hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            126724419.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|126724419|ref|ZP_01740262.1|
Accession:      [none]
Description:    RTX toxins and related Ca2+-binding protein [Rhodobacterales bacterium HTCC2150]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
Planc_extracel  Planctomycete extracellular              15.8    0.00011   1
PagL            Lipid A 3-O-deacylase (PagL)             10.1      0.032   1
Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-rea     4.0       0.11   1
DUF1499         Protein of unknown function (DUF1499)     4.7       0.79   1
Cobalamin_bind  Eukaryotic cobalamin-binding protein      3.0       0.86   1
Securin         Securin sister-chromatid separation i     2.4        1.2   1
PTS_EIIA_2      Phosphoenolpyruvate-dependent sugar p     4.3        1.3   1
FMN_bind        FMN-binding domain                        4.3        1.3   1
FlhE            Flagellar protein FlhE                    2.7        1.6   1
DUF1768         Domain of unknown function (DUF1768)      2.7        1.9   1
IL6Ra-bind      Interleukin-6 receptor alpha chain, b     2.3        1.9   1
Thioredoxin     Thioredoxin                               3.3        1.9   1
UBA_2           Ubiquitin associated domain (UBA)         3.2        2.1   1
DUF520          Protein of unknown function (DUF520)      1.0        2.3   1
DUF734          Protein of unknown function (DUF734)      3.3        2.4   1
RanBPM_CRA      Ran binding protein in the microtubul     3.0        2.6   1
Toluene_X       Outer membrane protein transport prot     0.9        2.6   1
Corona_NS3b     ORF3b coronavirus protein                 0.5        2.6   1
DUF1280         Protein of unknown function (DUF1280)     2.4        2.8   1
ETF             Electron transfer flavoprotein domain     2.8          3   1
Med12           Transcription mediator subunit Med12      2.4        3.1   1
RTBV_P12        Rice tungro bacilliform virus P12 pro     2.0        3.5   1
CM1             Influenza C virus M1 protein              0.0        3.6   1
THUMP           THUMP domain                              2.6        4.2   1
Peptidase_S13   D-Ala-D-Ala carboxypeptidase 3 (S13)      0.7        4.2   1
TOBE_2          TOBE domain                               3.1        4.2   1
DUF2108         Predicted membrane protein (DUF2108)      3.1        4.3   1
Autotransporter Autotransporter beta-domain               1.6        4.4   1
YugN            YugN-like family                          2.5        4.8   1
Phage_attach    Phage Head-Tail Attachment               -0.3        5.1   1
DUF1999         Protein of unknown function (DUF1999)     1.1        5.2   1
PHB_acc_N       PHB/PHA accumulation regulator DNA-bi     2.2        5.3   1
S4              S4 domain                                 3.8        5.3   1
HTH_10          HTH DNA binding domain                    2.7        5.4   1
MmoB_DmpM       MmoB/DmpM family                          2.5        5.4   1
DUF1488         Protein of unknown function (DUF1488)     2.7        5.7   1
CdhD            CO dehydrogenase/acetyl-CoA synthase      0.5        5.8   1
DUF1212         Protein of unknown function (DUF1212)     0.7        5.8   1
DmpG_comm       DmpG-like communication domain            2.3        5.8   1
DUF818          Chlamydia CHLPS protein (DUF818)         -0.4          6   1
Ssu72           Ssu72-like protein                       -0.2        6.1   1
DUF2419         Protein of unknown function (DUF2419)    -1.6        6.2   1
MukE            MukE-like family                         -0.5        6.7   1
DUF88           Protein of unknown function DUF88         1.6        7.4   1
DUF918          Nucleopolyhedrovirus protein of unkno     1.5        7.5   1
GCV_T           Aminomethyltransferase folate-binding     0.7        7.5   1
DUF1323         Protein of unknown function (DUF1323)     1.4        7.6   1
DUF1522         Domain of Unknown Function (DUF1522)      1.2        7.8   1
DcuA_DcuB       Anaerobic c4-dicarboxylate membrane t    -0.4        7.9   1
DUF1465         Protein of unknown function (DUF1465)     1.0          8   1
SurE            Survival protein SurE                     0.2        8.1   1
Strep_SA_rep    Streptococcal surface antigen repeat      2.9        8.1   1
DUF1419         Protein of unknown function (DUF1419)     0.3        8.1   1
DUF2512         Protein of unknown function (DUF2512)     2.2        8.6   1
CorC_HlyC       Transporter associated domain             2.0        8.6   1
DUF979          Protein of unknown function (DUF979)     -0.4        9.3   1
PEN-2           Presenilin enhancer-2 subunit of gamm     0.2        9.3   1
NodA            Nodulation protein A (NodA)              -0.2        9.4   1
DUF1321         Protein of unknown function (DUF1321)    -0.0        9.4   1
GCV_T_C         Glycine cleavage T-protein C-terminal     1.2        9.4   1
DUF472          Family of unknown function (DUF472)       0.8        9.5   1
RNA_capsid      Calicivirus putative RNA polymerase/c    -1.1        9.5   1
Entericidin     Entericidin EcnA/B family                 2.7        9.6   1
DUF2328         Uncharacterized protein conserved in     -0.4        9.8   1
Corona_NS4      Coronavirus non-structural protein NS     0.7        9.9   1
SIN1            Stress-activated map kinase interacti    -1.2         10   1
MspA            MspA                                      0.6         10   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
DUF2512           1/1       1    27 [.   119   147 .]     2.2      8.6
Planc_extracel    1/1       7    31 ..     4    28 .]    15.8  0.00011
DUF2328           1/1      18    33 ..   173   188 .]    -0.4      9.8
THUMP             1/1      20    35 ..    82    97 .]     2.6      4.2
UBA_2             1/1     152   169 ..     1    18 [.     3.2      2.1
ETF               1/1     155   196 ..    87   126 ..     2.8        3
DUF1419           1/1     175   186 ..   100   111 .]     0.3      8.1
CdhD              1/1     189   208 ..   421   440 .]     0.5      5.8
CorC_HlyC         1/1     232   257 ..     1    26 [.     2.0      8.6
PTS_EIIA_2        1/1     240   256 ..   137   153 .]     4.3      1.3
DUF1488           1/1     262   290 ..     1    29 [.     2.7      5.7
PEN-2             1/1     263   285 ..    74   101 .]     0.2      9.3
CM1               1/1     383   393 ..   178   188 ..     0.0      3.6
DUF2108           1/1     439   452 ..    38    51 ..     3.1      4.3
HTH_10            1/1     463   478 ..     1    16 [.     2.7      5.4
DUF1465           1/1     467   475 ..   152   160 .]     1.0        8
Thioredoxin       1/1     489   502 ..    95   109 .]     3.3      1.9
FMN_bind          1/1     566   592 ..     1    31 [.     4.3      1.3
DUF1212           1/1     573   594 ..    55    76 ..     0.7      5.8
Corona_NS4        1/1     602   610 ..     1    11 [.     0.7      9.9
Peptidase_S13     1/1     674   689 ..   384   399 .]     0.7      4.2
Ssu72             1/1     717   731 ..    93   109 ..    -0.2      6.1
Strep_67kDa_ant   1/1     718   740 ..   223   245 ..     4.0     0.11
Toluene_X         1/1     729   748 ..   493   513 .]     0.9      2.6
IL6Ra-bind        1/1     840   857 ..    88   106 .]     2.3      1.9
Med12             1/1     887   906 ..     9    29 ..     2.4      3.1
MukE              1/1     952   968 ..   193   209 ..    -0.5      6.7
DUF1999           1/1     974   988 ..   154   168 .]     1.1      5.2
DUF1499           1/1     995  1012 ..     1    18 [.     4.7     0.79
Corona_NS3b       1/1    1095  1114 ..   225   244 .]     0.5      2.6
Securin           1/1    1137  1158 ..     1    20 [.     2.4      1.2
DUF1321           1/1    1138  1146 ..   153   161 .]    -0.0      9.4
DmpG_comm         1/1    1157  1170 ..     1    14 [.     2.3      5.8
NodA              1/1    1171  1182 ..   185   196 .]    -0.2      9.4
SIN1              1/1    1173  1185 ..     1    15 [.    -1.2       10
RanBPM_CRA        1/1    1208  1229 ..    96   120 .]     3.0      2.6
RTBV_P12          1/1    1240  1264 ..     1    28 [.     2.0      3.5
Autotransporter   1/1    1326  1402 ..   216   296 .]     1.6      4.4
DUF979            1/1    1347  1361 ..   166   180 ..    -0.4      9.3
GCV_T_C           1/1    1348  1359 ..     1    12 [.     1.2      9.4
TOBE_2            1/1    1467  1482 ..     1    14 [.     3.1      4.2
DUF520            1/1    1507  1514 ..   126   133 ..     1.0      2.3
DUF734            1/1    1527  1545 ..    64    83 .]     3.3      2.4
MmoB_DmpM         1/1    1527  1543 ..    75    89 .]     2.5      5.4
MspA              1/1    1536  1573 ..    91   128 ..     0.6       10
SurE              1/1    1607  1614 ..     1     8 [.     0.2      8.1
DUF918            1/1    1614  1623 ..   149   158 .]     1.5      7.5
Phage_attach      1/1    1641  1657 ..     1    17 [.    -0.3      5.1
Cobalamin_bind    1/1    1667  1701 ..   312   351 .]     3.0     0.86
DUF1280           1/1    1713  1739 ..   200   226 .]     2.4      2.8
Strep_SA_rep      1/1    1716  1731 ..     1    16 [.     2.9      8.1
YugN              1/1    1759  1771 ..   122   134 .]     2.5      4.8
S4                1/1    1772  1790 ..    30    48 .]     3.8      5.3
DUF1768           1/1    1774  1786 ..   164   176 .]     2.7      1.9
GCV_T             1/1    1804  1812 ..     1     9 [.     0.7      7.5
PagL              1/1    1817  1854 ..     1    38 [.    10.1    0.032
DcuA_DcuB         1/1    1861  1875 ..   314   328 ..    -0.4      7.9
DUF1522           1/1    1910  1929 ..    97   118 .]     1.2      7.8
RNA_capsid        1/1    1912  1927 ..     1    17 [.    -1.1      9.5
DUF2419           1/1    2109  2129 ..     1    30 [.    -1.6      6.2
PHB_acc_N         1/1    2120  2134 ..    18    32 ..     2.2      5.3
DUF472            1/1    2143  2154 ..    71    82 .]     0.8      9.5
Entericidin       1/1    2179  2191 ..    31    43 .]     2.7      9.6
DUF88             1/1    2189  2196 ..     1     8 [.     1.6      7.4
DUF818            1/1    2290  2312 ..   350   372 .]    -0.4        6
FlhE              1/1    2329  2341 ..   127   139 .]     2.7      1.6
DUF1323           1/1    2354  2369 ..     1    16 [.     1.4      7.6

Alignments of top-scoring domains:
DUF2512: domain 1 of 1, from 1 to 27: score 2.2, E = 8.6
                   *->lrnvlpeqeenenrskagglryqTEfseE<-*
                      +++++  ++++ + s+ag+++ + E+ eE
  gi|1267244     1    MNKIF--EKRKKTNSSAGRRKIAIEPLEE    27

Planc_extracel: domain 1 of 1, from 7 to 31: score 15.8, E = 0.00011
                   *->rrrrrrsrrrrRRLrlEsLEsRrLL<-*
                      +r++++s+++rR+ ++E+LE R LL
  gi|1267244     7    KRKKTNSSAGRRKIAIEPLEERILL    31

DUF2328: domain 1 of 1, from 18 to 33: score -0.4, E = 9.8
                   *->gtisveiteeavvlsa<-*
                      ++i++e+ ee+++ls+
  gi|1267244    18    RKIAIEPLEERILLSV    33

THUMP: domain 1 of 1, from 20 to 35: score 2.6, E = 4.2
                CS    EEEEEETTEEEEES--
                   *->vhvEiikdkayisidr<-*
                      + +E++++++++s+d+
  gi|1267244    20    IAIEPLEERILLSVDL    35

UBA_2: domain 1 of 1, from 152 to 169: score 3.2, E = 2.1
                   *->iDedvvskLSkTMGYdkD<-*
                      +D+ ++s+L   MG d D
  gi|1267244   152    ADDPLISALARSMGPDSD    169

ETF: domain 1 of 1, from 155 to 196: score 2.8, E = 3
                CS    HHHHHHHH      C.EEEECSCHCCTT-S-HHHHHHHCCTEEEEE
                   *->aaLaalik......dplvLaGatsigkdtgQlaPrlAalLgaglvt<
                      ++++al+++ ++++d l L +    +++   l+ rlA+l ga +++
  gi|1267244   155    PLISALARsmgpdsD-LMLYACDLADGG---LPQRLAVLTGADVAA  196

                CS
                   -*

  gi|1267244     -    -

DUF1419: domain 1 of 1, from 175 to 186: score 0.3, E = 8.1
                   *->CDLsDkgSPerM<-*
                      CDL+D g P r
  gi|1267244   175    CDLADGGLPQRL    186

CdhD: domain 1 of 1, from 189 to 208: score 0.5, E = 5.8
                   *->lTGwkvlVGprDsseiiafl<-*
                      lTG+ v++ +++++ +++++
  gi|1267244   189    LTGADVAASTDTTGSEGDWE    208

CorC_HlyC: domain 1 of 1, from 232 to 257: score 2.0, E = 8.6
                   *->daigdgtflvdGtarLedlnealgle<-*
                      +a + +++l+++ ++ e ++ ++g++
  gi|1267244   232    TASNLDEYLANAQTPAETVANLFGTS    257

PTS_EIIA_2: domain 1 of 1, from 240 to 256: score 4.3, E = 1.3
                CS    HHH---HHHHHHHHTT-
                   *->LatattdeEllalLsgt<-*
                      La+a+t++E +a+L gt
  gi|1267244   240    LANAQTPAETVANLFGT    256

DUF1488: domain 1 of 1, from 262 to 290: score 2.7, E = 5.7
                   *->sIlFpdrpsydaarqavrFpAqvdGreie<-*
                       ++Fp   ++++  + v F + v+G+e++
  gi|1267244   262    GMTFPTSTAWRELADEVSFSVKVGGAEAQ    290

PEN-2: domain 1 of 1, from 263 to 285: score 0.2, E = 9.3
                   *->ttFqiGGeRleWgatgDllsFiiPDkLG<-*
                      +tF +    ++W +++D +sF +    G
  gi|1267244   263    MTFPT---STAWRELADEVSFSVK--VG    285

CM1: domain 1 of 1, from 383 to 393: score 0.0, E = 3.6
                   *->AstAinEiAGi<-*
                      AstA+nEi Gi
  gi|1267244   383    ASTALNEIVGI    393

DUF2108: domain 1 of 1, from 439 to 452: score 3.1, E = 4.3
                   *->egGmipliaArgYL<-*
                      ++G++++iaA  YL
  gi|1267244   439    QSGIMGVIAAGDYL    452

HTH_10: domain 1 of 1, from 463 to 478: score 2.7, E = 5.4
                   *->LTdrQleiLrlAykmG<-*
                      LT +Q+  L +A+++G
  gi|1267244   463    LTTAQVNRLVAAFNAG    478

DUF1465: domain 1 of 1, from 467 to 475: score 1.0, E = 8
                   *->QlnrLktAF<-*
                      Q nrL++AF
  gi|1267244   467    QVNRLVAAF    475

Thioredoxin: domain 1 of 1, from 489 to 502: score 3.3, E = 1.9
                CS    SS-HHHHHHHHHHHH
                   *->GaRtkddLvafikkh<-*
                      Ga +++dLv+ ik++
  gi|1267244   489    GA-DAADLVSNIKAN    502

FMN_bind: domain 1 of 1, from 566 to 592: score 4.3, E = 1.3
                   *->GywEkgpitvlvtvPdddGkItgvkilehkE<-*
                      G+   g+++ ++t+ +++ + tgv++ + +E
  gi|1267244   566    GF---GKAQGTITL-TKEITTTGVDLTQIAE    592

DUF1212: domain 1 of 1, from 573 to 594: score 0.7, E = 5.8
                   *->titrvrripnrginLekvaeVn<-*
                      tit ++ i+++g++L+++ae++
  gi|1267244   573    TITLTKEITTTGVDLTQIAELE    594

Corona_NS4: domain 1 of 1, from 602 to 610: score 0.7, E = 9.9
                   *->tPsATTlDGTd<-*
                        sAT lDGT+
  gi|1267244   602    --SATILDGTT    610

Peptidase_S13: domain 1 of 1, from 674 to 689: score 0.7, E = 4.2
                CS    EECTTC-EEEEEEEEE
                   *->vttdsGrklaFsfisN<-*
                      v + sG  +aF +i+N
  gi|1267244   674    VANSSGADVAFQIILN    689

Ssu72: domain 1 of 1, from 717 to 731: score -0.2, E = 6.1
                   *->PeRwQdetkDGvFDiVl<-*
                      P R+Q  tk  vFD+V+
  gi|1267244   717    PVRFQFGTK--VFDVVF    731

Strep_67kDa_ant: domain 1 of 1, from 718 to 740: score 4.0, E = 0.11
                   *->VdFeygtkVenIevDiskskKaA<-*
                      V+F++gtkV ++ +D s+s+ aA
  gi|1267244   718    VRFQFGTKVFDVVFDTSASTVAA    740

Toluene_X: domain 1 of 1, from 729 to 748: score 0.9, E = 2.6
                CS    TTEE.EEEEEEEEEEEEEEEE
                   *->lpgtfvsasahllalsynyrF<-*
                      + ++ +sas++ +al++n +F
  gi|1267244   729    VVFD-TSASTVAAALAANADF    748

IL6Ra-bind: domain 1 of 1, from 840 to 857: score 2.3, E = 1.9
                CS    ESSEEEE---EEEETTTSB
                   *->ssaGSksSedqtFtglgIL<-*
                      s+ G ++S++ tF g g L
  gi|1267244   840    SIMGAQFSNTYTFGGAG-L    857

Med12: domain 1 of 1, from 887 to 906: score 2.4, E = 3.1
                   *->TltdskreaWLkdLAnPnvpL<-*
                      T+t+++++aWL +L +  v+L
  gi|1267244   887    TATETAVKAWLDGLTS-KVSL    906

MukE: domain 1 of 1, from 952 to 968: score -0.5, E = 6.7
                   *->qaRLiRDGEAvvhtPes<-*
                      q  ++RDGEA v tP++
  gi|1267244   952    QIPVLRDGEAFVDTPDA    968

DUF1999: domain 1 of 1, from 974 to 988: score 1.1, E = 5.2
                   *->LGtRaarapgkkllr<-*
                      LGt a +a+++ l +
  gi|1267244   974    LGTSATSADTRTLAE    988

DUF1499: domain 1 of 1, from 995 to 1012: score 4.7, E = 0.79
                   *->GkspempnLGvqdgrLap<-*
                         pe++++G+qdg+La+
  gi|1267244   995    TSLPELAGIGTQDGELAA    1012

Corona_NS3b: domain 1 of 1, from 1095 to 1114: score 0.5, E = 2.6
                   *->AvLnEiDLKEEEGDRtYDvs<-*
                      Av  Ei L    G+Rt D+s
  gi|1267244  1095    AVWGEIPLFKKIGERTADMS    1114

Securin: domain 1 of 1, from 1137 to 1158: score 2.4, E = 1.2
                   *->mativsvdkEnt..ginLPatP<-*
                       a++vsvd  n   +inLP++P
  gi|1267244  1137    AANVVSVDTSNAalDINLPGEP    1158

DUF1321: domain 1 of 1, from 1138 to 1146: score -0.0, E = 9.4
                   *->aeVVsLDaF<-*
                      a+VVs+D+
  gi|1267244  1138    ANVVSVDTS    1146

DmpG_comm: domain 1 of 1, from 1157 to 1170: score 2.3, E = 5.8
                CS    --S-SHHHHHHHHH
                   *->pvtvDResLvlGyA<-*
                      ++++D  +L+lG++
  gi|1267244  1157    EPRIDMSTLTLGLS    1170

NodA: domain 1 of 1, from 1171 to 1182: score -0.2, E = 9.4
                   *->sGtlIeRnGpEL<-*
                      +G +Ie nG EL
  gi|1267244  1171    QGFVIETNGWEL    1182

SIN1: domain 1 of 1, from 1173 to 1185: score -1.2, E = 10
                   *->rvesDDtPEWELDKG<-*
                      +v+ + +  WELD +
  gi|1267244  1173    FVIETNG--WELDAS    1185

RanBPM_CRA: domain 1 of 1, from 1208 to 1229: score 3.0, E = 2.6
                   *->twaqneLrekinsgkkkyPklidlg<-*
                      twa++ L+ +   ++ ++  +++l+
  gi|1267244  1208    TWAESVLDTN---YSLSIATFNELR    1229

RTBV_P12: domain 1 of 1, from 1240 to 1264: score 2.0, E = 3.5
                   *->msADYPtFKEALEKFKnLEsdtAaKDKF<-*
                         D  tF+EAL   K  E+dt  +D F
  gi|1267244  1240    ---DDATFQEALYWLKMREADTVMQDGF    1264

Autotransporter: domain 1 of 1, from 1326 to 1402: score 1.6, E = 4.4
                CS    ....TEEEEEEEEEEEESS--- ------ ---- --.---------
                   *->lgrrslppyaglgvayefsgsr.vpvnsa.llaa.gslfgvasgtpl
                      l     ++++ +++  +f+  ++v+ ++++++ +  +    ++   +
  gi|1267244  1326    L---MSSLTGATNYTASFNSADgVTLDFVgSALTlPQ--ILID---F 1364

                CS EEEEEEEEEEEEECTTEEEEEEEEEE.... TTEEEEE
                   drtalslgaGlelklgsnlslflnysaefg.sqlsdng<-*
                   +r +  l  G+++++++++ + +  ++++++s+ ++++
  gi|1267244  1365 SRLSTLLLSGATYRVTPTAAARVRTRIQAAnSEVASYN    1402

DUF979: domain 1 of 1, from 1347 to 1361: score -0.4, E = 9.3
                   *->LldsvGWAaILPQlL<-*
                      +ld vG+A+ LPQ+L
  gi|1267244  1347    TLDFVGSALTLPQIL    1361

GCV_T_C: domain 1 of 1, from 1348 to 1359: score 1.2, E = 9.4
                CS    S-TTTHHHHHHH
                   *->gdFvGkeallrq<-*
                       dFvG +++l q
  gi|1267244  1348    LDFVGSALTLPQ    1359

TOBE_2: domain 1 of 1, from 1467 to 1482: score 3.1, E = 4.2
                   *->laiRPEhirl..glsG<-*
                      +a RPE ++++++l+G
  gi|1267244  1467    VAFRPETLAVngRLPG    1482

DUF520: domain 1 of 1, from 1507 to 1514: score 1.0, E = 2.3
                   *->QGDqVRVT<-*
                      QGDq+RVT
  gi|1267244  1507    QGDQLRVT    1514

DUF734: domain 1 of 1, from 1527 to 1545: score 3.3, E = 2.4
                   *->vGtLnislnpgdqndlnala<-*
                      +G++ ++ n gdq +l+a+a
  gi|1267244  1527    IGQIYVDAN-GDQFRLTAIA    1545

MmoB_DmpM: domain 1 of 1, from 1527 to 1543: score 2.5, E = 5.4
                CS    SSEEEES  SSEEEEES
                   *->aGrided..DDeftltw<-*
                      +G+i++d ++D+f+lt
  gi|1267244  1527    IGQIYVDanGDQFRLTA    1543

MspA: domain 1 of 1, from 1536 to 1573: score 0.6, E = 10
                   *->sngVslggsaGvtPsiglvsiGsvsgipdGllpdvtpp<-*
                      ++ + l+++aG  ++ +++ +++++++++Gl  +v+++
  gi|1267244  1536    GDQFRLTAIAGDQANADFLPLDGTTAPVGGLTNAVAFY    1573

SurE: domain 1 of 1, from 1607 to 1614: score 0.2, E = 8.1
                   *->MrILLTND<-*
                      +r+LL+ND
  gi|1267244  1607    PRLLLVND    1614

DUF918: domain 1 of 1, from 1614 to 1623: score 1.5, E = 7.5
                   *->DReyEIkLle<-*
                      D+e+E+kLl
  gi|1267244  1614    DSEWEMKLLL    1623

Phage_attach: domain 1 of 1, from 1641 to 1657: score -0.3, E = 5.1
                   *->MadfdNLFDeAisrADd<-*
                      +++fd L  + ++ AD+
  gi|1267244  1641    LSQFDQLLQQSVASADG    1657

Cobalamin_bind: domain 1 of 1, from 1667 to 1701: score 3.0, E = 0.86
                   *->PaLkgKTYLDvpsvsccpdcqvqrvllsdePvpespsevt<-*
                      P L+gK+++D++     pd++v +++l  + v ++  ++
  gi|1267244  1667    PLLYGKSFIDLIE---DPDASVSFNNL--SQVITTHLDAL    1701

DUF1280: domain 1 of 1, from 1713 to 1739: score 2.4, E = 2.8
                   *->YdgsDnssnlkkylkdvveQLNkltkI<-*
                      ++g+D +  l++y+ d+ +QL  +t +
  gi|1267244  1713    FNGTDYNGDLRAYVDDLAQQLSVITGL    1739

Strep_SA_rep: domain 1 of 1, from 1716 to 1731: score 2.9, E = 8.1
                   *->adYeakLaqYqadLAr<-*
                      +dY   L +Y  dLA+
  gi|1267244  1716    TDYNGDLRAYVDDLAQ    1731

YugN: domain 1 of 1, from 1759 to 1771: score 2.5, E = 4.8
                   *->gekllqeleeeLl<-*
                      + +++qelee+L+
  gi|1267244  1759    SASTVQELEETLS    1771

S4: domain 1 of 1, from 1772 to 1790: score 3.8, E = 5.3
                CS    ETTEE--TTTBEETTTCEE
                   *->VNGkvvkdpsyrVkpgDei<-*
                      V+Gk  + + yr+k  D +
  gi|1267244  1772    VDGKLLDEVRYRIKIQDLV    1790

DUF1768: domain 1 of 1, from 1774 to 1786: score 2.7, E = 1.9
                CS    HHHHHHHHHHHHH
                   *->GkiLMeVReeLrk<-*
                      Gk+L+eVR +++
  gi|1267244  1774    GKLLDEVRYRIKI    1786

GCV_T: domain 1 of 1, from 1804 to 1812: score 0.7, E = 7.5
                CS    EEE-TTSEE
                   *->lfDvShmgk<-*
                      lfD+S mg
  gi|1267244  1804    LFDLSEMGI    1812

PagL: domain 1 of 1, from 1817 to 1854: score 10.1, E = 0.032
                   *->tgdsedgyrlalrygfdplwlagiswsggrlslrlelg<-*
                      +  ++dgy+++l++++d++  +g++ +gg++++ +el+
  gi|1267244  1817    SNRDIDGYEFGLNADLDINIDFGLKRDGGQFQPFIELS    1854

DcuA_DcuB: domain 1 of 1, from 1861 to 1875: score -0.4, E = 7.9
                   *->WLgdTfvsahideIK<-*
                      WL++T+vs+ +++I+
  gi|1267244  1861    WLSSTVVSDPMPQIT    1875

DUF1522: domain 1 of 1, from 1910 to 1929: score 1.2, E = 7.8
                   *->gGaLtLststgADLsItGtgdl<-*
                      +Ga+ +s +++AD  I G +++
  gi|1267244  1910    SGAVDFSGGIAAD--IEGEANF    1929

RNA_capsid: domain 1 of 1, from 1912 to 1927: score -1.1, E = 9.5
                   *->MAgAfigglAadalgsa<-*
                       A +f gg+Aad+ g a
  gi|1267244  1912    -AVDFSGGIAADIEGEA    1927

DUF2419: domain 1 of 1, from 2109 to 2129: score -1.6, E = 6.2
                   *->heLHPkaidikDkstsesTVdwiFvlDtLN<-*
                      + L  ++          +T d+i ++D+LN
  gi|1267244  2109    DTLTLQS---------NATLDYITLVDLLN    2129

PHB_acc_N: domain 1 of 1, from 2120 to 2134: score 2.2, E = 5.3
                   *->sYiTLeDvaqliidg<-*
                      +YiTL D+ +li+dg
  gi|1267244  2120    DYITLVDLLNLIRDG    2134

DUF472: domain 1 of 1, from 2143 to 2154: score 0.8, E = 9.5
                   *->hPeWePRYlayp<-*
                      ++ W+PR+ +++
  gi|1267244  2143    QTIWSPRFAVAS    2154

Entericidin: domain 1 of 1, from 2179 to 2191: score 2.7, E = 9.6
                   *->DiqsaGeAiedaA<-*
                      Di+++G+A+e+ A
  gi|1267244  2179    DISATGSALERIA    2191

DUF88: domain 1 of 1, from 2189 to 2196: score 1.6, E = 7.4
                   *->riAvFIDg<-*
                      riA+F Dg
  gi|1267244  2189    RIAIFADG    2196

DUF818: domain 1 of 1, from 2290 to 2312: score -0.4, E = 6
                   *->lHkdpLdektiqkLAehIlehLs<-*
                      l +d Ld +ti  +A+  ++ ++
  gi|1267244  2290    LNSDALDLNTIGYVAAQLSNQFD    2312

FlhE: domain 1 of 1, from 2329 to 2341: score 2.7, E = 1.6
                   *->LqvrsnQViVNYR<-*
                      + vrs ++i NYR
  gi|1267244  2329    FDVRSGDLIMNYR    2341

DUF1323: domain 1 of 1, from 2354 to 2369: score 1.4, E = 7.6
                   *->MTteELAellGvarQT<-*
                      M  eELA llG+   T
  gi|1267244  2354    MREEELAVLLGITTDT    2369

//