hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            158336405.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|158336405|ref|YP_001517579.1|
Accession:      [none]
Description:    hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
Haemagg_act     haemagglutination activity domain       124.6      1e-35   1
Big_1           Bacterial Ig-like domain (group 1)       47.2    1.1e-14   2
Chlam_PMP       Chlamydia polymorphic membrane protei    34.7    3.7e-08   5
Fil_haemagg     Haemagluttinin repeat                    10.2      0.032   3
DUF824          Salmonella repeat of unknown function     8.2       0.31   2
DUF2050         Putative pre-mRNA-splicing factor (DU     4.1       0.69   1
Citrate_ly_lig  Citrate lyase ligase C-terminal domai     3.4        1.2   2
Peptidase_M15   D-ala-D-ala dipeptidase                   3.5        1.2   1
Ribul_P_3_epim  Ribulose-phosphate 3 epimerase family     3.0        1.2   2
HtaA            Htaa                                      2.7        1.4   1
X_fast-SP_rel   Xylella fastidiosa surface protein re     3.7        1.4   2
Es2             Nuclear protein Es2                       1.2        1.7   1
THAP            THAP domain                               3.3        1.9   1
NODP            NOTCH protein                             4.5        1.9   1
DUF1323         Protein of unknown function (DUF1323)     3.4        2.2   1
PdxA            Pyridoxal phosphate biosynthetic prot     2.3        2.4   1
Pga1            GPI-Mannosyltransferase II co-activat     2.6        2.4   1
Peptidase_A4    Peptidase A4 family                       0.8        2.8   1
Cupin_1         Cupin                                     2.8        2.8   1
Glyco_hydro_38C Glycosyl hydrolases family 38 C-termi     0.2        3.3   1
DUF823          Salmonella repeat of unknown function     1.0        3.4   2
PKD             PKD domain                                2.2        3.8   1
MucBP           MucBP domain                              2.7        5.6   1
DUF2491         Protein of unknown function (DUF2491)     0.5        5.7   1
Hum_adeno_E3A   Human adenovirus early E3A glycoprote     0.8        5.7   1
DUF2134         Predicted membrane protein (DUF2134)      1.8        5.9   1
Glucodextran_B  Glucodextranase, domain B                 1.9        6.2   1
Disaggr_assoc   Disaggregatase related                    0.4        7.4   1
KNTase_C        KNTase C-terminal domain                 -0.5        7.8   1
Jun             Jun-like transcription factor            -1.0          8   1
HlyD            HlyD family secretion protein             0.6        9.5   1
SEFIR           SEFIR domain                              0.5        9.6   1
Peptidase_C37   Southampton virus-type processing pep    -2.9        9.8   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Haemagg_act       1/1       6   125 ..     1   139 []   124.6    1e-35
DUF1323           1/1      52    76 ..    98   122 .]     3.4      2.2
Hum_adeno_E3A     1/1     105   122 ..     1    20 [.     0.8      5.7
DUF2050           1/1     121   134 ..   143   156 .]     4.1     0.69
Cupin_1           1/1     149   179 ..     1    39 [.     2.8      2.8
HlyD              1/1     234   269 ..   283   321 .]     0.6      9.5
Glyco_hydro_38C   1/1     305   351 ..     1    43 [.     0.2      3.3
Peptidase_M15     1/1     316   331 ..     1    16 [.     3.5      1.2
PdxA              1/1     490   502 ..   298   310 .]     2.3      2.4
Pga1              1/1     492   507 ..     1    16 [.     2.6      2.4
Glucodextran_B    1/1     533   555 ..     1    26 [.     1.9      6.2
Chlam_PMP         1/5     573   596 ..     1    19 []     2.4       23
Fil_haemagg       1/3     573   603 ..    49    75 .]     5.7     0.66
Chlam_PMP         2/5     603   620 ..     1    18 [.    10.7     0.13
Chlam_PMP         3/5     634   652 ..     1    19 []    10.1     0.19
Chlam_PMP         4/5     668   685 ..     1    19 []     4.3      6.9
Chlam_PMP         5/5     699   717 ..     1    19 []     7.2      1.2
Peptidase_C37     1/1     703   709 ..   613   619 .]    -2.9      9.8
Disaggr_assoc     1/1     788   795 ..   198   205 .]     0.4      7.4
KNTase_C          1/1     794   813 ..    62    81 ..    -0.5      7.8
PKD               1/1     918   936 ..     1    33 [.     2.2      3.8
MucBP             1/1     925   947 ..    81   108 .]     2.7      5.6
Es2               1/1     941   986 ..   452   491 .]     1.2      1.7
Ribul_P_3_epim    1/2     966   975 ..   201   210 .]     1.5      3.4
X_fast-SP_rel     1/2     997  1028 ..    39    70 .]     1.7      5.7
Big_1             1/2    1007  1075 ..    20    90 ..    22.7  7.9e-07
Fil_haemagg       2/3    1011  1104 ..     1    70 [.     4.0        2
DUF824            1/2    1015  1032 ..    16    33 ..     4.1      4.1
Citrate_ly_lig    1/2    1026  1036 ..   180   190 .]     1.7      3.6
DUF2134           1/1    1041  1092 ..     1    59 [.     1.8      5.9
DUF823            1/2    1051  1062 ..     1    12 [.     0.8      4.1
Peptidase_A4      1/1    1061  1073 ..   215   228 .]     0.8      2.8
Ribul_P_3_epim    2/2    1068  1077 ..   201   210 .]     1.5      3.4
SEFIR             1/1    1075  1100 ..   130   156 ..     0.5      9.6
HtaA              1/1    1080  1090 ..   186   196 .]     2.7      1.4
X_fast-SP_rel     2/2    1099  1130 ..    39    70 .]     2.0      4.5
Big_1             2/2    1109  1179 ..    20    92 ..    24.5    2e-07
Fil_haemagg       3/3    1113  1178 ..     1    75 []     0.5       20
DUF824            2/2    1117  1134 ..    16    33 ..     4.1      4.1
Citrate_ly_lig    2/2    1128  1138 ..   180   190 .]     1.7      3.6
DUF823            2/2    1153  1173 ..     1    21 [.     0.3      5.9
DUF2491           1/1    1176  1190 ..   227   241 .]     0.5      5.7
THAP              1/1    1225  1238 ..    81    94 .]     3.3      1.9
NODP              1/1    1232  1253 ..    44    66 .]     4.5      1.9
Jun               1/1    1240  1248 ..   293   303 .]    -1.0        8

Alignments of top-scoring domains:
Haemagg_act: domain 1 of 1, from 6 to 125: score 124.6, E = 1e-35
                CS    X---EE-TT-EEE-...-TTS--EEE-----TTSEEEEEEEE--B-T
                   *->aqslpdgglvtngtvtiqatgvpitggtipqtsgnlfisfssFnVgq
                      aqs+ ++  +t+++vt ++  + i gg+ + ++ nlf+sf++F  +q
  gi|1583364     6    AQSIVTEPNGTQTIVTADGKRFNISGGSLSGDGANLFHSFKKFGLSQ 52

                CS TEEEEEE-SSEEETTTEEE---TT-.SS--SEEEEEE-SS--EEEEEEEE
                   ggtvlFnatqgqSqLgGnltgNpnLapgaasnIlNRVTGgnaSqIqGlle
                   g+ ++F   +                ++ ++nIl RV Gg+aS+I+Gl++
  gi|1583364    53 GEIATFL--S----------------NPGIQNILGRVNGGDASIINGLIQ 84

                CS EEE.S-EEEEEE-TT-EEEEEEEEESEEEEEEE-SEEEEETT
                   vlGganAnVfLaNPNGIifgggAfiNvgglfvtTgaisikff<-*
                   v+G +nAn++L+NP+GI+fg++A+iNv+  f +T+a  i f+
  gi|1583364    85 VQG-SNANLYLMNPAGIVFGPNATINVPADFRATTATGIGFE    125

DUF1323: domain 1 of 1, from 52 to 76: score 3.4, E = 2.2
                   *->QeklaslLsREGIrglLqRLgIres<-*
                      Q  +a +Ls  GI ++L R    ++
  gi|1583364    52    QGEIATFLSNPGIQNILGRVNGGDA    76

Hum_adeno_E3A: domain 1 of 1, from 105 to 122: score 0.8, E = 5.7
                   *->mtdttnapttdyrnatAtGL<-*
                        ++t+   +d+r +tAtG+
  gi|1583364   105    --NATINVPADFRATTATGI    122

DUF2050: domain 1 of 1, from 121 to 134: score 4.1, E = 0.69
                   *->SNGFEkkwFekqne<-*
                      + GFEk wF+  ++
  gi|1583364   121    GIGFEKGWFNTIGD    134

Cupin_1: domain 1 of 1, from 149 to 179: score 2.8, E = 2.8
                CS    EECCCSSC...SEEEETTEEEEEECTTTCTGCCHHHTTE
                   *->fnllepspgfADvynsegGrlttansnnlPkglltlggs<-*
                      fn+++p+     ++n  +G+l +a  +nl+  l +  ++
  gi|1583364   149    FNTDQPGS----IVN--AGNLAVAKGQNLS--LIGGTVV    179

HlyD: domain 1 of 1, from 234 to 269: score 0.6, E = 9.5
                CS    ---------------------------------------
                   *->vavvnidkvvqglpVeigldpGafnqsttplvpGevviv<-*
                      ++++  ++v+ g++V++       ++  tp+ +G+v+i
  gi|1583364   234    LLTGGDVPVATGVEVDAAGR---TWLLNTPVATGDVAIS    269

Glyco_hydro_38C: domain 1 of 1, from 305 to 351: score 0.2, E = 3.3
                CS    EEEEEEE-SSS-EEEEEEEEES-S-EEE ETT.. .. . .......
                   *->epvvvfNpLawtrnevVripvsspnvsv.desge.it.e.ailaeed
                        v+ fN  + + ne+V ++   p + +    +e +t+  ai++ e+
  gi|1583364   305    PIVTRFNADGTNANELVFLDTTVPDYQRlLFGTEaGTtTvAIPVSEN 351

                CS
                   <-*

  gi|1583364     -     -

Peptidase_M15: domain 1 of 1, from 316 to 331: score 3.5, E = 1.2
                CS    --TTEEEGGGTSTT-E
                   *->kelglvdlaevvpDvr<-*
                       +++lv+l+  vpD++
  gi|1583364   316    NANELVFLDTTVPDYQ    331

PdxA: domain 1 of 1, from 490 to 502: score 2.3, E = 2.4
                CS    -THHHHHHHHHHH
                   *->dpgSliaAlklAa<-*
                      d+ SliaA++lA
  gi|1583364   490    DAASLIAAINLAN    502

Pga1: domain 1 of 1, from 492 to 507: score 2.6, E = 2.4
                   *->ialvaLCalvlANTET<-*
                      ++l+a + l+ +NTET
  gi|1583364   492    ASLIAAINLANGNTET    507

Glucodextran_B: domain 1 of 1, from 533 to 555: score 1.9, E = 6.2
                CS    --EEEEES-SEEE-SSSEEEEEEEE-
                   *->PeLsvtaPeaLstADsAtavvrGtta<-*
                         s+taPe+L+     ++  r tta
  gi|1583364   533    ---SITAPEKLTINGMGNTLARDTTA    555

Chlam_PMP: domain 1 of 5, from 573 to 596: score 2.4, E = 23
                   *->ditFsgNsa.....aggGGAiyas<-*
                      dit++g +a++++++ +GGAi+++
  gi|1583364   573    DITLTGGIAnsggqGDDGGAIHNR    596

Fil_haemagg: domain 1 of 3, from 573 to 603: score 5.7, E = 0.66
                CS    .............    .EEEEESS-EEEEE
                   *->dlllaagalrngg....dltltaaGdLdnsg<-*
                      d++l++g++++gg+++++++++++G+L++++
  gi|1583364   573    DITLTGGIANSGGqgddGGAIHNRGTLTVNN    603

Chlam_PMP: domain 2 of 5, from 603 to 620: score 10.7, E = 0.13
                   *->ditFsgNsaaggGGAiya<-*
                      +++++gN+aa +GGAi++
  gi|1583364   603    NSIITGNTAADDGGAISS    620

Chlam_PMP: domain 3 of 5, from 634 to 652: score 10.1, E = 0.19
                   *->ditFsgNsaaggGGAiyas<-*
                      ++t+sgN+a g+GGA++++
  gi|1583364   634    NSTISGNTAMGNGGALSNT    652

Chlam_PMP: domain 4 of 5, from 668 to 685: score 4.3, E = 6.9
                   *->ditFsgNsaaggGGAiyas<-*
                      ++t++gN a + GG+i
  gi|1583364   668    NSTITGNNA-NVGGGIAQL    685

Chlam_PMP: domain 5 of 5, from 699 to 717: score 7.2, E = 1.2
                   *->ditFsgNsaaggGGAiyas<-*
                      ++t+sgN++  gGG+iy++
  gi|1583364   699    NSTISGNTVVFGGGGIYNR    717

Peptidase_C37: domain 1 of 1, from 703 to 709: score -2.9, E = 9.8
                   *->SGNTVIC<-*
                      SGNTV+
  gi|1583364   703    SGNTVVF    709

Disaggr_assoc: domain 1 of 1, from 788 to 795: score 0.4, E = 7.4
                   *->sSPCIdAG<-*
                      +SP IdAG
  gi|1583364   788    NSPIIDAG    795

KNTase_C: domain 1 of 1, from 794 to 813: score -0.5, E = 7.8
                   *->aGAMLIGLHnrilysTsAsV<-*
                      aG  LIG  n+ +++Ts  V
  gi|1583364   794    AGNNLIGVDNQGIFTTSTLV    813

PKD: domain 1 of 1, from 918 to 936: score 2.2, E = 3.8
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SS
                   *->vsasaveegpsvvalgetVtFtassSydpdpGs<-*
                      +++s           g++VtFta+   +p+ G+
  gi|1583364   918    LPVS-----------GLNVTFTATP--SPT-GA    936

MucBP: domain 1 of 1, from 925 to 947: score 2.7, E = 5.6
                   *->VvgqvTptlkdt.lpvnvtYtfngtiqtV<-*
                      V      t ++t++p+ +t+ fng++ t
  gi|1583364   925    V------TFTATpSPTGATGSFNGNPTTT    947

Es2: domain 1 of 1, from 941 to 986: score 1.2, E = 1.7
                   *->akrnlksPvgrtprfsssprlafGsrTPgaa.......k.LtPAAqr
                      +++++++ v+++ + ++ p l   + T +++   ++++++LtPA  +
  gi|1583364   941    NGNPTTTVVTNATGVATAPTLT--ANTVAGSyvissssGtLTPASFN 985

                   L<-*
                   L
  gi|1583364   986 L    986

Ribul_P_3_epim: domain 1 of 2, from 966 to 975: score 1.5, E = 3.4
                CS    ECCHHHCTSS
                   *->VaGSAvFgap<-*
                      VaGS+v++++
  gi|1583364   966    VAGSYVISSS    975

X_fast-SP_rel: domain 1 of 2, from 997 to 1028: score 1.7, E = 5.7
                   *->tYsGGnLKsvvDEAAGaiHLqLADsPKFGnvl<-*
                      t sGGn +s     A a  L +    +FGn +
  gi|1583364   997    TISGGNDQSTTVNTAFANTLDVTVTDQFGNLV    1028

Big_1: domain 1 of 2, from 1007 to 1075: score 22.7, E = 7.9e-07
                CS    ESSSS--EEEEEEEEETTTEE-TT-EEEE.....EESSSEES-S.E.
                   *->vAngndaiTlTAtVkDanGnPVagqeVtFtvpsdvsssgtlsngntk
                      ++n++ a+Tl +tV+D++Gn+V++ + + + ps +++s tls++ t
  gi|1583364  1007    TVNTAFANTLDVTVTDQFGNLVPNTTLNYSAPS-TGASSTLSAT-T- 1050

                CS EEE-TTSEEEEEEE-S S-EEEEEE
                   atTdanGkAtvtLTst.kaGtytVt<-*
                   atTd+nG+A v+ T+++ aG+y+++
  gi|1583364  1051 ATTDSNGVARVSATGNtVAGSYVIS    1075

Fil_haemagg: domain 2 of 3, from 1011 to 1104: score 4.0, E = 2
                CS    EEESSEEEETT                   TT--EE-SEEEEEE-ST
                   *->vaaGaltlnaa...................alggldlnnggtlsagg
                      + a++l+++++++ ++  ++++ + + ++++++++ +++++t +++g
  gi|1583364  1011    AFANTLDVTVTdqfgnlvpnttlnysapstGASSTLSATTATTDSNG 1057

                CS T-EEEE-S-EEESSE..................     .EEEEESS-
                   gltltaagllnnggtliaggdlllaagalrngg.....dltltaaGd<-*
                      ++a+g   +g   i+++  +la  +++ +++++ ++l  +++G+
  gi|1583364  1058 VARVSATGNTVAGSYVISSSSGTLAPVSFNLTNtpdvpALLTISGGN    1104

DUF824: domain 1 of 2, from 1015 to 1032: score 4.1, E = 4.1
                   *->pltVTvKDaaGnPvpnvp<-*
                      +l VTv+D  Gn vpn++
  gi|1583364  1015    TLDVTVTDQFGNLVPNTT    1032

Citrate_ly_lig: domain 1 of 2, from 1026 to 1036: score 1.7, E = 3.6
                   *->kLVPaTTlqYL<-*
                      +LVP TTl+Y
  gi|1583364  1026    NLVPNTTLNYS    1036

DUF2134: domain 1 of 1, from 1041 to 1092: score 1.8, E = 5.9
                   *->AAAqrlsdgsaaaanssaaaaaaAaaaaarngfgggdlalslsvecG
                       A   ls+++a    +++++   A  +a+ n  +g++   ++s ++G
  gi|1583364  1041    GASSTLSATTA----TTDSN-GVARVSATGNTVAGSY---VISSSSG 1079

                   ywnat.daaadsp<-*
                   ++++ + + +++p
  gi|1583364  1080 TLAPVsFNLTNTP    1092

DUF823: domain 1 of 2, from 1051 to 1062: score 0.8, E = 4.1
                   *->GvTgAdGtatft<-*
                      ++T+++G a ++
  gi|1583364  1051    ATTDSNGVARVS    1062

Peptidase_A4: domain 1 of 1, from 1061 to 1073: score 0.8, E = 2.8
                CS    EEEETTE.EEEEE-
                   *->cSVSGtTtVTveYV<-*
                      +S +G T V  +YV
  gi|1583364  1061    VSATGNT-VAGSYV    1073

Ribul_P_3_epim: domain 2 of 2, from 1068 to 1077: score 1.5, E = 3.4
                CS    ECCHHHCTSS
                   *->VaGSAvFgap<-*
                      VaGS+v++++
  gi|1583364  1068    VAGSYVISSS    1077

SEFIR: domain 1 of 1, from 1075 to 1100: score 0.5, E = 9.6
                   *->sealrkyivvyFsgyskkkdvPtpLri<-*
                      s++ ++ ++v F ++++++dvP++L+i
  gi|1583364  1075    SSSSGTLAPVSF-NLTNTPDVPALLTI    1100

HtaA: domain 1 of 1, from 1080 to 1090: score 2.7, E = 1.4
                   *->aLDPvslsltl<-*
                      +L+Pvs++lt+
  gi|1583364  1080    TLAPVSFNLTN    1090

X_fast-SP_rel: domain 2 of 2, from 1099 to 1130: score 2.0, E = 4.5
                   *->tYsGGnLKsvvDEAAGaiHLqLADsPKFGnvl<-*
                      t sGGn +s     A a  L +    +FGn +
  gi|1583364  1099    TISGGNNQSTTVNTAFANTLDVTVTDQFGNLV    1130

Big_1: domain 2 of 2, from 1109 to 1179: score 24.5, E = 2e-07
                CS    ESSSS--EEEEEEEEETTTEE-TT-EEEE.....EESSSEES-S.E.
                   *->vAngndaiTlTAtVkDanGnPVagqeVtFtvpsdvsssgtlsngntk
                      ++n++ a+Tl +tV+D++Gn+V++ + + + ps +++s tls++ t
  gi|1583364  1109    TVNTAFANTLDVTVTDQFGNLVPNTTLNYSAPS-TGASSTLSAT-T- 1152

                CS EEE-TTSEEEEEEE-S S-EEEEEEEE
                   atTdanGkAtvtLTst.kaGtytVtAs<-*
                   atTd+nG+A+v+ T +++aGt tVtA+
  gi|1583364  1153 ATTDNNGVASVSATANdTAGTFTVTAT    1179

Fil_haemagg: domain 3 of 3, from 1113 to 1178: score 0.5, E = 20
                CS    EEESSEEEETT    TT--EE-SEEEEEE-STT-EEEE-S-EEESSE
                   *->vaaGaltlnaa....alggldlnnggtlsagggltltaagllnnggt
                      + a++l+++++++ ++l   ++ n  + s+g+  tl+a+ + ++ ++
  gi|1583364  1113    AFANTLDVTVTdqfgNLVPNTTLNYSAPSTGASSTLSATTATTDNNG 1159

                CS ...................EEEEESS-EEEEE
                   liaggdlllaagalrnggdltltaaGdLdnsg<-*
                    ++ ++             ++ ++aG++++++
  gi|1583364  1160 VASVSA-------------TANDTAGTFTVTA    1178

DUF824: domain 2 of 2, from 1117 to 1134: score 4.1, E = 4.1
                   *->pltVTvKDaaGnPvpnvp<-*
                      +l VTv+D  Gn vpn++
  gi|1583364  1117    TLDVTVTDQFGNLVPNTT    1134

Citrate_ly_lig: domain 2 of 2, from 1128 to 1138: score 1.7, E = 3.6
                   *->kLVPaTTlqYL<-*
                      +LVP TTl+Y
  gi|1583364  1128    NLVPNTTLNYS    1138

DUF823: domain 2 of 2, from 1153 to 1173: score 0.3, E = 5.9
                   *->GvTgAdGtatftltQdngvGl<-*
                      ++T+ +G a+++ t ++++G+
  gi|1583364  1153    ATTDNNGVASVSATANDTAGT    1173

DUF2491: domain 1 of 1, from 1176 to 1190: score 0.5, E = 5.7
                   *->stslGidLeptDfrv<-*
                      +t++G++++ ++f+
  gi|1583364  1176    VTATGVGVTAGNFTL    1190

THAP: domain 1 of 1, from 1225 to 1238: score 3.3, E = 1.9
                   *->pgAVPTlflghddl<-*
                      +gAVPT++l+ d
  gi|1583364  1225    CGAVPTVNLEVDID    1238

NODP: domain 1 of 1, from 1232 to 1253: score 4.5, E = 1.9
                   *->gLdslpypIesVtSepdepstpe<-*
                      +L +++++I++V++++++p + +
  gi|1583364  1232    NL-EVDIDIPDVQGQTPPPEESQ    1253

Jun: domain 1 of 1, from 1240 to 1248: score -1.0, E = 8
                   *->PevpSfGeSPP<-*
                      P+v   G +PP
  gi|1583364  1240    PDVQ--GQTPP    1248

//