsHvDsYvEA<-*
                      ++LtPGsH D  vE
  gi|1266550  6222    VNLTPGSH-DIRVEY    6235

DAP_epimerase: domain 3 of 3, from 6224 to 6241: score 4.2, E = 1.8
                CS    .CCCTTCEEEE.....EEETTTE
                   *->lvsgeadikmRgWyMdifnrdgS<-*
                      l++g +di+++     +f+r+g+
  gi|1266550  6224    LTPGSHDIRVE-----YFERGGG    6241

Reg_prop: domain 3 of 6, from 6287 to 6311: score 0.2, E = 1.1e+02
                   *->slpgg.vtfalledsdG.rlWigt.n<-*
                      s+ + ++t  +  ++d + ++++t+n
  gi|1266550  6287    SYSNAdIT-EFSVSGDEtLIYAATsN    6311

Peptidase_A4: domain 1 of 1, from 6289 to 6307: score 1.7, E = 1.5
                CS    TTEE-EEEEEETTE.EEEEE-
                   *->ngevLTecSVSGtTtVTveYV<-*
                      ++ ++Te SVSG+   T  Y
  gi|1266550  6289    SNADITEFSVSGDE--TLIYA    6307

Flocculin: domain 2 of 2, from 6301 to 6311: score 0.3, E = 45
                   *->tETiivvrTPt<-*
                      +ET+i+  T+
  gi|1266550  6301    DETLIYAATSN    6311

DUF1410: domain 1 of 1, from 6305 to 6329: score 1.7, E = 9.3
                   *->ielvdnnnnpnnklinnndlvnknkii<-*
                      i    +  n+++ +in  dl+++++i
  gi|1266550  6305    I--YAATSNNELRVINAADLSENQIIT    6329

DUF1735: domain 1 of 3, from 6323 to 6354: score 0.9, E = 19
                   *->stvtIkAGenssdpsvlpikykteegleldknYvLP<-*
                      s+ +I  G+n+++   ++i+  t  ++++   YvL
  gi|1266550  6323    SENQIITGTNKGL---IDITDIT-VSNDDQFVYVLS    6354

SBP56: domain 1 of 1, from 6338 to 6352: score 0.4, E = 3
                   *->ITDilISLDDRFLYv<-*
                      ITDi +S DD F Yv
  gi|1266550  6338    ITDITVSNDDQFVYV    6352

Bgal_small_N: domain 1 of 1, from 6342 to 6370: score 1.2, E = 5.1
                CS    ETT ..EEEEEETTTTSEEEEEETTEE-E
                   *->eVr.gknftytFdkqtGlLeswlvnGkel<-*
                      +V++ ++f y+++ ++G+L  ++ nG++l
  gi|1266550  6342    TVSnDDQFVYVLSEDSGTLAIYQRNGTQL    6370

DUF587: domain 1 of 1, from 6415 to 6428: score 0.2, E = 9.7
                   *->LtViEIDdctndlI<-*
                      LtV E D+ t++l+
  gi|1266550  6415    LTVFEADTTTGELT    6428

Peptidase_S9_N: domain 1 of 1, from 6416 to 6433: score 0.4, E = 4
                CS    EEEEEETTTTCEEEEEEE
                   *->tiYdldlatgerellkdr<-*
                      t+++ d +tge+++++
  gi|1266550  6416    TVFEADTTTGELTFVQIL    6433

Transposase_20: domain 1 of 1, from 6431 to 6440: score 3.3, E = 3.3
                   *->eiLlsiPGvG<-*
                      +iL+s+PG +
  gi|1266550  6431    QILRSLPGLD    6440

Reg_prop: domain 4 of 6, from 6435 to 6458: score 5.1, E = 6.2
                   *->slpgg.vtfalledsdG.rlWigt.n<-*
                      slpg +++++++   dG+ +++++++
  gi|1266550  6435    SLPGLdFSSDVVS--DGnQVYVAStD    6458

HK: domain 1 of 1, from 6444 to 6454: score 0.5, E = 7
                CS    EEEEESSE..EEE
                   *->DyVSDGrrGGtyv<-*
                      D+VSDG++  +yv
  gi|1266550  6444    DVVSDGNQ--VYV    6454

GBS_Bsp-like: domain 1 of 1, from 6448 to 6462: score 2.9, E = 2.6
                   *->dGkrvGvnlttGtqv<-*
                      dG++v+v+ t+G+ +
  gi|1266550  6448    DGNQVYVASTDGFAL    6462

CheY-binding: domain 1 of 1, from 6478 to 6486: score 3.2, E = 5.4
                CS    S-GGGEEEE
                   *->IDpdQIeie<-*
                      ++p+Q++i+
  gi|1266550  6478    LEPEQLSIT    6486

DUF734: domain 2 of 2, from 6482 to 6497: score 2.9, E = 3
                   *->tLnislnpgdqndlnala<-*
                      +L+i++n  + n+l++++
  gi|1266550  6482    QLSITFN--NINELTVNT    6497

Flagellin_IN: domain 3 of 3, from 6514 to 6535: score 0.7, E = 25
                   *->tltinggggkensvadgvdislsagds<-*
                      tl+in g g+       v++++ a+++
  gi|1266550  6514    TLNINTGEGSDV-----VELEAIANTT    6535

Apc13p: domain 1 of 1, from 6656 to 6672: score 0.5, E = 9.4
                   *->nvplehLqPvnpeeEedvv<-*
                      nv+   L+ vn+e++ed+v
  gi|1266550  6656    NVT--GLDTVNTEDDEDTV    6672

Peptidase_S24: domain 1 of 1, from 6712 to 6734: score 1.4, E = 9.3
                CS    ESSSEEEEE-SSTTS...--EETSSTE
                   *->iglpgdivllpsnnanykydpiyingk<-*
                      +g+ + i+l++ n      d+i++ng+
  gi|1266550  6712    QGDTDTIFLQSANA----TDEITVNGG    6734

HemolysinCabind: domain 37 of 37, from 6730 to 6740: score 0.2, E = 68
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      t +Gg+ +Dt+
  gi|1266550  6730    TVNGGGNDDTF    6740

ART: domain 1 of 1, from 6739 to 6763: score 0.1, E = 6.6
                   *->vFqVtnfskPtqgkskiqLrSigktss<-*
                      +FqVt+ ++   ++++i+L+   ++s
  gi|1266550  6739    TFQVTG-QN-IVDGANITLNGSSQSSQ    6763

PEP-utilizers: domain 2 of 2, from 6739 to 6760: score 1.1, E = 14
                CS    EEEETTEEESTTEEEEE.CTSEE
                   *->vleiateklkdGdiitvCDGstG<-*
                      ++ + ++ + dG  it+ +Gs+
  gi|1266550  6739    TFQVTGQNIVDGANITL-NGSSQ    6760

Adeno_E3_CR1: domain 1 of 1, from 6828 to 6839: score 6.4, E = 0.15
                   *->tvyvGsNlTLvG<-*
                       ++ G+N+TLvG
  gi|1266550  6828    SINEGDNVTLVG    6839

DUF920: domain 1 of 1, from 6828 to 6840: score 2.0, E = 4
                   *->sIedgravplVgs<-*
                      sI+ g++v lVgs
  gi|1266550  6828    SINEGDNVTLVGS    6840

DUF1735: domain 2 of 3, from 6877 to 6908: score 2.1, E = 8.6
                   *->AGenssdpsvlpikykt..eegleldknYvLP<-*
                      A+   s +++ ++ ++  +++g ++d+ YvL
  gi|1266550  6877    ANSDGSVDISTTLDWDAlsSLGVSNDGVYVLT    6908

PKD: domain 1 of 8, from 6899 to 6927: score 12.1, E = 0.0034
                CS    .. SEEEEEEEEEEETTCEEEEEEEEEEE
                   *->Vt.pGtYtVtLtvsngvgsasattttvtV<-*
                      V+++G Y +tL v++++g+++  +tt+ V
  gi|1266550  6899    VSnDGVYVLTLEVTDSAGTVANDSTTLIV    6927

Cadherin: domain 1 of 6, from 6902 to 6927: score 2.5, E = 5.3
                CS    .S-B--EEE----.........S---EEEE--
                   *->ngeYeLtveAtDadpllasgggpplsstatvt<-*
                      +g Y+Lt+e+tD++      g+ + +st+ ++
  gi|1266550  6902    DGVYVLTLEVTDSA------GTVANDSTTLIV    6927

He_PIG: domain 1 of 7, from 6903 to 6916: score 4.0, E = 2.4
                   *->Gsytftvtatdgsg<-*
                      G+y  t+ +td++g
  gi|1266550  6903    GVYVLTLEVTDSAG    6916

RA: domain 1 of 2, from 6905 to 6938: score 0.8, E = 22
                   *->dsgvlrVygedgtpgt.yktilvskntTaeeVir<-*
                      +  +l V +  gt+ ++++t+ v+++  +  +i+
  gi|1266550  6905    YVLTLEVTDSAGTVANdSTTLIVNNTNPTATIIQ    6938

V-set: domain 1 of 2, from 6933 to 7018: score 2.6, E = 3.6
                CS    XEEEEEECSS.............EEEEETTSEEEEEEEEECHHSSSG
                   *->qsvvtqepprWGLLLTASLsWptsvtvaeGgsvtLpCtysGtfddss
                        ++ q  p+             s++ +eG+++ ++ + s    d+
  gi|1266550  6933    TATIIQ--PS-------------SLIFNEGDNIQFEASAS----DP- 6959

                CS SSTTCEEEEEEECEETTSEEEEEE. EESSCTEEEEETTTCEEEEETTEE
                   sssgtfsiyWyrqqppgkgpeliii.syysyystsegngtvgerfkgrvt
                    ss+t +++W + ++       i+++ ++  ++++ ++g+++  f  +
  gi|1266550  6960 -SSDTLTYSWNF-GDG-----TIVNnVLQPLHTYE-DDGDYSVIFTVKDD 7001

                CS EEEETCTTEEEEEESSCSG
                   lsgnpskgdfsLtIsnlql<-*
                    ++++   + +LtI+n+ +
  gi|1266550  7002 DTTDTK--SINLTINNVNP    7018

PKD: domain 2 of 8, from 6937 to 7013: score 51.6, E = 2.5e-15
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS.SSS
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdFGDggsp
                      +++s     +  + +g +++F+as+ +dp+  + ++ysW+FGD
  gi|1266550  6937    IQPS-----SLIFNEGDNIQFEASA-SDPS-SDTLTYSWNFGD---- 6972

                CS EEEECSS EEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
                   gttstep.nvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-*
                   gt+ ++   + HtY+     +G+Y+V  tv+++  +++++ +++t+
  gi|1266550  6973 GTIVNNVlQPLHTYED----DGDYSVIFTVKDDDTTDTKS-INLTI    7013

Cuticle_1: domain 2 of 2, from 6939 to 6952: score 6.8, E = 0.16
                   *->PSGiVtsdGkNvQl<-*
                      PS  ++  G+N+Q+
  gi|1266550  6939    PSSLIFNEGDNIQF    6952

EcoEI_R_C: domain 1 of 1, from 6989 to 7032: score 1.9, E = 3
                   *->DGePvqiyepkpddpgvpePddppeggdpeppappge.pcpsdedpe
                      DG+  +i+++k+dd     ++d+   + ++++++p ++++  d+ +
  gi|1266550  6989    DGDYSVIFTVKDDD-----TTDTKSINLTINNVNPIAkAG--DDITA 7028

                   eeee<-*
                   ee++
  gi|1266550  7029 EEGS    7032

FTP: domain 1 of 2, from 6991 to 7016: score 3.4, E = 4.5
                   *->dlkvvktttdpnGkthvRfqQtynGi<-*
                      d++v++t++d++ +       t+n++
  gi|1266550  6991    DYSVIFTVKDDDTTDTKSINLTINNV    7016

PKD: domain 3 of 8, from 7020 to 7099: score 35.4, E = 2.4e-10
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS.SSS
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdFGDggsp
                      ++a+    ++ ++++g t t+++s+ +    ++  +y Wd ++   +
  gi|1266550  7020    AKAG----DDITAEEGSTFTLSGSA-TEVG-NDTFTYAWDLDN--NG 7058

                CS EEEECSSEEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
                   gttstepnvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-*
                   +  +++++v+H++       G YtV L v++g g +++ t++vtV
  gi|1266550  7059 TYETSGQTVSHSFAD----NGLYTVGLEVTDGDGGVDTDTVNVTV    7099

DUF552: domain 1 of 1, from 7031 to 7048: score 3.8, E = 3
                   *->GavyALdGeiqrvgekIF<-*
                      G ++ L G+   vg+ +F
  gi|1266550  7031    GSTFTLSGSATEVGNDTF    7048

Avidin: domain 1 of 1, from 7039 to 7050: score 2.3, E = 3.6
                CS    GSEEEEEEEEEE
                   *->ksilvGaDtFTr<-*
                      +++ vG DtFT
  gi|1266550  7039    SATEVGNDTFTY    7050

Phage_GPD: domain 1 of 1, from 7066 to 7088: score 3.1, E = 1.2
                   *->svtHsLsrnGGyttslelergpe<-*
                      +v Hs+ +nG yt++le+  g++
  gi|1266550  7066    TVSHSFADNGLYTVGLEVTDGDG    7088

V-set: domain 2 of 2, from 7070 to 7100: score 2.3, E = 4.2
                CS    SGGGCEEEEEEEEET  SEEEEECEEEEEEE
                   *->qlsDsGtYyCavsns..nelvfgggtrLtVl<-*
                      + +D+G Y+ +   ++++++v    +++tV+
  gi|1266550  7070    SFADNGLYTVGLEVTdgDGGVDTDTVNVTVT    7100

Cadherin: domain 2 of 6, from 7074 to 7100: score 1.0, E = 15
                CS    .S-B--EEE----.........S---EEEE--EEE-
                   *->ngeYeLtveAtDadpllasgggpplsstatvtitVl<-*
                      ng Y++ +e+tD+d         +  +t tv++tV+
  gi|1266550  7074    NGLYTVGLEVTDGD---------GGVDTDTVNVTVT    7100

He_PIG: domain 2 of 7, from 7075 to 7088: score 0.4, E = 25
                   *->Gsytftvtatdgsg<-*
                      G yt+ + +tdg g
  gi|1266550  7075    GLYTVGLEVTDGDG    7088

DUF322: domain 1 of 1, from 7089 to 7103: score 4.1, E = 1.8
                   *->glkvdsVNVhVvGir<-*
                      g++ d+VNV+V ++
  gi|1266550  7089    GVDTDTVNVTVTNVA    7103

Glyco_hydro_28: domain 1 of 1, from 7095 to 7123: score -0.2, E = 8.4
                CS    EEEES.S...BS-SEEBSSS.......TT---
                   *->vditgsGkggkktssCeNvppslkGkqspasc<-*
                      v++t   ++  +t+++ N++ s+ ++++p++
  gi|1266550  7095    VNVTV--TNVAPTATIDNIT-SIRREGTPIIV    7123

Y_Y_Y: domain 1 of 3, from 7130 to 7196: score 7.8, E = 0.14
                   *->nydgpenllYrYrlegfdgeWvel.....tdystenelsytnLppGk
                      ++++++ l Y Y  + ++g+ ++  ++++ d++   ++++t+ + G+
  gi|1266550  7130    IAGDNDTLTYLY-EVFKNGDTTTFatesgIDQT---SFTFTPDDNGS 7172

                   Ytikvkakdkdgnwsyddiasltftvl<-*
                   Y+i++ + d+dg +++   +s t+tv+
  gi|1266550  7173 YEIQLTVSDEDGGETI---TSQTITVN    7196

NAPRTase: domain 1 of 1, from 7132 to 7148: score 0.2, E = 9.7
                CS    S-HHHHHHHHHHCT-ST
                   *->gDpafvdllrtvFgnge<-*
                      gD +++ +l +vF+ng+
  gi|1266550  7132    GDNDTLTYLYEVFKNGD    7148

FlgD: domain 1 of 2, from 7146 to 7192: score 0.9, E = 8
                   *->d.dgntivyldgg.gggetGsvsggvevgLpsaAdevtvtikDa.aG
                      ++d++t + +++g       ++s+++++  ++++ e ++t+ D+++G
  gi|1266550  7146    NgDTTT-FATESGiD-----QTSFTFTP-DDNGSYEIQLTVSDEdGG 7185

                   qvvnvelVrtid<-*
                   ++     + + +
  gi|1266550  7186 ET-----ITSQT    7192

PKD: domain 4 of 8, from 7160 to 7195: score 21.3, E = 5.1e-06
                CS    SSEEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
                   *->epnvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-*
                      ++++t t        G+Y ++Ltvs++ g  + t+ t+tV
  gi|1266550  7160    QTSFTFTPDD----NGSYEIQLTVSDEDGGETITSQTITV    7195

Glyco_hydro_2: domain 1 of 1, from 7165 to 7196: score 3.9, E = 0.42
                CS    .....S-C.TEEEEEEEECTTEEEE.......EEEECS.C
                   *->YEPedsekvaklevtLsDkeGkevvHsAiDHLAsgtgtvs<-*
                      + P+d++  + + +t+sD++G e++       +s+t tv+
  gi|1266550  7165    FTPDDNGS-YEIQLTVSDEDGGETI-------TSQTITVN    7196

He_PIG: domain 3 of 7, from 7166 to 7184: score 4.6, E = 1.6
                   *->tPtptvqpGsytftvtatdgsg<-*
                      tP+ +   Gsy++ +t++d  g
  gi|1266550  7166    TPDDN---GSYEIQLTVSDEDG    7184

Cadherin: domain 3 of 6, from 7170 to 7196: score 3.9, E = 2.1
                CS    .S-B--EEE----.........S---EEEE--
                   *->ngeYeLtveAtDadpllasgggpplsstatvt<-*
                      ng Ye+ + ++D+d     gg++  s+t tv+
  gi|1266550  7170    NGSYEIQLTVSDED-----GGETITSQTITVN    7196

MED14: domain 1 of 1, from 7173 to 7183: score 3.4, E = 1.4
                   *->FEvsLTigddd<-*
                      +E++LT++d+d
  gi|1266550  7173    YEIQLTVSDED    7183

Pollen_allerg_1: domain 1 of 2, from 7191 to 7200: score 2.0, E = 5.7
                CS    .EEEEEEEE-
                   *->rtlvaknViP<-*
                      +t++ +nV+P
  gi|1266550  7191    QTITVNNVAP    7200

I-set: domain 1 of 1, from 7200 to 7224: score 3.7, E = 2.4
                CS    -EEEE--EEEEEETTCEEEEEEEEE
                   *->PkFtqkpkdveVqeGesarFeCkvt<-*
                      P++ +   +  ++eG sa+F+ ++t
  gi|1266550  7200    PTINTLTIPTNISEGVSAEFTATAT    7224

Peptidase_C25_C: domain 1 of 1, from 7200 to 7212: score 2.0, E = 4.8
                CS    -B---EE--SEEE
                   *->PtkmqvTaPAsip<-*
                      Pt ++ T P +i+
  gi|1266550  7200    PTINTLTIPTNIS    7212

PKD: domain 5 of 8, from 7207 to 7281: score 63.2, E = 6.8e-19
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS.SSS
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdFGDggsp
                      ++++        + +g++++Fta++ +d    + ++y+W+FGD   +
  gi|1266550  7207    IPTN--------ISEGVSAEFTATA-TDVG-DDTLTYTWNFGD---G 7240

                CS EEEECSSEEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
                   gttstepnvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-*
                   +    +++v H Y       G+YtVtLtv+++ g +  +t+++tV
  gi|1266550  7241 SDAVEGQTVIHQYDD----NGSYTVTLTVTDEDGGTRIQTRSITV    7281

ig: domain 1 of 1, from 7214 to 7272: score 1.8, E = 8.8
                CS    TSEEEEEEEEE ESSSSSSEEEEEETTC-SS-CEEEEEEETSSCCCE
                   *->GesvtLtCsvs.sgppqvdvtWfkegkgleessetgtdenrvssqts
                      G s+++t ++ + g++  ++tW +++++   + +t+++++ ++++++
  gi|1266550  7214    GVSAEFTATATdVGDDTLTYTWNFGDGSDAVEGQTVIHQYDDNGSYT 7260

                CS EEEEEESSE-GGG-EE
                   tslLtisnvteedsGt<-*
                      +t++ ++ ed+Gt
  gi|1266550  7261 ---VTLTVTD-EDGGT    7272

FlgD: domain 2 of 2, from 7253 to 7280: score 1.1, E = 7.1
                   *->gLpsaAdevtvtikDa.aGqvvnvelVrtid<-*
                      + ++++ +vt+t++D+++G+     + r+i+
  gi|1266550  7253    YDDNGSYTVTLTVTDEdGGTR---IQTRSIT    7280

DUF1869: domain 1 of 1, from 7254 to 7264: score -0.5, E = 6.9
                   *->nnkatyllTVT<-*
                        ++ y++T T
  gi|1266550  7254    DDNGSYTVTLT    7264

Cadherin: domain 4 of 6, from 7256 to 7282: score 3.4, E = 2.9
                CS    .S-B--EEE----.........S---EEEE--
                   *->ngeYeLtveAtDadpllasgggpplsstatvt<-*
                      ng Y++t+ +tD+d     gg++ ++   tv+
  gi|1266550  7256    NGSYTVTLTVTDED-----GGTRIQTRSITVN    7282

He_PIG: domain 4 of 7, from 7257 to 7270: score 9.1, E = 0.086
                   *->Gsytftvtatdgsg<-*
                      Gsyt+t+t+td  g
  gi|1266550  7257    GSYTVTLTVTDEDG    7270

Y_Y_Y: domain 2 of 3, from 7257 to 7282: score 0.3, E = 23
                   *->GkYtikvkakdkdgnwsyddiasltftvl<-*
                      G+Yt+++ ++d+dg + +   ++ ++tv+
  gi|1266550  7257    GSYTVTLTVTDEDGGTRI---QTRSITVN    7282

FTP: domain 2 of 2, from 7258 to 7272: score 0.2, E = 36
                   *->dlkvvktttdpnGkt<-*
                      +++v+ t+td++G t
  gi|1266550  7258    SYTVTLTVTDEDGGT    7272

RA: domain 2 of 2, from 7259 to 7287: score 2.4, E = 8.2
                   *->dsgvlrVygedgtpgt.yktilvskntTa<-*
                      ++ +l V +edg  ++++++i v++ + +
  gi|1266550  7259    YTVTLTVTDEDGGTRIqTRSITVNNASPV    7287

SoxZ: domain 1 of 2, from 7260 to 7281: score 3.2, E = 2
                CS    .EEEEEEETTS-EEEEEEEE--
                   *->elkfsWtDnkGssetaeakItv<-*
                      +++++ tD++G+++  + +Itv
  gi|1266550  7260    TVTLTVTDEDGGTRIQTRSITV    7281

DUF11: domain 2 of 2, from 7262 to 7288: score 1.4, E = 17
                   *->ttgatddlppnnnanatvtvtpvadlv<-*
                      t ++td++ +++ ++++ tv++ +++v
  gi|1266550  7262    TLTVTDEDGGTRIQTRSITVNNASPVV    7288

PKD: domain 6 of 8, from 7288 to 7367: score 46.5, E = 9.7e-14
                CS    EESS. ....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS.SS
                   *->vsasa.veegpsvvalgetVtFtassSydpdpGspvsysWdFGDggs
                      v+a+ ++++++     g+tV F++s S +++  +  ++ WdFGD
  gi|1266550  7288    VNAGLdQTSDE-----GATVAFNGSYSDQGS-LDTHTVVWDFGD--- 7325

                CS SEEEECSSEEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
                   pgttstepnvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-*
                   + +++ + ++tHtY++    +G Yt+tLtv+++ g++++ ++ vtV
  gi|1266550  7326 GNSSTDSLTPTHTYTQ----DGVYTATLTVTDNDGASNSDQIVVTV    7367

WD40: domain 2 of 2, from 7312 to 7322: score 0.4, E = 28
                CS    EETTSEEEEEE
                   *->gSrDgtikiWd<-*
                      gS D +  +Wd
  gi|1266550  7312    GSLDTHTVVWD    7322

He_PIG: domain 5 of 7, from 7338 to 7356: score 7.0, E = 0.33
                   *->tptvqpGsytftvtatdgsg<-*
                      t+t q G+yt+t+t+td  g
  gi|1266550  7338    TYT-QDGVYTATLTVTDNDG    7356

Cadherin: domain 5 of 6, from 7342 to 7368: score 0.6, E = 18
                CS    .S-B--EEE----.........S---EEEE--EEE-
                   *->ngeYeLtveAtDadpllasgggpplsstatvtitVl<-*
                      +g Y+ t+ +tD+d         + s+  ++++tV
  gi|1266550  7342    DGVYTATLTVTDND---------GASNSDQIVVTVN    7368

SCPU: domain 1 of 2, from 7343 to 7352: score 1.0, E = 17
                   *->GtYqDTlsVt<-*
                      G+Y+ Tl+Vt
  gi|1266550  7343    GVYTATLTVT    7352

COPI_assoc: domain 1 of 1, from 7372 to 7389: score 1.1, E = 8.2
                   *->dadlgaGDdDddDdddeV<-*
                      ++ ++aGD+  +D+ d V
  gi|1266550  7372    PQNVNAGDNQLIDEGDSV    7389

PKD: domain 7 of 8, from 7375 to 7454: score 43.7, E = 6.9e-13
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEE   EE-SS.
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsys...WdFGDg
                      v+a+    + + + +g +VtFt+s    +d + ++  ++  WdFGD
  gi|1266550  7375    VNAG----DNQLIDEGDSVTFTGSF---DD-PGILDTHtivWDFGD- 7412

                CS SSSEEEECSSEEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
                   gspgttstepnvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-
                     + +t++  ++tHtY++     G+YtVtLt +++ g+ +  t++vtV
  gi|1266550  7413 --GNSTTGTLTPTHTYTQ----NGDYTVTLTITDEQGAYANDTLSVTV   7454

                CS
                   *

  gi|1266550     -   -

ATP-synt_ab_N: domain 1 of 1, from 7383 to 7393: score 5.6, E = 0.47
                CS    G-TTTEEEEEE
                   *->lkrGdeVkdTG<-*
                      +++Gd+V++TG
  gi|1266550  7383    IDEGDSVTFTG    7393

Herpes_ICP4_C: domain 1 of 1, from 7406 to 7418: score -0.5, E = 4.9
                   *->vtWdsgfGgsaeTv<-*
                      ++Wd+g+G  ++T
  gi|1266550  7406    IVWDFGDGN-STTG    7418

He_PIG: domain 6 of 7, from 7414 to 7443: score 9.0, E = 0.092
                   *->dsstGritGtPtptvqpGsytftvtatdgsg<-*
                      +s+tG++t t t+t q G yt+t+t+td  g
  gi|1266550  7414    NSTTGTLTPTHTYT-QNGDYTVTLTITDEQG    7443

Telo_bind: domain 1 of 1, from 7428 to 7461: score 4.0, E = 1.8
                CS    TTSEEEEEEEEEETTSSCCSSCCGSEEEEEEESSCCC
                   *->ngkdytctlkIvDptlvtkggksdgltvklfskkfed<-*
                       + dyt+tl+I+D  ++      d+l+v++ + + ++
  gi|1266550  7428    QNGDYTVTLTITDEQGAYA---NDTLSVTVTALSVPQ    7461

Cadherin: domain 6 of 6, from 7429 to 7455: score 3.2, E = 3.2
                CS    .S-B--EEE----.........S---EEEE--EEE-
                   *->ngeYeLtveAtDadpllasgggpplsstatvtitVl<-*
                      ng Y++t+  tD+         ++ ++  t+ +tV+
  gi|1266550  7429    NGDYTVTLTITDE---------QGAYANDTLSVTVT    7455

Big_3: domain 1 of 1, from 7430 to 7454: score 5.3, E = 1.5
                   *->GtytVTytYkGq...pvtatftVtV<-*
                      G+ytVT+t+   ++  ++ t+ VtV
  gi|1266550  7430    GDYTVTLTITDEqgaYANDTLSVTV    7454

SCPU: domain 2 of 2, from 7443 to 7453: score 2.8, E = 5.1
                   *->GtYq.DTlsVt<-*
                      G Y++DTlsVt
  gi|1266550  7443    GAYAnDTLSVT    7453

PKD: domain 8 of 8, from 7491 to 7543: score 50.3, E = 6.7e-15
                CS    ECEEEEE-SS.SSSEEEECSSEEEEEESS....SEEEEEEEEEEETT
                   *->pvsysWdFGDggspgttstepnvtHtYskgsVtpGtYtVtLtvsngv
                      +++ +W+FGD   +++ts+  +++HtYs+    +G YtV+Ltv++++
  gi|1266550  7491    NYTIEWNFGD---GSSTSGTLTPNHTYSS----DGIYTVRLTVTDNN 7530

                CS CEEEEEE EEEEE
                   gsasatt.ttvtV<-*
                   ++ s ++++tv+V
  gi|1266550  7531 SLQSNSDtLTVYV    7543

He_PIG: domain 7 of 7, from 7505 to 7531: score 9.1, E = 0.083
                   *->tGtPtptvqp....Gsytftvtatdgsg<-*
                      +Gt tp+ ++ +++G yt+++t+td
  gi|1266550  7505    SGTLTPN-HTyssdGIYTVRLTVTDNNS    7531

Y_Y_Y: domain 3 of 3, from 7513 to 7544: score 2.8, E = 4.1
                   *->tnLppGkYtikvkakdkdgnwsyddiasltftvl<-*
                      t+ + G Yt+++ ++d+++  s+    +lt+ v+
  gi|1266550  7513    TYSSDGIYTVRLTVTDNNSLQSNS--DTLTVYVN    7544

HYR: domain 1 of 1, from 7518 to 7543: score 2.4, E = 4.3
                   *->GEettVtYtatDnaGNeAdsCtFtVtV<-*
                      G ++tV+ t+tDn+  + +s t+tV V
  gi|1266550  7518    G-IYTVRLTVTDNNSLQSNSDTLTVYV    7543

Pollen_allerg_1: domain 2 of 2, from 7532 to 7548: score 1.1, E = 11
                CS    EEETTS-.EEEEEEEE-
                   *->vTsesdgrtlvaknViP<-*
                      ++s sd  t+  +nV+P
  gi|1266550  7532    LQSNSDTLTVYVNNVAP    7548

DUF1735: domain 3 of 3, from 7543 to 7567: score 0.2, E = 29
                   *->enssdpsvlpikykteegleldknYvLP<-*
                      +n+ +ps l+i+ ++  +l+ +++Y L
  gi|1266550  7543    VNNVAPS-LTISGDD--SLNEGGTYTLT    7567

Gp5_C: domain 4 of 4, from 7554 to 7567: score 0.6, E = 47
                CS    S-EEEEESS-EEEE
                   *->GnesltVkGnrtvt<-*
                      G++sl+ +G++t+t
  gi|1266550  7554    GDDSLNEGGTYTLT    7567

MdoG: domain 1 of 1, from 7574 to 7588: score -1.2, E = 5.4
                CS    TT-EEEEEEEEEEES-
                   *->pGkElrFsYrLnWgrd<-*
                      pG+E + sY++nWg d
  gi|1266550  7574    PGQETLISYTINWG-D    7588

Glyco_hydro_18: domain 1 of 2, from 7577 to 7608: score 2.3, E = 1.1
                CS    CEEEEEEEGGGCGSSGGCGG..SCGGGSHTHHHHGTTESEE
                   *->krivgYftqwgnygrgrleGakflvddidpsgkaAdklTHi<-*
                       +++ Y  +wg++++        l+++++++      lTHi
  gi|1266550  7577    ETLISYTINWGDGNIE-----TILAENLNSDR----TLTHI    7608

VWA_N: domain 1 of 1, from 7583 to 7607: score 2.0, E = 2.6
                   *->ainWseakFLdsVFreNreeDPsLtW<-*
                      +inW++   ++ +++eN+ +D +Lt+
  gi|1266550  7583    TINWGDG-NIETILAENLNSDRTLTH    7607

EFP: domain 1 of 2, from 7602 to 7611: score 1.2, E = 17
                   *->rrtmqYLYkD<-*
                      +rt+++ Y+D
  gi|1266550  7602    DRTLTHIYND    7611

DUF1539: domain 1 of 1, from 7605 to 7619: score 1.7, E = 6.6
                   *->Lnaiynqndegpnqv<-*
                      L++iyn  d++p ++
  gi|1266550  7605    LTHIYNDEDSNPTIL    7619

Galactosyl_T_2: domain 1 of 1, from 7635 to 7645: score -0.5, E = 9.3
                   *->tnITVdigalpe<-*
                      ++ITV+++ +p+
  gi|1266550  7635    KSITVNNV-APG    7645

tRNA-synt_1d: domain 1 of 1, from 7676 to 7682: score -0.5, E = 9.3
                   *->tdydfDl<-*
                      t+y++D+
  gi|1266550  7676    TNYIIDW    7682

DUF24: domain 1 of 2, from 7681 to 7691: score 0.4, E = 11
                   *->kWGeeyleped<-*
                      +WG+ ++e++
  gi|1266550  7681    DWGDGNIETIL    7691

Reg_prop: domain 5 of 6, from 7694 to 7719: score 1.7, E = 45
                   *->slpgg..vtfalledsdG.rlWigt.n<-*
                      +l++ +++t  ++ed+ +++++++ ++
  gi|1266550  7694    DLNSDrtIT-HIYEDDSNpTILVSLtD    7719

CARDB: domain 1 of 1, from 7738 to 7764: score 1.6, E = 9.4
                   *->lPDLivessslspsepyageentitv.tVkN<-*
                      +PDL++    l+ + + +g+ +t+t++tV N
  gi|1266550  7738    APDLEI----LGDEMVDEGSIYTLTLgTVNN    7764

Glyco_hydro_18: domain 2 of 2, from 7768 to 7799: score 2.4, E = 1
                CS    CEEEEEEEGGGCGSSGGCGG..SCGGGSHTHHHHGTTESEE
                   *->krivgYftqwgnygrgrleGakflvddidpsgkaAdklTHi<-*
                       +++ Y  +wg++++        lv+d++++       THi
  gi|1266550  7768    TTLISYTINWGDGNIE-----TILVEDLNSDR----TITHI    7799

Reg_prop: domain 6 of 6, from 7789 to 7814: score 1.7, E = 45
                   *->slpgg..vtfalledsdG.rlWigt.n<-*
                      +l++ +++t  ++ed+ +++++++ ++
  gi|1266550  7789    DLNSDrtIT-HIYEDDSNpTILVSLtD    7814

DUF24: domain 2 of 2, from 7871 to 7881: score 0.4, E = 11
                   *->kWGeeyleped<-*
                      +WG+ ++e++
  gi|1266550  7871    DWGDGNIETIL    7881

MucBP: domain 1 of 1, from 7883 to 7923: score 1.9, E = 9.1
                   *->ltktvtvTvhYvDedGnelapdvvQtvtFtRtiyRgtvDkvTGkvti
                      +    ++Tv++v+ +Gn  +               ++   +T    +
  gi|1266550  7883    EEINSDRTVTHVYNNGNSNP---------------AILVSLT---DE 7911

                   kytgdWtagdtYaavtsptIk<-*
                           ++tY +v s+ I+
  gi|1266550  7912 --------DGTY-NVASKLIT    7923

EFP: domain 2 of 2, from 7888 to 7900: score 5.5, E = 0.98
                   *->rrtmqYLYkDGde<-*
                      +rt+++ Y++G++
  gi|1266550  7888    DRTVTHVYNNGNS    7900

SoxZ: domain 2 of 2, from 7906 to 7924: score 3.8, E = 1.3
                CS    EEEEETTS-EEEEEEEE--
                   *->fsWtDnkGssetaeakItv<-*
                      +s+tD++G+   a++ Itv
  gi|1266550  7906    VSLTDEDGTYNVASKLITV    7924

LEF-8: domain 1 of 1, from 7908 to 7929: score 0.8, E = 1.3
                   *->lpdnsGefkVlsSLlhCNNvIm<-*
                      l d+ G ++V s L+  NN+I
  gi|1266550  7908    LTDEDGTYNVASKLITVNNIIP    7929

CoA_trans: domain 1 of 1, from 7923 to 7939: score 1.6, E = 4.2
                CS    GGCEBCCGGHCCEEETT
                   *->pltvhtPGvlvdrvvea<-*
                      +++ ++P +++d++v
  gi|1266550  7923    TVNNIIPDISIDDIVID    7939

Calx-beta: domain 2 of 2, from 7961 to 8003: score 40.7, E = 2.3e-10
                   *->tVtVsyrTeDGTAtaGPgsDYeptegtiLtFgPgedtekcinvtiiD
                      tVt +++T DGTA+aG   DY+ + g+ L+F Pg+   ++++v++++
  gi|1266550  7961    TVTLDFTTLDGTAKAG--LDYTQQQGQ-LIFTPGQ-ITQTVSVPLLE 8003

                   <-*

  gi|1266550     -     -

COesterase: domain 1 of 1, from 7975 to 8016: score -1.0, E = 3.9
                CS    XXXXXXXXXXXXXX--EEECTTTSSTT.EEEETT...EEEE-EEEEE
                   *->mllllllllllllflavtataptspedpvVeTsyvtgGkvrGlrvkv
                       +l ++++ + l f++++ t+       +V  ++  + ++rG
  gi|1266550  7975    AGLDYTQQQGQLIFTPGQITQ-------TVSVPL--LEPLRG----D 8008

                CS STCSEEEE
                   dggnkpvy<-*
                    +g+++v+
  gi|1266550  8009 INGDGEVN    8016

DUF2135: domain 1 of 1, from 7987 to 8001: score 4.7, E = 1.7
                   *->ivtPnEkretfvvpl<-*
                      i+tP + ++t++vpl
  gi|1266550  7987    IFTPGQITQTVSVPL    8001

Dockerin_1: domain 4 of 5, from 8008 to 8023: score 13.9, E = 0.0038
                CS    -TT-SS--SHHHHHHH
                   *->DvNgDGkVnalDlall<-*
                      D+NgDG Vn +D+ ll
  gi|1266550  8008    DINGDGEVNRTDFDLL    8023

efhand: domain 1 of 1, from 8008 to 8027: score 4.3, E = 5
                CS    TTTSSSEEHHHHHHHHHHHH
                   *->DkDgDGkIsfeEfkaalkkl<-*
                      D +gDG++++ +f  ++++
  gi|1266550  8008    DINGDGEVNRTDFDLLVATR    8027

Dockerin_1: domain 5 of 5, from 8068 to 8083: score 11.4, E = 0.022
                CS    -TT-SS--SHHHHHHH
                   *->DvNgDGkVnalDlall<-*
                      D+N+DG ++ lD+ ll
  gi|1266550  8068    DLNNDGEITLLDIRLL    8083

//