hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            159028785.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|159028785|emb|CAO89956.1|
Accession:      [none]
Description:    unnamed protein product [Microcystis aeruginosa PCC 7806]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
LVIVD           LVIVD repeat                            903.0   1.5e-268  14
Calx-beta       Calx-beta domain                         70.4    2.1e-18   4
PBD             P21-Rho-binding domain                   15.3     0.0016   8
DUF685          Protein of unknown function (DUF685)      5.8       0.17   1
DUF734          Protein of unknown function (DUF734)      6.9        0.2   1
PASTA           PASTA domain                              6.6       0.34   2
Cadherin        Cadherin domain                           6.4        0.4   1
Dynactin_p22    Dynactin subunit p22                      4.6       0.73   1
DUF291          Domain of unknown function                6.3       0.76   1
HSL_N           Hormone-sensitive lipase (HSL) N-term     1.9        1.1   1
Lact_bio_phlase Lacto-N-biose phosphorylase               0.6        2.4   1
Dev_Cell_Death  Development and cell death domain         3.0        2.5   1
Arch_flagellin  Archaebacterial flagellin                 2.0        2.7   1
AsnC_trans_reg  AsnC family                               4.0        2.8   1
DUF2252         Uncharacterized protein conserved in      1.2          3   1
Big_1           Bacterial Ig-like domain (group 1)        2.0        3.2   1
TNV_CP          Satellite tobacco necrosis virus coat     1.3        3.4   1
ROF             Modulator of Rho-dependent transcript     2.9        4.3   1
Ribosomal_L18p  Ribosomal L18p/L5e family                 2.6        4.4   1
Flagellin_D3    Flagellin D3 domain                       3.1        4.8   1
Chlam_PMP       Chlamydia polymorphic membrane protei     4.8        5.3   1
DUF720          Protein of unknown function (DUF720)      1.7        5.5   1
DNA_III_psi     DNA polymerase III psi subunit            1.7        5.9   1
Glyco_hydro_43  Glycosyl hydrolases family 43            -0.9        6.8   1
BSP_II          Bone sialoprotein II (BSP-II)            -1.4        7.4   1
HMA             Heavy-metal-associated domain             2.0        7.8   1
DUF1176         Protein of unknown function (DUF1176)     0.1        8.1   1
Glucodextran_B  Glucodextranase, domain B                 1.5        8.2   1
Fimbrial_K88    Fimbrial, major and minor subunit         0.2        9.7   1
Cytochrom_D1    Cytochrome D1 heme domain                -0.8        9.7   1
SCPU            Spore Coat Protein U domain               1.8        9.8   2

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
TNV_CP            1/1      38    48 ..   194   204 .]     1.3      3.4
Dynactin_p22      1/1      48    60 ..     1    14 [.     4.6     0.73
AsnC_trans_reg    1/1      63    96 ..     1    36 [.     4.0      2.8
Big_1             1/1      63    95 ..    73   106 .]     2.0      3.2
DNA_III_psi       1/1      69    90 ..    92   113 .]     1.7      5.9
ROF               1/1      77    94 ..    67    86 .]     2.9      4.3
DUF1176           1/1     170   182 ..   374   388 .]     0.1      8.1
LVIVD             1/14    223   260 ..     1    42 []    41.3  3.4e-11
BSP_II            1/1     257   267 ..   302   312 .]    -1.4      7.4
HSL_N             1/1     257   266 ..   306   315 .]     1.9      1.1
LVIVD             2/14    262   301 ..     1    42 []    71.0  7.8e-20
PBD               1/8     286   294 ..     1    10 [.     2.0       10
LVIVD             3/14    302   344 ..     1    42 []    62.1  3.1e-17
PBD               2/8     329   337 ..     1    10 [.     2.0       10
LVIVD             4/14    345   386 ..     1    42 []    78.2  6.1e-22
PBD               3/8     371   378 ..     1     9 [.     1.6       13
Glyco_hydro_43    1/1     375   385 ..     1    11 [.    -0.9      6.8
LVIVD             5/14    388   427 ..     1    42 []    71.5  5.6e-20
PBD               4/8     412   420 ..     1    10 [.     2.0       10
LVIVD             6/14    430   469 ..     1    42 []    65.0  4.2e-18
PBD               5/8     454   462 ..     1    10 [.     2.0       10
LVIVD             7/14    470   511 ..     1    42 []    67.5  8.3e-19
PBD               6/8     496   504 ..     1    10 [.     2.0       10
LVIVD             8/14    512   553 ..     1    42 []    75.7  3.3e-21
LVIVD             9/14    554   595 ..     1    42 []    73.6  1.4e-20
Cytochrom_D1      1/1     566   580 ..    51    65 ..    -0.8      9.7
PBD               7/8     580   588 ..     1    10 [.     2.0       10
LVIVD            10/14    596   637 ..     1    42 []    62.8  1.9e-17
LVIVD            11/14    638   679 ..     1    42 []    67.5  8.3e-19
PBD               8/8     664   672 ..     1    10 [.     2.0       10
LVIVD            12/14    680   721 ..     1    42 []    62.3  2.7e-17
LVIVD            13/14    722   763 ..     1    42 []    68.5  4.2e-19
DUF2252           1/1     725   740 ..   422   437 .]     1.2        3
Fimbrial_K88      1/1     737   760 ..    35    61 ..     0.2      9.7
LVIVD            14/14    764   797 ..     1    34 [.    36.0  1.2e-09
Dev_Cell_Death    1/1     778   789 ..    55    66 ..     3.0      2.5
Ribosomal_L18p    1/1     780   788 ..   137   145 .]     2.6      4.4
Calx-beta         1/4     857   896 ..    68   109 .]     9.4    0.075
PASTA             1/2     858   897 ..    25    73 .]     0.2       25
Flagellin_D3      1/1     861   889 ..    73   100 .]     3.1      4.8
DUF720            1/1     935   952 ..   117   134 .]     1.7      5.5
SCPU              1/2     954   990 ..     1    43 [.     1.6       11
Calx-beta         2/4     960  1009 ..    58   109 .]    12.4    0.012
Glucodextran_B    1/1     960   981 ..    49    70 ..     1.5      8.2
PASTA             2/2     972  1010 ..    29    73 .]     6.4     0.38
HMA               1/1     982  1018 ..    33    64 .]     2.0      7.8
Arch_flagellin    1/1     993  1027 ..   167   208 ..     2.0      2.7
Lact_bio_phlase   1/1     997  1008 ..   768   779 .]     0.6      2.4
Calx-beta         3/4    1022  1125 ..     1   109 []    48.1  2.3e-12
Cadherin          1/1    1043  1060 ..     1    21 [.     6.4      0.4
Chlam_PMP         1/1    1044  1072 ..     1    19 []     4.8      5.3
DUF685            1/1    1074  1097 ..   155   178 ..     5.8     0.17
DUF291            1/1    1089  1106 ..    73    92 .]     6.3     0.76
DUF734            1/1    1092  1106 ..     1    15 [.     6.9      0.2
Calx-beta         4/4    1139  1152 ..     1    14 [.     0.5       20
SCPU              2/2    1229  1239 ..    61    69 .]     0.1       29

Alignments of top-scoring domains:
TNV_CP: domain 1 of 1, from 38 to 48: score 1.3, E = 3.4
                CS    EEEEEEEEE--
                   *->dlgvelvYtDa<-*
                      +l++ +v++Da
  gi|1590287    38    RLTATVVFLDA    48

Dynactin_p22: domain 1 of 1, from 48 to 60: score 4.6, E = 0.73
                   *->MAGLTDLQRLQARV<-*
                       AG TD Q LQA V
  gi|1590287    48    -AGVTDYQTLQAGV    60

AsnC_trans_reg: domain 1 of 1, from 63 to 96: score 4.0, E = 2.8
                CS    EEEEEEE-TT-....HHHHHHHHHT-TTEEEEEEES
                   *->AfvlvkleprhseealdafeealaaiPEVvecyrvt<-*
                       +  v l+p++  + ++++ ++l++ P+++ +++v+
  gi|1590287    63    GIATVILSPNQ--DGIEQITAFLQQNPQITTIHLVS    96

Big_1: domain 1 of 1, from 63 to 95: score 2.0, E = 3.2
                CS    SEEEEEEE-SS-EEEEEEEEET.TECEEEEEEEE
                   *->GkAtvtLTstkaGtytVtAslanngatsvdaktV<-*
                      G+Atv L+++  G  ++tA l+ ++ +  +  +V
  gi|1590287    63    GIATVILSPNQDGIEQITAFLQ-QNPQITTIHLV    95

DNA_III_psi: domain 1 of 1, from 69 to 90: score 1.7, E = 5.9
                CS    ES.....--S..--SSBS-EEE
                   *->LgdNsdeidrldPlskqAqqvl<-*
                      L+ N+d i+ + ++ +q  q+
  gi|1590287    69    LSPNQDGIEQITAFLQQNPQIT    90

ROF: domain 1 of 1, from 77 to 94: score 2.9, E = 4.3
                   *->DqilamtALtenPhFgrvvf<-*
                      +qi+a+   + nP ++++++
  gi|1590287    77    EQITAFL--QQNPQITTIHL    94

DUF1176: domain 1 of 1, from 170 to 182: score 0.1, E = 8.1
                   *->aaGGlsaWplpwrva<-*
                      a GG   W+l  +v+
  gi|1590287   170    ALGG--SWELEVIVS    182

LVIVD: domain 1 of 14, from 223 to 260: score 41.3, E = 3.4e-11
                   *->gGdaqdvsVsGNYAY.VAdgdngLvIVDISNPSsPilkgsydt<-*
                        +a+ v+V GNY Y V+d    L I+DISNPS+Pi+kgsyd+
  gi|1590287   223    --YAYAVTVVGNYGYaVGDT---LEIIDISNPSNPIFKGSYDI    260

BSP_II: domain 1 of 1, from 257 to 267: score -1.4, E = 7.4
                   *->GYdsYdGqDYY<-*
                      +Yd Y+GqD
  gi|1590287   257    SYDIYEGQDVQ    267

HSL_N: domain 1 of 1, from 257 to 266: score 1.9, E = 1.1
                   *->sYDLREGqDs<-*
                      sYD+ EGqD
  gi|1590287   257    SYDIYEGQDV    266

LVIVD: domain 2 of 14, from 262 to 301: score 71.0, E = 7.8e-20
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                      +G  qdv + GNYAYVAd+d gL I+DISNP++P+lkg+ydt
  gi|1590287   262    EG--QDVQIVGNYAYVADDDSGLQIIDISNPTNPTLKGNYDT    301

PBD: domain 1 of 8, from 286 to 294: score 2.0, E = 10
                   *->eIStPLtnFk<-*
                      +IS+P tn++
  gi|1590287   286    DISNP-TNPT    294

LVIVD: domain 3 of 14, from 302 to 344: score 62.1, E = 3.1e-17
                   *->gGdaqdvsVsGNYAYVAdgd.ngLvIVDISNPSsPilkgsydt<-*
                       G+a dv + GNYAYVAdg++ gL I+DISNP++P++kg+y t
  gi|1590287   302    SGTAIDVQIVGNYAYVADGWsGGLQIIDISNPTNPTFKGNYYT    344

PBD: domain 2 of 8, from 329 to 337: score 2.0, E = 10
                   *->eIStPLtnFk<-*
                      +IS+P tn++
  gi|1590287   329    DISNP-TNPT    337

LVIVD: domain 4 of 14, from 345 to 386: score 78.2, E = 6.1e-22
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                       G+a++v V GNYAY+Ad++ gL I+DISNP++Pilkg+ydt
  gi|1590287   345    SGNAWGVQVIGNYAYIADWGSGLQIIDISNPTNPILKGNYDT    386

PBD: domain 3 of 8, from 371 to 378: score 1.6, E = 13
                   *->eIStPLtnF<-*
                      +IS+P tn+
  gi|1590287   371    DISNP-TNP    378

Glyco_hydro_43: domain 1 of 1, from 375 to 385: score -0.9, E = 6.8
                CS    EES-SB-SS--
                   *->yrNPvlpgfyP<-*
                       +NP+l+g y+
  gi|1590287   375    PTNPILKGNYD    385

LVIVD: domain 5 of 14, from 388 to 427: score 71.5, E = 5.6e-20
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                         a+dv+V GNYAYVAd++ gL I+DISNP++P+lkg+ydt
  gi|1590287   388    --RARDVEVVGNYAYVADDWFGLQIIDISNPTNPTLKGNYDT    427

PBD: domain 4 of 8, from 412 to 420: score 2.0, E = 10
                   *->eIStPLtnFk<-*
                      +IS+P tn++
  gi|1590287   412    DISNP-TNPT    420

LVIVD: domain 6 of 14, from 430 to 469: score 65.0, E = 4.2e-18
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                         a +v V GNYAYVA++d gL I+DISNP++P+lkg+ydt
  gi|1590287   430    --AAIGVQVVGNYAYVANEDSGLQIIDISNPTNPTLKGNYDT    469

PBD: domain 5 of 8, from 454 to 462: score 2.0, E = 10
                   *->eIStPLtnFk<-*
                      +IS+P tn++
  gi|1590287   454    DISNP-TNPT    462

LVIVD: domain 7 of 14, from 470 to 511: score 67.5, E = 8.3e-19
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                       G a dv + GNYAYVAdg  gL I+DISNP++P+lkg+y++
  gi|1590287   470    SGAAFDVQIVGNYAYVADGYSGLQIIDISNPTNPTLKGKYNI    511

PBD: domain 6 of 8, from 496 to 504: score 2.0, E = 10
                   *->eIStPLtnFk<-*
                      +IS+P tn++
  gi|1590287   496    DISNP-TNPT    504

LVIVD: domain 8 of 14, from 512 to 553: score 75.7, E = 3.3e-21
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                       G+aqdv V GNYAYVAd+  gL I+DISNP+ P+lkg+y+t
  gi|1590287   512    FGSAQDVQVVGNYAYVADDTSGLQIIDISNPTTPTLKGNYNT    553

LVIVD: domain 9 of 14, from 554 to 595: score 73.6, E = 1.4e-20
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                       G a +v + GNYAYVAd+d gL I+DISNP++P+lkg+y+t
  gi|1590287   554    SGLALGVQIVGNYAYVADRDSGLQIIDISNPTNPTLKGNYNT    595

Cytochrom_D1: domain 1 of 1, from 566 to 580: score -0.8, E = 9.7
                CS    EEEEEETTSEEEEEE
                   *->YvYviGRDGrltliD<-*
                      Y+Yv+ RD +l +iD
  gi|1590287   566    YAYVADRDSGLQIID    580

PBD: domain 7 of 8, from 580 to 588: score 2.0, E = 10
                   *->eIStPLtnFk<-*
                      +IS+P tn++
  gi|1590287   580    DISNP-TNPT    588

LVIVD: domain 10 of 14, from 596 to 637: score 62.8, E = 1.9e-17
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                       G a dv +  NYAYVAd + gL I+DISNP +P+lkg+ydt
  gi|1590287   596    SGLALDVQIVANYAYVADYWSGLQIIDISNPINPTLKGNYDT    637

LVIVD: domain 11 of 14, from 638 to 679: score 67.5, E = 8.3e-19
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                       G a dv + GNYAYVAdg  gL I+DISNP++P+lkg+y++
  gi|1590287   638    SGAAFDVQIVGNYAYVADGYSGLQIIDISNPTNPTLKGKYNI    679

PBD: domain 8 of 8, from 664 to 672: score 2.0, E = 10
                   *->eIStPLtnFk<-*
                      +IS+P tn++
  gi|1590287   664    DISNP-TNPT    672

LVIVD: domain 12 of 14, from 680 to 721: score 62.3, E = 2.7e-17
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                       G+aqdv V GNYAYVAd + gL I+DIS P +P l+g+++t
  gi|1590287   680    FGSAQDVQVVGNYAYVADYNSGLQIIDISSPINPLLVGKCNT    721

LVIVD: domain 13 of 14, from 722 to 763: score 68.5, E = 4.2e-19
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsydt<-*
                       Gda++v V G+YAY Ad+++gL I+DISNP+ Pil+g+++t
  gi|1590287   722    SGDAYGVQVVGDYAYLADAGAGLQIIDISNPTTPILVGKCNT    763

DUF2252: domain 1 of 1, from 725 to 740: score 1.2, E = 3
                   *->aYAdQverDyaaFvkA<-*
                      aY  Qv  Dya + +A
  gi|1590287   725    AYGVQVVGDYAYLADA    740

Fimbrial_K88: domain 1 of 1, from 737 to 760: score 0.2, E = 9.7
                   *->tadatvesgeltItvsdpaslPfLlGk<-*
                      +ada  + g ++I++s p+ +P+L+Gk
  gi|1590287   737    LADA--GAGLQIIDISNPT-TPILVGK    760

LVIVD: domain 14 of 14, from 764 to 797: score 36.0, E = 1.2e-09
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsP<-*
                       Gda++v + GNYAYVA +d gL I+D+S  ++P
  gi|1590287   764    SGDAYGVQIVGNYAYVAASDGGLNIIDVSEFTNP    797

Dev_Cell_Death: domain 1 of 1, from 778 to 789: score 3.0, E = 2.5
                   *->FEAtSnGglnId<-*
                      + A+S+GglnI+
  gi|1590287   778    YVAASDGGLNII    789

Ribosomal_L18p: domain 1 of 1, from 780 to 788: score 2.6, E = 4.4
                CS    HHHCCHB--
                   *->gArEaGLnf<-*
                      +A ++GLn+
  gi|1590287   780    AASDGGLNI    788

Calx-beta: domain 1 of 4, from 857 to 896: score 9.4, E = 0.075
                   *->YeptegtiLtFgPgedtekcinvtiiDDdvyEgdEnFfvrLs<-*
                      +++++gt +tF ++  t  ++ +    D  +E++E+  + L+
  gi|1590287   857    FTSKTGT-VTFAANS-TTAKVTIDPTADTTVENNETVALTLA    896

PASTA: domain 1 of 2, from 858 to 897: score 0.2, E = 25
                   *->tlkegkv.tveeisgtdkssdvgtGkVvsQsPpaGtkvpkgskvtLt
                      t+   k +tv+      + ++  t+k v  +P a t+v+++++v Lt
  gi|1590287   858    TS---KTgTVT------FAANSTTAK-VTIDPTADTTVENNETVALT 894

                   vsk<-*
                   ++
  gi|1590287   895 LAA    897

Flagellin_D3: domain 1 of 1, from 861 to 889: score 3.1, E = 4.8
                CS    -BEEESTT-S --TTSS-TT--EEESEEE
                   *->dGkVtlaaga.ttttaatPagateVTkvq<-*
                      +G+Vt+aa  +t++++ +P++ t+V  +
  gi|1590287   861    TGTVTFAANStTAKVTIDPTADTTVENNE    889

DUF720: domain 1 of 1, from 935 to 952: score 1.7, E = 5.5
                   *->tsaLikTLkdivsiiAnL<-*
                      t+ L+ T+  ++s+++ L
  gi|1590287   935    TQNLLYTFTRMGSTKNAL    952

SCPU: domain 1 of 2, from 954 to 990: score 1.6, E = 11
                   *->lpYqLYqDsgrtevwg.sGqkdvgsatlldtlglgtaqtnttql<-*
                      ++Y+L  ++++++ ++++G+  +++ t++   +++t++     +
  gi|1590287   954    INYNLAGTATLNTDYTrTGT--NNTVTFAAGSSTATVT-----V    990

Calx-beta: domain 2 of 4, from 960 to 1009: score 12.4, E = 0.012
                   *->GTAtaGPgsDYeptegt.iLtFgPgedtekcinvtiiDDdvyEgdEn
                      GTAt +  +DY+ t   +++tF +g  +  ++ v    D   E++E+
  gi|1590287   960    GTATLN--TDYTRTGTNnTVTFAAGS-STATVTVDPTADTTIEPNET 1003

                   FfvrLs<-*
                     + L+
  gi|1590287  1004 VILTLA    1009

Glucodextran_B: domain 1 of 1, from 960 to 981: score 1.5, E = 8.2
                CS    T..EEEEEEE--SSEEEEEEEE
                   *->GtstFslDlALtaaKnkvtvAA<-*
                      Gt+t   D   t++ n+vt AA
  gi|1590287   960    GTATLNTDYTRTGTNNTVTFAA    981

PASTA: domain 2 of 2, from 972 to 1010: score 6.4, E = 0.38
                   *->gkv.tveeisgtdkssdvgtGkVvsQsPpaGtkvpkgskvtLtvsk<
                      g+ +tv+      + ++  t++ v ++P a t+++++++v+Lt++
  gi|1590287   972    GTNnTVT------FAAGSSTAT-VTVDPTADTTIEPNETVILTLAA  1010

                   -*

  gi|1590287     -    -

HMA: domain 1 of 1, from 982 to 1018: score 2.0, E = 7.8
                CS    TTTEEEEEESTT     TSCHHHHHHHHHHTTSEEEE
                   *->etgkltVtgded.....lpklkklveaveiigydarl<-*
                      + +++tVt+d+  +++  p+ +++   ++ +gy+++
  gi|1590287   982    GSSTATVTVDPTadttiEPNETVILTLAAGTGYKVGT    1018

Arch_flagellin: domain 1 of 1, from 993 to 1027: score 2.0, E = 2.7
                   *->ssdpvlnpgdkvaItvtlnlpintdstfvginpstkvrgeVv<-*
                      ++d++++p ++v +t      + ++ + + ++++t+v+g++v
  gi|1590287   993    TADTTIEPNETVILT------LAAGTG-YKVGTTTPVTGTIV    1027

Lact_bio_phlase: domain 1 of 1, from 997 to 1008: score 0.6, E = 2.4
                   *->eLkAneilWfdi<-*
                      ++++ne++++++
  gi|1590287   997    TIEPNETVILTL    1008

Calx-beta: domain 3 of 4, from 1022 to 1125: score 48.1, E = 2.3e-12
                   *->atvtIlDdd...dagvvgFeptvyqVsVlEndGevevcVvrmggape
                      +t tI  dd+++ +g+++F  +++++  ++ + +  v+V+r+gg
  gi|1590287  1022    VTGTIVNDDtpsSPGTLSFGSPTFSIN-ENGTPVTAVTVTRTGG--- 1064

                   lrrtVtVsyrTeDGTAtaGPgsDYeptegtiLtFgPgedtekcinvtiiD
                    ++ V+  ++  +GTAta P sDY+  + t + F +ge   k++ v+i++
  gi|1590287  1065 SNGAVSATVKLTNGTATA-P-SDYNNNSIT-VNFANGE-ISKTVTVPIVN 1110

                   DdvyEgdEnFfvrLs<-*
                   D   E+dE+  ++L
  gi|1590287  1111 DTLPEPDETVQLILI    1125

Cadherin: domain 1 of 1, from 1043 to 1060: score 6.4, E = 0.4
                CS    --EEE-SS...S---EEEEE-
                   *->ysasvpEnapvGtevltvtAt<-*
                      +++s+ En   Gt+v+ vt+t
  gi|1590287  1043    PTFSINEN---GTPVTAVTVT    1060

Chlam_PMP: domain 1 of 1, from 1044 to 1072: score 4.8, E = 5.3
                   *->ditFsgNsa..........aggGGAiyas<-*
                      + ++++N+++ +  + ++++g++GA++a+
  gi|1590287  1044    TFSINENGTpvtavtvtrtGGSNGAVSAT    1072

DUF685: domain 1 of 1, from 1074 to 1097: score 5.8, E = 0.17
                   *->eltksttiYPsdYknqaitidmen<-*
                      +lt +t   PsdY+n++it++  n
  gi|1590287  1074    KLTNGTATAPSDYNNNSITVNFAN    1097

DUF291: domain 1 of 1, from 1089 to 1106: score 6.3, E = 0.76
                   *->tatLTFdFsaGaTadpvLtv<-*
                      + ++T++F +G  +++++tv
  gi|1590287  1089    N-SITVNFANGE-ISKTVTV    1106

DUF734: domain 1 of 1, from 1092 to 1106: score 6.9, E = 0.2
                   *->LinLaKGvvpsnvdv<-*
                      ++n+a+G+++++v+v
  gi|1590287  1092    TVNFANGEISKTVTV    1106

Calx-beta: domain 4 of 4, from 1139 to 1152: score 0.5, E = 20
                   *->atvtIlDdddagvv<-*
                      at +I D+d a+ +
  gi|1590287  1139    ATLNIVDNDAAILI    1152

SCPU: domain 2 of 2, from 1229 to 1239: score 0.1, E = 29
                   *->tYq..DTlsVt<-*
                      tY+++DT++V+
  gi|1590287  1229    TYTsnDTFTVN    1239

//