hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 126724419.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|126724419|ref|ZP_01740262.1|
Accession: [none]
Description: RTX toxins and related Ca2+-binding protein [Rhodobacterales bacterium HTCC2150]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
Planc_extracel Planctomycete extracellular 15.8 0.00011 1
PagL Lipid A 3-O-deacylase (PagL) 10.1 0.032 1
Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-rea 4.0 0.11 1
DUF1499 Protein of unknown function (DUF1499) 4.7 0.79 1
Cobalamin_bind Eukaryotic cobalamin-binding protein 3.0 0.86 1
Securin Securin sister-chromatid separation i 2.4 1.2 1
PTS_EIIA_2 Phosphoenolpyruvate-dependent sugar p 4.3 1.3 1
FMN_bind FMN-binding domain 4.3 1.3 1
FlhE Flagellar protein FlhE 2.7 1.6 1
DUF1768 Domain of unknown function (DUF1768) 2.7 1.9 1
IL6Ra-bind Interleukin-6 receptor alpha chain, b 2.3 1.9 1
Thioredoxin Thioredoxin 3.3 1.9 1
UBA_2 Ubiquitin associated domain (UBA) 3.2 2.1 1
DUF520 Protein of unknown function (DUF520) 1.0 2.3 1
DUF734 Protein of unknown function (DUF734) 3.3 2.4 1
RanBPM_CRA Ran binding protein in the microtubul 3.0 2.6 1
Toluene_X Outer membrane protein transport prot 0.9 2.6 1
Corona_NS3b ORF3b coronavirus protein 0.5 2.6 1
DUF1280 Protein of unknown function (DUF1280) 2.4 2.8 1
ETF Electron transfer flavoprotein domain 2.8 3 1
Med12 Transcription mediator subunit Med12 2.4 3.1 1
RTBV_P12 Rice tungro bacilliform virus P12 pro 2.0 3.5 1
CM1 Influenza C virus M1 protein 0.0 3.6 1
THUMP THUMP domain 2.6 4.2 1
Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) 0.7 4.2 1
TOBE_2 TOBE domain 3.1 4.2 1
DUF2108 Predicted membrane protein (DUF2108) 3.1 4.3 1
Autotransporter Autotransporter beta-domain 1.6 4.4 1
YugN YugN-like family 2.5 4.8 1
Phage_attach Phage Head-Tail Attachment -0.3 5.1 1
DUF1999 Protein of unknown function (DUF1999) 1.1 5.2 1
PHB_acc_N PHB/PHA accumulation regulator DNA-bi 2.2 5.3 1
S4 S4 domain 3.8 5.3 1
HTH_10 HTH DNA binding domain 2.7 5.4 1
MmoB_DmpM MmoB/DmpM family 2.5 5.4 1
DUF1488 Protein of unknown function (DUF1488) 2.7 5.7 1
CdhD CO dehydrogenase/acetyl-CoA synthase 0.5 5.8 1
DUF1212 Protein of unknown function (DUF1212) 0.7 5.8 1
DmpG_comm DmpG-like communication domain 2.3 5.8 1
DUF818 Chlamydia CHLPS protein (DUF818) -0.4 6 1
Ssu72 Ssu72-like protein -0.2 6.1 1
DUF2419 Protein of unknown function (DUF2419) -1.6 6.2 1
MukE MukE-like family -0.5 6.7 1
DUF88 Protein of unknown function DUF88 1.6 7.4 1
DUF918 Nucleopolyhedrovirus protein of unkno 1.5 7.5 1
GCV_T Aminomethyltransferase folate-binding 0.7 7.5 1
DUF1323 Protein of unknown function (DUF1323) 1.4 7.6 1
DUF1522 Domain of Unknown Function (DUF1522) 1.2 7.8 1
DcuA_DcuB Anaerobic c4-dicarboxylate membrane t -0.4 7.9 1
DUF1465 Protein of unknown function (DUF1465) 1.0 8 1
SurE Survival protein SurE 0.2 8.1 1
Strep_SA_rep Streptococcal surface antigen repeat 2.9 8.1 1
DUF1419 Protein of unknown function (DUF1419) 0.3 8.1 1
DUF2512 Protein of unknown function (DUF2512) 2.2 8.6 1
CorC_HlyC Transporter associated domain 2.0 8.6 1
DUF979 Protein of unknown function (DUF979) -0.4 9.3 1
PEN-2 Presenilin enhancer-2 subunit of gamm 0.2 9.3 1
NodA Nodulation protein A (NodA) -0.2 9.4 1
DUF1321 Protein of unknown function (DUF1321) -0.0 9.4 1
GCV_T_C Glycine cleavage T-protein C-terminal 1.2 9.4 1
DUF472 Family of unknown function (DUF472) 0.8 9.5 1
RNA_capsid Calicivirus putative RNA polymerase/c -1.1 9.5 1
Entericidin Entericidin EcnA/B family 2.7 9.6 1
DUF2328 Uncharacterized protein conserved in -0.4 9.8 1
Corona_NS4 Coronavirus non-structural protein NS 0.7 9.9 1
SIN1 Stress-activated map kinase interacti -1.2 10 1
MspA MspA 0.6 10 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
DUF2512 1/1 1 27 [. 119 147 .] 2.2 8.6
Planc_extracel 1/1 7 31 .. 4 28 .] 15.8 0.00011
DUF2328 1/1 18 33 .. 173 188 .] -0.4 9.8
THUMP 1/1 20 35 .. 82 97 .] 2.6 4.2
UBA_2 1/1 152 169 .. 1 18 [. 3.2 2.1
ETF 1/1 155 196 .. 87 126 .. 2.8 3
DUF1419 1/1 175 186 .. 100 111 .] 0.3 8.1
CdhD 1/1 189 208 .. 421 440 .] 0.5 5.8
CorC_HlyC 1/1 232 257 .. 1 26 [. 2.0 8.6
PTS_EIIA_2 1/1 240 256 .. 137 153 .] 4.3 1.3
DUF1488 1/1 262 290 .. 1 29 [. 2.7 5.7
PEN-2 1/1 263 285 .. 74 101 .] 0.2 9.3
CM1 1/1 383 393 .. 178 188 .. 0.0 3.6
DUF2108 1/1 439 452 .. 38 51 .. 3.1 4.3
HTH_10 1/1 463 478 .. 1 16 [. 2.7 5.4
DUF1465 1/1 467 475 .. 152 160 .] 1.0 8
Thioredoxin 1/1 489 502 .. 95 109 .] 3.3 1.9
FMN_bind 1/1 566 592 .. 1 31 [. 4.3 1.3
DUF1212 1/1 573 594 .. 55 76 .. 0.7 5.8
Corona_NS4 1/1 602 610 .. 1 11 [. 0.7 9.9
Peptidase_S13 1/1 674 689 .. 384 399 .] 0.7 4.2
Ssu72 1/1 717 731 .. 93 109 .. -0.2 6.1
Strep_67kDa_ant 1/1 718 740 .. 223 245 .. 4.0 0.11
Toluene_X 1/1 729 748 .. 493 513 .] 0.9 2.6
IL6Ra-bind 1/1 840 857 .. 88 106 .] 2.3 1.9
Med12 1/1 887 906 .. 9 29 .. 2.4 3.1
MukE 1/1 952 968 .. 193 209 .. -0.5 6.7
DUF1999 1/1 974 988 .. 154 168 .] 1.1 5.2
DUF1499 1/1 995 1012 .. 1 18 [. 4.7 0.79
Corona_NS3b 1/1 1095 1114 .. 225 244 .] 0.5 2.6
Securin 1/1 1137 1158 .. 1 20 [. 2.4 1.2
DUF1321 1/1 1138 1146 .. 153 161 .] -0.0 9.4
DmpG_comm 1/1 1157 1170 .. 1 14 [. 2.3 5.8
NodA 1/1 1171 1182 .. 185 196 .] -0.2 9.4
SIN1 1/1 1173 1185 .. 1 15 [. -1.2 10
RanBPM_CRA 1/1 1208 1229 .. 96 120 .] 3.0 2.6
RTBV_P12 1/1 1240 1264 .. 1 28 [. 2.0 3.5
Autotransporter 1/1 1326 1402 .. 216 296 .] 1.6 4.4
DUF979 1/1 1347 1361 .. 166 180 .. -0.4 9.3
GCV_T_C 1/1 1348 1359 .. 1 12 [. 1.2 9.4
TOBE_2 1/1 1467 1482 .. 1 14 [. 3.1 4.2
DUF520 1/1 1507 1514 .. 126 133 .. 1.0 2.3
DUF734 1/1 1527 1545 .. 64 83 .] 3.3 2.4
MmoB_DmpM 1/1 1527 1543 .. 75 89 .] 2.5 5.4
MspA 1/1 1536 1573 .. 91 128 .. 0.6 10
SurE 1/1 1607 1614 .. 1 8 [. 0.2 8.1
DUF918 1/1 1614 1623 .. 149 158 .] 1.5 7.5
Phage_attach 1/1 1641 1657 .. 1 17 [. -0.3 5.1
Cobalamin_bind 1/1 1667 1701 .. 312 351 .] 3.0 0.86
DUF1280 1/1 1713 1739 .. 200 226 .] 2.4 2.8
Strep_SA_rep 1/1 1716 1731 .. 1 16 [. 2.9 8.1
YugN 1/1 1759 1771 .. 122 134 .] 2.5 4.8
S4 1/1 1772 1790 .. 30 48 .] 3.8 5.3
DUF1768 1/1 1774 1786 .. 164 176 .] 2.7 1.9
GCV_T 1/1 1804 1812 .. 1 9 [. 0.7 7.5
PagL 1/1 1817 1854 .. 1 38 [. 10.1 0.032
DcuA_DcuB 1/1 1861 1875 .. 314 328 .. -0.4 7.9
DUF1522 1/1 1910 1929 .. 97 118 .] 1.2 7.8
RNA_capsid 1/1 1912 1927 .. 1 17 [. -1.1 9.5
DUF2419 1/1 2109 2129 .. 1 30 [. -1.6 6.2
PHB_acc_N 1/1 2120 2134 .. 18 32 .. 2.2 5.3
DUF472 1/1 2143 2154 .. 71 82 .] 0.8 9.5
Entericidin 1/1 2179 2191 .. 31 43 .] 2.7 9.6
DUF88 1/1 2189 2196 .. 1 8 [. 1.6 7.4
DUF818 1/1 2290 2312 .. 350 372 .] -0.4 6
FlhE 1/1 2329 2341 .. 127 139 .] 2.7 1.6
DUF1323 1/1 2354 2369 .. 1 16 [. 1.4 7.6
Alignments of top-scoring domains:
DUF2512: domain 1 of 1, from 1 to 27: score 2.2, E = 8.6
*->lrnvlpeqeenenrskagglryqTEfseE<-*
+++++ ++++ + s+ag+++ + E+ eE
gi|1267244 1 MNKIF--EKRKKTNSSAGRRKIAIEPLEE 27
Planc_extracel: domain 1 of 1, from 7 to 31: score 15.8, E = 0.00011
*->rrrrrrsrrrrRRLrlEsLEsRrLL<-*
+r++++s+++rR+ ++E+LE R LL
gi|1267244 7 KRKKTNSSAGRRKIAIEPLEERILL 31
DUF2328: domain 1 of 1, from 18 to 33: score -0.4, E = 9.8
*->gtisveiteeavvlsa<-*
++i++e+ ee+++ls+
gi|1267244 18 RKIAIEPLEERILLSV 33
THUMP: domain 1 of 1, from 20 to 35: score 2.6, E = 4.2
CS EEEEEETTEEEEES--
*->vhvEiikdkayisidr<-*
+ +E++++++++s+d+
gi|1267244 20 IAIEPLEERILLSVDL 35
UBA_2: domain 1 of 1, from 152 to 169: score 3.2, E = 2.1
*->iDedvvskLSkTMGYdkD<-*
+D+ ++s+L MG d D
gi|1267244 152 ADDPLISALARSMGPDSD 169
ETF: domain 1 of 1, from 155 to 196: score 2.8, E = 3
CS HHHHHHHH C.EEEECSCHCCTT-S-HHHHHHHCCTEEEEE
*->aaLaalik......dplvLaGatsigkdtgQlaPrlAalLgaglvt<
++++al+++ ++++d l L + +++ l+ rlA+l ga +++
gi|1267244 155 PLISALARsmgpdsD-LMLYACDLADGG---LPQRLAVLTGADVAA 196
CS
-*
gi|1267244 - -
DUF1419: domain 1 of 1, from 175 to 186: score 0.3, E = 8.1
*->CDLsDkgSPerM<-*
CDL+D g P r
gi|1267244 175 CDLADGGLPQRL 186
CdhD: domain 1 of 1, from 189 to 208: score 0.5, E = 5.8
*->lTGwkvlVGprDsseiiafl<-*
lTG+ v++ +++++ +++++
gi|1267244 189 LTGADVAASTDTTGSEGDWE 208
CorC_HlyC: domain 1 of 1, from 232 to 257: score 2.0, E = 8.6
*->daigdgtflvdGtarLedlnealgle<-*
+a + +++l+++ ++ e ++ ++g++
gi|1267244 232 TASNLDEYLANAQTPAETVANLFGTS 257
PTS_EIIA_2: domain 1 of 1, from 240 to 256: score 4.3, E = 1.3
CS HHH---HHHHHHHHTT-
*->LatattdeEllalLsgt<-*
La+a+t++E +a+L gt
gi|1267244 240 LANAQTPAETVANLFGT 256
DUF1488: domain 1 of 1, from 262 to 290: score 2.7, E = 5.7
*->sIlFpdrpsydaarqavrFpAqvdGreie<-*
++Fp ++++ + v F + v+G+e++
gi|1267244 262 GMTFPTSTAWRELADEVSFSVKVGGAEAQ 290
PEN-2: domain 1 of 1, from 263 to 285: score 0.2, E = 9.3
*->ttFqiGGeRleWgatgDllsFiiPDkLG<-*
+tF + ++W +++D +sF + G
gi|1267244 263 MTFPT---STAWRELADEVSFSVK--VG 285
CM1: domain 1 of 1, from 383 to 393: score 0.0, E = 3.6
*->AstAinEiAGi<-*
AstA+nEi Gi
gi|1267244 383 ASTALNEIVGI 393
DUF2108: domain 1 of 1, from 439 to 452: score 3.1, E = 4.3
*->egGmipliaArgYL<-*
++G++++iaA YL
gi|1267244 439 QSGIMGVIAAGDYL 452
HTH_10: domain 1 of 1, from 463 to 478: score 2.7, E = 5.4
*->LTdrQleiLrlAykmG<-*
LT +Q+ L +A+++G
gi|1267244 463 LTTAQVNRLVAAFNAG 478
DUF1465: domain 1 of 1, from 467 to 475: score 1.0, E = 8
*->QlnrLktAF<-*
Q nrL++AF
gi|1267244 467 QVNRLVAAF 475
Thioredoxin: domain 1 of 1, from 489 to 502: score 3.3, E = 1.9
CS SS-HHHHHHHHHHHH
*->GaRtkddLvafikkh<-*
Ga +++dLv+ ik++
gi|1267244 489 GA-DAADLVSNIKAN 502
FMN_bind: domain 1 of 1, from 566 to 592: score 4.3, E = 1.3
*->GywEkgpitvlvtvPdddGkItgvkilehkE<-*
G+ g+++ ++t+ +++ + tgv++ + +E
gi|1267244 566 GF---GKAQGTITL-TKEITTTGVDLTQIAE 592
DUF1212: domain 1 of 1, from 573 to 594: score 0.7, E = 5.8
*->titrvrripnrginLekvaeVn<-*
tit ++ i+++g++L+++ae++
gi|1267244 573 TITLTKEITTTGVDLTQIAELE 594
Corona_NS4: domain 1 of 1, from 602 to 610: score 0.7, E = 9.9
*->tPsATTlDGTd<-*
sAT lDGT+
gi|1267244 602 --SATILDGTT 610
Peptidase_S13: domain 1 of 1, from 674 to 689: score 0.7, E = 4.2
CS EECTTC-EEEEEEEEE
*->vttdsGrklaFsfisN<-*
v + sG +aF +i+N
gi|1267244 674 VANSSGADVAFQIILN 689
Ssu72: domain 1 of 1, from 717 to 731: score -0.2, E = 6.1
*->PeRwQdetkDGvFDiVl<-*
P R+Q tk vFD+V+
gi|1267244 717 PVRFQFGTK--VFDVVF 731
Strep_67kDa_ant: domain 1 of 1, from 718 to 740: score 4.0, E = 0.11
*->VdFeygtkVenIevDiskskKaA<-*
V+F++gtkV ++ +D s+s+ aA
gi|1267244 718 VRFQFGTKVFDVVFDTSASTVAA 740
Toluene_X: domain 1 of 1, from 729 to 748: score 0.9, E = 2.6
CS TTEE.EEEEEEEEEEEEEEEE
*->lpgtfvsasahllalsynyrF<-*
+ ++ +sas++ +al++n +F
gi|1267244 729 VVFD-TSASTVAAALAANADF 748
IL6Ra-bind: domain 1 of 1, from 840 to 857: score 2.3, E = 1.9
CS ESSEEEE---EEEETTTSB
*->ssaGSksSedqtFtglgIL<-*
s+ G ++S++ tF g g L
gi|1267244 840 SIMGAQFSNTYTFGGAG-L 857
Med12: domain 1 of 1, from 887 to 906: score 2.4, E = 3.1
*->TltdskreaWLkdLAnPnvpL<-*
T+t+++++aWL +L + v+L
gi|1267244 887 TATETAVKAWLDGLTS-KVSL 906
MukE: domain 1 of 1, from 952 to 968: score -0.5, E = 6.7
*->qaRLiRDGEAvvhtPes<-*
q ++RDGEA v tP++
gi|1267244 952 QIPVLRDGEAFVDTPDA 968
DUF1999: domain 1 of 1, from 974 to 988: score 1.1, E = 5.2
*->LGtRaarapgkkllr<-*
LGt a +a+++ l +
gi|1267244 974 LGTSATSADTRTLAE 988
DUF1499: domain 1 of 1, from 995 to 1012: score 4.7, E = 0.79
*->GkspempnLGvqdgrLap<-*
pe++++G+qdg+La+
gi|1267244 995 TSLPELAGIGTQDGELAA 1012
Corona_NS3b: domain 1 of 1, from 1095 to 1114: score 0.5, E = 2.6
*->AvLnEiDLKEEEGDRtYDvs<-*
Av Ei L G+Rt D+s
gi|1267244 1095 AVWGEIPLFKKIGERTADMS 1114
Securin: domain 1 of 1, from 1137 to 1158: score 2.4, E = 1.2
*->mativsvdkEnt..ginLPatP<-*
a++vsvd n +inLP++P
gi|1267244 1137 AANVVSVDTSNAalDINLPGEP 1158
DUF1321: domain 1 of 1, from 1138 to 1146: score -0.0, E = 9.4
*->aeVVsLDaF<-*
a+VVs+D+
gi|1267244 1138 ANVVSVDTS 1146
DmpG_comm: domain 1 of 1, from 1157 to 1170: score 2.3, E = 5.8
CS --S-SHHHHHHHHH
*->pvtvDResLvlGyA<-*
++++D +L+lG++
gi|1267244 1157 EPRIDMSTLTLGLS 1170
NodA: domain 1 of 1, from 1171 to 1182: score -0.2, E = 9.4
*->sGtlIeRnGpEL<-*
+G +Ie nG EL
gi|1267244 1171 QGFVIETNGWEL 1182
SIN1: domain 1 of 1, from 1173 to 1185: score -1.2, E = 10
*->rvesDDtPEWELDKG<-*
+v+ + + WELD +
gi|1267244 1173 FVIETNG--WELDAS 1185
RanBPM_CRA: domain 1 of 1, from 1208 to 1229: score 3.0, E = 2.6
*->twaqneLrekinsgkkkyPklidlg<-*
twa++ L+ + ++ ++ +++l+
gi|1267244 1208 TWAESVLDTN---YSLSIATFNELR 1229
RTBV_P12: domain 1 of 1, from 1240 to 1264: score 2.0, E = 3.5
*->msADYPtFKEALEKFKnLEsdtAaKDKF<-*
D tF+EAL K E+dt +D F
gi|1267244 1240 ---DDATFQEALYWLKMREADTVMQDGF 1264
Autotransporter: domain 1 of 1, from 1326 to 1402: score 1.6, E = 4.4
CS ....TEEEEEEEEEEEESS--- ------ ---- --.---------
*->lgrrslppyaglgvayefsgsr.vpvnsa.llaa.gslfgvasgtpl
l ++++ +++ +f+ ++v+ ++++++ + + ++ +
gi|1267244 1326 L---MSSLTGATNYTASFNSADgVTLDFVgSALTlPQ--ILID---F 1364
CS EEEEEEEEEEEEECTTEEEEEEEEEE.... TTEEEEE
drtalslgaGlelklgsnlslflnysaefg.sqlsdng<-*
+r + l G+++++++++ + + ++++++s+ ++++
gi|1267244 1365 SRLSTLLLSGATYRVTPTAAARVRTRIQAAnSEVASYN 1402
DUF979: domain 1 of 1, from 1347 to 1361: score -0.4, E = 9.3
*->LldsvGWAaILPQlL<-*
+ld vG+A+ LPQ+L
gi|1267244 1347 TLDFVGSALTLPQIL 1361
GCV_T_C: domain 1 of 1, from 1348 to 1359: score 1.2, E = 9.4
CS S-TTTHHHHHHH
*->gdFvGkeallrq<-*
dFvG +++l q
gi|1267244 1348 LDFVGSALTLPQ 1359
TOBE_2: domain 1 of 1, from 1467 to 1482: score 3.1, E = 4.2
*->laiRPEhirl..glsG<-*
+a RPE ++++++l+G
gi|1267244 1467 VAFRPETLAVngRLPG 1482
DUF520: domain 1 of 1, from 1507 to 1514: score 1.0, E = 2.3
*->QGDqVRVT<-*
QGDq+RVT
gi|1267244 1507 QGDQLRVT 1514
DUF734: domain 1 of 1, from 1527 to 1545: score 3.3, E = 2.4
*->vGtLnislnpgdqndlnala<-*
+G++ ++ n gdq +l+a+a
gi|1267244 1527 IGQIYVDAN-GDQFRLTAIA 1545
MmoB_DmpM: domain 1 of 1, from 1527 to 1543: score 2.5, E = 5.4
CS SSEEEES SSEEEEES
*->aGrided..DDeftltw<-*
+G+i++d ++D+f+lt
gi|1267244 1527 IGQIYVDanGDQFRLTA 1543
MspA: domain 1 of 1, from 1536 to 1573: score 0.6, E = 10
*->sngVslggsaGvtPsiglvsiGsvsgipdGllpdvtpp<-*
++ + l+++aG ++ +++ +++++++++Gl +v+++
gi|1267244 1536 GDQFRLTAIAGDQANADFLPLDGTTAPVGGLTNAVAFY 1573
SurE: domain 1 of 1, from 1607 to 1614: score 0.2, E = 8.1
*->MrILLTND<-*
+r+LL+ND
gi|1267244 1607 PRLLLVND 1614
DUF918: domain 1 of 1, from 1614 to 1623: score 1.5, E = 7.5
*->DReyEIkLle<-*
D+e+E+kLl
gi|1267244 1614 DSEWEMKLLL 1623
Phage_attach: domain 1 of 1, from 1641 to 1657: score -0.3, E = 5.1
*->MadfdNLFDeAisrADd<-*
+++fd L + ++ AD+
gi|1267244 1641 LSQFDQLLQQSVASADG 1657
Cobalamin_bind: domain 1 of 1, from 1667 to 1701: score 3.0, E = 0.86
*->PaLkgKTYLDvpsvsccpdcqvqrvllsdePvpespsevt<-*
P L+gK+++D++ pd++v +++l + v ++ ++
gi|1267244 1667 PLLYGKSFIDLIE---DPDASVSFNNL--SQVITTHLDAL 1701
DUF1280: domain 1 of 1, from 1713 to 1739: score 2.4, E = 2.8
*->YdgsDnssnlkkylkdvveQLNkltkI<-*
++g+D + l++y+ d+ +QL +t +
gi|1267244 1713 FNGTDYNGDLRAYVDDLAQQLSVITGL 1739
Strep_SA_rep: domain 1 of 1, from 1716 to 1731: score 2.9, E = 8.1
*->adYeakLaqYqadLAr<-*
+dY L +Y dLA+
gi|1267244 1716 TDYNGDLRAYVDDLAQ 1731
YugN: domain 1 of 1, from 1759 to 1771: score 2.5, E = 4.8
*->gekllqeleeeLl<-*
+ +++qelee+L+
gi|1267244 1759 SASTVQELEETLS 1771
S4: domain 1 of 1, from 1772 to 1790: score 3.8, E = 5.3
CS ETTEE--TTTBEETTTCEE
*->VNGkvvkdpsyrVkpgDei<-*
V+Gk + + yr+k D +
gi|1267244 1772 VDGKLLDEVRYRIKIQDLV 1790
DUF1768: domain 1 of 1, from 1774 to 1786: score 2.7, E = 1.9
CS HHHHHHHHHHHHH
*->GkiLMeVReeLrk<-*
Gk+L+eVR +++
gi|1267244 1774 GKLLDEVRYRIKI 1786
GCV_T: domain 1 of 1, from 1804 to 1812: score 0.7, E = 7.5
CS EEE-TTSEE
*->lfDvShmgk<-*
lfD+S mg
gi|1267244 1804 LFDLSEMGI 1812
PagL: domain 1 of 1, from 1817 to 1854: score 10.1, E = 0.032
*->tgdsedgyrlalrygfdplwlagiswsggrlslrlelg<-*
+ ++dgy+++l++++d++ +g++ +gg++++ +el+
gi|1267244 1817 SNRDIDGYEFGLNADLDINIDFGLKRDGGQFQPFIELS 1854
DcuA_DcuB: domain 1 of 1, from 1861 to 1875: score -0.4, E = 7.9
*->WLgdTfvsahideIK<-*
WL++T+vs+ +++I+
gi|1267244 1861 WLSSTVVSDPMPQIT 1875
DUF1522: domain 1 of 1, from 1910 to 1929: score 1.2, E = 7.8
*->gGaLtLststgADLsItGtgdl<-*
+Ga+ +s +++AD I G +++
gi|1267244 1910 SGAVDFSGGIAAD--IEGEANF 1929
RNA_capsid: domain 1 of 1, from 1912 to 1927: score -1.1, E = 9.5
*->MAgAfigglAadalgsa<-*
A +f gg+Aad+ g a
gi|1267244 1912 -AVDFSGGIAADIEGEA 1927
DUF2419: domain 1 of 1, from 2109 to 2129: score -1.6, E = 6.2
*->heLHPkaidikDkstsesTVdwiFvlDtLN<-*
+ L ++ +T d+i ++D+LN
gi|1267244 2109 DTLTLQS---------NATLDYITLVDLLN 2129
PHB_acc_N: domain 1 of 1, from 2120 to 2134: score 2.2, E = 5.3
*->sYiTLeDvaqliidg<-*
+YiTL D+ +li+dg
gi|1267244 2120 DYITLVDLLNLIRDG 2134
DUF472: domain 1 of 1, from 2143 to 2154: score 0.8, E = 9.5
*->hPeWePRYlayp<-*
++ W+PR+ +++
gi|1267244 2143 QTIWSPRFAVAS 2154
Entericidin: domain 1 of 1, from 2179 to 2191: score 2.7, E = 9.6
*->DiqsaGeAiedaA<-*
Di+++G+A+e+ A
gi|1267244 2179 DISATGSALERIA 2191
DUF88: domain 1 of 1, from 2189 to 2196: score 1.6, E = 7.4
*->riAvFIDg<-*
riA+F Dg
gi|1267244 2189 RIAIFADG 2196
DUF818: domain 1 of 1, from 2290 to 2312: score -0.4, E = 6
*->lHkdpLdektiqkLAehIlehLs<-*
l +d Ld +ti +A+ ++ ++
gi|1267244 2290 LNSDALDLNTIGYVAAQLSNQFD 2312
FlhE: domain 1 of 1, from 2329 to 2341: score 2.7, E = 1.6
*->LqvrsnQViVNYR<-*
+ vrs ++i NYR
gi|1267244 2329 FDVRSGDLIMNYR 2341
DUF1323: domain 1 of 1, from 2354 to 2369: score 1.4, E = 7.6
*->MTteELAellGvarQT<-*
M eELA llG+ T
gi|1267244 2354 MREEELAVLLGITTDT 2369
//