hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            134103275.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|134103275|ref|YP_001108936.1|
Accession:      [none]
Description:    PE-PGRS family protein [Saccharopolyspora erythraea NRRL 2338]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
Bombolitin      Bombolitin family                         6.5       0.57   1
DUF1451         Protein of unknown function (DUF1451)     4.8       0.83   1
DUF1792         Domain of unknown function (DUF1792)      3.9        1.1   1
DUF721          Protein of unknown function (DUF721)      3.8        1.4   1
RnaseA          Pancreatic ribonuclease                   2.6        1.6   1
Gmad1           Lipoprotein LpqB beta-propeller domai     2.9        1.7   1
Reo_sigmaC      Reovirus sigma C capsid protein           1.7        1.8   1
SPDY            Domain of unknown function (DUF317)       4.0        2.6   1
Filamin         Filamin/ABP280 repeat                     3.2        2.9   1
DUF816          Baculovirus protein of unknown functi     2.3          3   1
LRV             Leucine rich repeat variant               5.4        3.1   2
Antimicrobial_8 Uperin family                             4.8        3.4   1
Rod-binding     Rod binding protein                       3.5        3.5   1
Albicidin_res   Albicidin resistance domain               2.2        3.7   1
ProRS-C_2       Prolyl-tRNA synthetase, C-terminal        1.4          4   1
DUF2250         Uncharacterized protein conserved in      1.5          5   1
NHR2            NHR2 domain like                          1.5        5.4   1
PSD1            Protein of unknown function (DUF1553)     0.6        5.4   1
HA              Helicase associated domain                2.9        5.7   1
4_1_CTD         4.1 protein C-terminal domain (CTD)       1.4        5.8   1
DUF1396         Protein of unknown function (DUF1396)    -0.8        6.2   1
Kelch_2         Kelch motif                               3.3        6.7   1
Beta-trefoil    Beta-trefoil                              0.3        6.9   1
DUF1388         Repeat of unknown function (DUF1388)      2.5        7.4   1
Z1              Z1 domain                                 0.3        7.8   1
TSNR_N          Thiostrepton-resistance methylase, N      1.1        8.3   1
DNA_pol3_beta_2 DNA polymerase III beta subunit, cent     0.7        8.5   1
Prox1           Homeobox prospero-like protein (PROX1    -2.8        8.7   1
IU_nuc_hydro    Inosine-uridine preferring nucleoside    -0.8        8.9   1
Met_asp_mut_E   Methylaspartate mutase E chain (MutE)    -1.0          9   1
NRPS            Nonribosomal peptide synthase            -0.1        9.2   1
NikR_C          NikR C terminal nickel binding domain     1.8        9.2   1
AMH_N           Anti-Mullerian hormone, N terminal re    -1.2        9.5   1
S-AdoMet_synt_M S-adenosylmethionine synthetase, cent     0.9        9.7   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
ProRS-C_2         1/1      27    41 ..     1    15 [.     1.4        4
Beta-trefoil      1/1      39    45 ..   199   205 .]     0.3      6.9
Z1                1/1      83    92 ..     1    10 [.     0.3      7.8
LRV               1/2      87    97 ..    16    26 .]     3.5       11
Gmad1             1/1      92   121 ..   259   297 .]     2.9      1.7
Filamin           1/1      93   103 ..     1    11 [.     3.2      2.9
DUF2250           1/1     164   179 ..   190   205 .]     1.5        5
DUF816            1/1     174   190 ..     1    20 [.     2.3        3
IU_nuc_hydro      1/1     180   190 ..   355   365 .]    -0.8      8.9
Bombolitin        1/1     220   236 ..     1    17 []     6.5     0.57
DUF721            1/1     221   261 ..     1    47 [.     3.8      1.4
Antimicrobial_8   1/1     222   237 ..     1    17 []     4.8      3.4
DUF1451           1/1     225   259 ..     1    35 [.     4.8     0.83
TSNR_N            1/1     278   293 ..   101   115 .]     1.1      8.3
DUF1388           1/1     521   549 ..     1    29 []     2.5      7.4
AMH_N             1/1     810   835 ..     1    34 [.    -1.2      9.5
NHR2              1/1     971   982 ..    56    67 .]     1.5      5.4
Met_asp_mut_E     1/1    1087  1094 ..     1     8 [.    -1.0        9
DNA_pol3_beta_2   1/1    1110  1122 ..     1    13 [.     0.7      8.5
Reo_sigmaC        1/1    1132  1143 ..   315   326 .]     1.7      1.8
Prox1             1/1    1147  1155 ..  1539  1547 .]    -2.8      8.7
NRPS              1/1    1185  1210 ..    34    62 .]    -0.1      9.2
DUF1396           1/1    1200  1216 ..     1    19 [.    -0.8      6.2
SPDY              1/1    1206  1228 ..     1    28 [.     4.0      2.6
Albicidin_res     1/1    1227  1250 ..     1    25 [.     2.2      3.7
S-AdoMet_synt_M   1/1    1279  1286 ..   116   123 .]     0.9      9.7
RnaseA            1/1    1346  1354 ..   121   129 .]     2.6      1.6
Kelch_2           1/1    1357  1375 ..    36    54 .]     3.3      6.7
HA                1/1    1687  1702 ..    56    71 .]     2.9      5.7
PSD1              1/1    1735  1753 ..   264   282 .]     0.6      5.4
LRV               2/2    1760  1775 ..    11    26 .]     1.9       28
NikR_C            1/1    1786  1795 ..     1    10 [.     1.8      9.2
Rod-binding       1/1    1803  1810 ..     1     9 [.     3.5      3.5
4_1_CTD           1/1    1877  1891 ..     1    15 [.     1.4      5.8
DUF1792           1/1    1921  1930 ..     1    10 [.     3.9      1.1

Alignments of top-scoring domains:
ProRS-C_2: domain 1 of 1, from 27 to 41: score 1.4, E = 4
                CS    EEE-S...S--..HH
                   *->ITvLdFEnDvNsLsd<-*
                      + +L+F  Dv sL d
  gi|1341032    27    VGILEFYHDVSSLND    41

Beta-trefoil: domain 1 of 1, from 39 to 45: score 0.3, E = 6.9
                   *->LNdGaeW<-*
                      LNdG++W
  gi|1341032    39    LNDGSSW    45

Z1: domain 1 of 1, from 83 to 92: score 0.3, E = 7.8
                   *->eSLrdAidsF<-*
                      e L++A+d+F
  gi|1341032    83    EPLKEALDWF    92

LRV: domain 1 of 2, from 87 to 97: score 3.5, E = 11
                CS    GGGGGGTT-SS
                   *->eaLerLaaDpd<-*
                      eaL + a Dpd
  gi|1341032    87    EALDWFAGDPD    97

Gmad1: domain 1 of 1, from 92 to 121: score 2.9, E = 1.7
                   *->vvtdadgllqlFpassiesgqgWrevpglvGagtaPvyP<-*
                      +++d+dg++          g++W++v +  ++ +a++y+
  gi|1341032    92    FAGDPDGVKAY--------GATWTKVSE-AVGEAAASYA    121

Filamin: domain 1 of 1, from 93 to 103: score 3.2, E = 2.9
                CS    ---SSSEEEE-
                   *->agDasKVkayG<-*
                      agD++ VkayG
  gi|1341032    93    AGDPDGVKAYG    103

DUF2250: domain 1 of 1, from 164 to 179: score 1.5, E = 5
                   *->lTrlGeevkFfrelkr<-*
                      +T  Ge+v F+re +r
  gi|1341032   164    VTIMGEVVSFVREFVR    179

DUF816: domain 1 of 1, from 174 to 190: score 2.3, E = 3
                   *->tvdvdeFakqLIadkcsaLI<-*
                         v eF + L+ad +s LI
  gi|1341032   174    ---VREFVRDLVADCISRLI    190

IU_nuc_hydro: domain 1 of 1, from 180 to 190: score -0.8, E = 8.9
                CS    HHHHHHHHCCS
                   *->dlvfevlrraa<-*
                      dlv++++ r++
  gi|1341032   180    DLVADCISRLI    190

Bombolitin: domain 1 of 1, from 220 to 236: score 6.5, E = 0.57
                   *->iKitDiLAKLGKvLAHv<-*
                       Ki Di+ KL K +  v
  gi|1341032   220    AKIADIVQKLIKTISNV    236

DUF721: domain 1 of 1, from 221 to 261: score 3.8, E = 1.4
                   *->slgdllngellrklgekwekralalarllqaWpeiVGpalAahtrPv
                      +++d++ ++l++++       a +lar+ +   e++ +al + t+Pv
  gi|1341032   221    KIADIV-QKLIKTIS----NVAPKLARMAEVFGEVM-KALGKLTKPV 261

                   <-*

  gi|1341032     -     -

Antimicrobial_8: domain 1 of 1, from 222 to 237: score 4.8, E = 3.4
                   *->GVgdlirKivsaiKNVv<-*
                       + d+++K + +i NV+
  gi|1341032   222    -IADIVQKLIKTISNVA    237

DUF1451: domain 1 of 1, from 225 to 259: score 4.8, E = 0.83
                   *->llerlterlklsekeLkkaveqakeylvaagdLte<-*
                      ++ +l  + ++ ++ L+++ e + e+++a+g Lt+
  gi|1341032   225    IVQKLIKTISNVAPKLARMAEVFGEVMKALGKLTK    259

TSNR_N: domain 1 of 1, from 278 to 293: score 1.1, E = 8.3
                   *->kVPraaRlAD.leels<-*
                      kV  ++R+AD+l+e+s
  gi|1341032   278    KVDVPGRMADkLAEKS    293

DUF1388: domain 1 of 1, from 521 to 549: score 2.5, E = 7.4
                   *->PaenKsPgenKsPgenKsPgEnKsPaeak<-*
                      P+   sP+ + sPg   sP    sPa  +
  gi|1341032   521    PGTGSSPAAAASPGSGSSPDSGSSPAFGS    549

AMH_N: domain 1 of 1, from 810 to 835: score -1.2, E = 9.5
                   *->lrkgtpreetvaleqtlseesgleaeeregenaL<-*
                      +r+++pr+e        ++ +g+++  +++ +aL
  gi|1341032   810    PRPDAPRPE--------ASRPGAPRPDGTRPEAL    835

NHR2: domain 1 of 1, from 971 to 982: score 1.5, E = 5.4
                   *->WkRRssEqeelR<-*
                      W+RR  E+  +R
  gi|1341032   971    WQRRMAEDAKIR    982

Met_asp_mut_E: domain 1 of 1, from 1087 to 1094: score -1.0, E = 9
                   *->lPdhKrFa<-*
                       Pd+KrF+
  gi|1341032  1087    MPDPKRFT    1094

DNA_pol3_beta_2: domain 1 of 1, from 1110 to 1122: score 0.7, E = 8.5
                CS    EEEHHHHHHHHHT
                   *->qlpqkvLkelIeq<-*
                      +l++k+L+e+I++
  gi|1341032  1110    DLSAKELAEVIRA    1122

Reo_sigmaC: domain 1 of 1, from 1132 to 1143: score 1.7, E = 1.8
                   *->irFLTVRTGIDT<-*
                      ir L  RTG DT
  gi|1341032  1132    IRLLSCRTGSDT    1143

Prox1: domain 1 of 1, from 1147 to 1155: score -2.8, E = 8.7
                CS    -HHHH----
                   *->SPNfLeeLl<-*
                      SPNf e+L
  gi|1341032  1147    SPNFAEQLS    1155

NRPS: domain 1 of 1, from 1185 to 1210: score -0.1, E = 9.2
                   *->glagrglaadqavtsalGepvygiSQTPQ<-*
                      ++++++++a   ++ ++++p+ ++S  P
  gi|1341032  1185    SFDVDSSGA---PQPHFDDPGQWVSHSPD    1210

DUF1396: domain 1 of 1, from 1200 to 1216: score -0.8, E = 6.2
                   *->DAaqlAElqeSadaTkalt<-*
                      D+ q+  ++ S d Tka++
  gi|1341032  1200    DPGQW--VSHSPDGTKAVH    1216

SPDY: domain 1 of 1, from 1206 to 1228: score 4.0, E = 2.6
                   *->agSPDgrarlgydpdaDehgregdgpag<-*
                       +SPDg+ ++ + p     +++g++p++
  gi|1341032  1206    SHSPDGTKAVHDSP-----FPPGHDPQW    1228

Albicidin_res: domain 1 of 1, from 1227 to 1250: score 2.2, E = 3.7
                   *->eWpaLVaevRaamdagvdrPdspra<-*
                      +W+   a +++a ++g + Pd p+a
  gi|1341032  1227    QWVKHGAQAQDAVRRGIP-PDHPQA    1250

S-AdoMet_synt_M: domain 1 of 1, from 1279 to 1286: score 0.9, E = 9.7
                   *->hInPsGrF<-*
                      hI P+G F
  gi|1341032  1279    HISPTGDF    1286

RnaseA: domain 1 of 1, from 1346 to 1354: score 2.6, E = 1.6
                CS    EEEEEEEEC
                   *->vPVHFDasv<-*
                      vPVHFD+
  gi|1341032  1346    VPVHFDGNQ    1354

Kelch_2: domain 1 of 1, from 1357 to 1375: score 3.3, E = 6.7
                   *->dllvldpetnvWeelpalp<-*
                      dl+ ++p+tn+We+ +++
  gi|1341032  1357    DLGRFHPQTNRWEWFNPPA    1375

HA: domain 1 of 1, from 1687 to 1702: score 2.9, E = 5.7
                   *->kLtpeqqelLeaLgft<-*
                      +  pe+++lLe+Lg +
  gi|1341032  1687    TAEPERRTLLERLGDV    1702

PSD1: domain 1 of 1, from 1735 to 1753: score 0.6, E = 5.4
                   *->lsRpPtdeEreelvtflqe<-*
                      lsR +t+e+ ++++++ ++
  gi|1341032  1735    LSRVATAEDAAAFERLCTA    1753

LRV: domain 2 of 2, from 1760 to 1775: score 1.9, E = 28
                CS    ..S-GGGGGGGTT-SS
                   *->PdlPpeaLerLaaDpd<-*
                      P +P e++++ +a pd
  gi|1341032  1760    PAAPDELVRARVAHPD    1775

NikR_C: domain 1 of 1, from 1786 to 1795: score 1.8, E = 9.2
                CS    EEEEEEEEET
                   *->vGtitlVYDH<-*
                       + +t++YDH
  gi|1341032  1786    SALLTYTYDH    1795

Rod-binding: domain 1 of 1, from 1803 to 1810: score 3.5, E = 3.5
                   *->KsMRkaPtp<-*
                      KsMR++ tp
  gi|1341032  1803    KSMREG-TP    1810

4_1_CTD: domain 1 of 1, from 1877 to 1891: score 1.4, E = 5.8
                   *->kteissksVpivnte<-*
                      +te+ s+ Vp +++e
  gi|1341032  1877    GTEVESRHVPDGHRE    1891

DUF1792: domain 1 of 1, from 1921 to 1930: score 3.9, E = 1.1
                   *->ViRFGDGEfd<-*
                      V R GDGEf+
  gi|1341032  1921    VLRIGDGEFR    1930

//