hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            157963290.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|157963290|ref|YP_001503324.1|
Accession:      [none]
Description:    hypothetical protein Spea_3476 [Shewanella pealeana ATCC 700345]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
DUF2318         Predicted membrane protein (DUF2318)      9.7      0.039   1
Nodulin         Nodulin                                   1.6        1.2   1
DUF1314         Protein of unknown function (DUF1314)     2.5        1.7   1
Arena_glycoprot Arenavirus glycoprotein                  -0.1          2   1
HrpJ            Hypersensitivity response secretion p     1.7        3.7   1
DUF832          Herpesvirus protein of unknown functi     0.9        6.6   1
Vps53_N         Vps53-like, N-terminal                   -0.3        6.7   1
PDZ             PDZ domain (Also known as DHR or GLGF     2.3        6.8   1
COG2            COG (conserved oligomeric Golgi) comp     1.5          7   1
RTX             RTX N-terminal domain                    -1.8        7.1   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
DUF2318           1/1      47    76 ..     1    30 [.     9.7    0.039
Nodulin           1/1      69    83 ..     1    15 [.     1.6      1.2
RTX               1/1     100   115 ..     1    16 [.    -1.8      7.1
DUF832            1/1     111   135 ..     1    30 [.     0.9      6.6
COG2              1/1     116   131 ..   160   175 .]     1.5        7
PDZ               1/1     119   143 ..    61    86 .]     2.3      6.8
HrpJ              1/1     122   138 ..    66    98 ..     1.7      3.7
Vps53_N           1/1     144   166 ..     1    23 [.    -0.3      6.7
DUF1314           1/1     161   173 ..   177   189 .]     2.5      1.7
Arena_glycoprot   1/1     223   232 ..     1    11 [.    -0.1        2

Alignments of top-scoring domains:
DUF2318: domain 1 of 1, from 47 to 76: score 9.7, E = 0.039
                   *->RkalAkrltsrRlllftvlslliilaalLY<-*
                      R ++A   t+rRl+  +++ ++++l+ lL+
  gi|1579632    47    RGLIANKKTKRRLSHDFPVYWIVLLCLLLF    76

Nodulin: domain 1 of 1, from 69 to 83: score 1.6, E = 1.2
                   *->iLITLFLFIgAaVAE<-*
                      +L  L+LFI  a+AE
  gi|1579632    69    VLLCLLLFINDAIAE    83

RTX: domain 1 of 1, from 100 to 115: score -1.8, E = 7.1
                   *->tlaniKsqlkqglkst<-*
                      tl++iKs+l ++ +s+
  gi|1579632   100    TLTKIKSSLVKAEQSV    115

DUF832: domain 1 of 1, from 111 to 135: score 0.9, E = 6.6
                   *->MeltvpVagvteeneKEqYekwrnilsnFs<-*
                       e++v+ ++v++ +e     ++ ++ls+Fs
  gi|1579632   111    AEQSVSLIIVDSSLE-----QLEALLSGFS    135

COG2: domain 1 of 1, from 116 to 131: score 1.5, E = 7
                   *->lLldldhvveklEkll<-*
                      +L+ +d ++e+lE+ll
  gi|1579632   116    SLIIVDSSLEQLEALL    131

PDZ: domain 1 of 1, from 119 to 143: score 2.3, E = 6.8
                CS    CTTSBHHHHHHHHHTCHSSEEEEEEE
                   *->lenlsheeavlalkgsggsevtLtvl<-*
                      +++ s+e+  ++l g +g ev+L++l
  gi|1579632   119    IVDSSLEQLEALLSGFSG-EVHLLIL    143

HrpJ: domain 1 of 1, from 122 to 138: score 1.7, E = 3.7
                   *->atLaqqnrrlrtlLlqqgSPnLdayLegasgep<-*
                      ++L+q                L+a+L g+sge+
  gi|1579632   122    SSLEQ----------------LEALLSGFSGEV    138

Vps53_N: domain 1 of 1, from 144 to 166: score -0.3, E = 6.7
                   *->kpdfsaleyInqLFPteqSLani<-*
                       +++ + e+Inq +  e  ++n+
  gi|1579632   144    EDNMEPFEQINQALYQEPPYSNV    166

DUF1314: domain 1 of 1, from 161 to 173: score 2.5, E = 1.7
                   *->PtvsnsrilakGS<-*
                      P+ sn +i+ak+S
  gi|1579632   161    PPYSNVSIVAKAS    173

Arena_glycoprot: domain 1 of 1, from 223 to 232: score -0.1, E = 2
                   *->MGQivsFfQEi<-*
                       GQ++++f+E+
  gi|1579632   223    -GQFIGLFEEL    232

//