hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            160897962.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|160897962|ref|YP_001563544.1|
Accession:      [none]
Description:    YD repeat-containing protein [Delftia acidovorans SPH-1]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
RHS_repeat      RHS Repeat                              227.6    3.2e-65  12
RHS             RHS protein                              73.6      1e-22   2
PAAR_motif      PAAR motif                                9.6       0.12   2
Phe_hydrox_dim  Phenol hydroxylase, C-terminal dimeri     5.7       0.24   1
CMD             Carboxymuconolactone decarboxylase fa     7.4       0.33   1
Trp_leader2     Tryptophan operon leader peptide          4.0       0.75   1
Glyco_hydro_6   Glycosyl hydrolases family 6              3.0        1.2   1
Troponin        Troponin                                  4.5        1.3   1
GalP_UDP_tr_C   Galactose-1-phosphate uridyl transfer     3.9        1.5   1
MOSC            MOSC domain                               4.4        1.5   1
DUF883          Bacterial protein of unknown function     4.1        2.6   1
DUF2220         Uncharacterized protein conserved in      1.2        2.6   1
HrpA_pilin      HrpA pilus formation protein              0.8        2.8   1
HIPIP           High potential iron-sulfur protein        1.8        3.3   1
Amidohydro_2    Amidohydrolase                            1.7        3.3   1
DUF2135         Uncharacterized protein conserved in      3.5        3.9   1
DUF1052         Protein of unknown function (DUF1052)     1.3        3.9   1
Lipocalin_2     Lipocalin-like domain                     2.2          4   1
Glucodextran_N  Glucodextranase, domain N                -0.6        4.7   1
RNA_pol_Rpb2_3  RNA polymerase Rpb2, domain 3             2.9        4.8   1
DUF2505         Protein of unknown function (DUF2505)     1.3        5.1   1
DUF1612         Protein of unknown function (DUF1612)    -2.0        5.1   1
DUF2063         Uncharacterized protein conserved in      2.3        5.2   1
HlyC            RTX toxin acyltransferase family          1.2        5.7   1
DUF1630         Protein of unknown function (DUF1630)    -0.8          6   1
MR_MLE_N        Mandelate racemase / muconate lactoni     0.9        6.4   1
APH_6_hur       Aminoglycoside/hydroxyurea antibiotic     1.4        6.5   1
FTZ             Fushi tarazu (FTZ), N-terminal region    -0.5        7.6   1
MdcG            Phosphoribosyl-dephospho-CoA transfer    -0.2        7.8   1
DUF2109         Predicted membrane protein (DUF2109)      1.7          8   1
CSF-1           Macrophage colony stimulating factor-    -0.5        8.1   1
Amidase_5       Bacteriophage peptidoglycan hydrolase     0.6        8.2   1
DUF2117         Uncharacterized protein conserved in     -0.0        9.1   1
DUF2084         Uncharacterized protein conserved in      1.0        9.1   1
TBP             Transcription factor TFIID (or TATA-b     1.8        9.4   1
GSPII_N         Bacterial type II secretion system pr    -0.4        9.8   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
PAAR_motif        1/2       2    16 ..    11    25 .]     6.4        1
MOSC              1/1      14    50 ..   137   172 .]     4.4      1.5
PAAR_motif        2/2      18    30 ..     1    13 [.     3.2      8.3
Glyco_hydro_6     1/1      48    75 ..     1    29 [.     3.0      1.2
RNA_pol_Rpb2_3    1/1      86    97 ..    52    63 ..     2.9      4.8
FTZ               1/1     161   174 ..   298   311 .]    -0.5      7.6
RHS_repeat        1/12    240   254 ..    25    44 .]     2.1      9.7
APH_6_hur         1/1     270   280 ..   261   271 .]     1.4      6.5
RHS_repeat        2/12    310   345 ..     1    42 [.    15.4   0.0016
Amidohydro_2      1/1     337   428 ..     1    61 [.     1.7      3.3
Amidase_5         1/1     346   359 ..   140   155 .]     0.6      8.2
RHS_repeat        3/12    429   466 ..     1    44 []    26.1  1.5e-06
RHS_repeat        4/12    471   509 ..     1    44 []    37.4    9e-10
RHS               1/2     492   506 ..    27    41 .]     5.0     0.73
CSF-1             1/1     516   534 ..   293   311 .]    -0.5      8.1
RHS_repeat        5/12    542   579 ..     1    44 []    31.5  4.2e-08
GSPII_N           1/1     583   595 ..   242   257 .]    -0.4      9.8
RHS_repeat        6/12    584   620 ..     1    44 []    19.3  0.00012
HrpA_pilin        1/1     603   624 ..   102   125 ..     0.8      2.8
RHS_repeat        7/12    637   673 ..     1    44 []    24.5  4.1e-06
DUF1052           1/1     651   673 ..   136   158 .]     1.3      3.9
RHS_repeat        8/12    678   715 ..     1    44 []    15.6   0.0014
DUF1612           1/1     723   731 ..   187   195 ..    -2.0      5.1
RHS_repeat        9/12    723   769 ..     1    44 []    12.9   0.0081
MR_MLE_N          1/1     749   765 ..   113   129 .]     0.9      6.4
DUF2084           1/1     778   791 ..    19    32 ..     1.0      9.1
DUF2505           1/1     812   825 ..     1    14 [.     1.3      5.1
DUF2109           1/1     818   828 ..    68    78 .]     1.7        8
HlyC              1/1     828   842 ..     1    15 [.     1.2      5.7
DUF2220           1/1     889   905 ..     1    19 [.     1.2      2.6
RHS_repeat       10/12    894   946 ..     1    44 []    11.0    0.029
HIPIP             1/1     913   921 ..     1     9 [.     1.8      3.3
RHS_repeat       11/12    958   987 ..     1    29 [.    20.6  5.4e-05
Glucodextran_N    1/1     990   997 ..     1     8 [.    -0.6      4.7
GalP_UDP_tr_C     1/1     994  1016 ..   199   221 .]     3.9      1.5
RHS_repeat       12/12   1074  1123 ..     1    44 []    11.0    0.029
CMD               1/1    1079  1100 ..    28    51 ..     7.4     0.33
DUF883            1/1    1086  1118 ..    34    66 ..     4.1      2.6
Lipocalin_2       1/1    1127  1139 ..   144   156 .]     2.2        4
TBP               1/1    1148  1163 ..    28    44 ..     1.8      9.4
MdcG              1/1    1162  1189 ..    12    49 ..    -0.2      7.8
DUF1630           1/1    1204  1220 ..   652   668 .]    -0.8        6
DUF2063           1/1    1215  1233 ..     1    19 [.     2.3      5.2
Troponin          1/1    1247  1268 ..    40    62 ..     4.5      1.3
Trp_leader2       1/1    1256  1270 ..     1    16 [.     4.0     0.75
RHS               2/2    1269  1309 ..     1    41 []    68.5    4e-21
DUF2135           1/1    1394  1404 ..     1    11 [.     3.5      3.9
Phe_hydrox_dim    1/1    1406  1428 ..    10    41 ..     5.7     0.24
DUF2117           1/1    1445  1468 ..    52    77 ..    -0.0      9.1

Alignments of top-scoring domains:
PAAR_motif: domain 1 of 2, from 2 to 16: score 6.4, E = 1
                   *->nGkPAARlGDsvvCp<-*
                      +GkPAAR +Dsvv +
  gi|1608979     2    SGKPAARITDSVVKG    16

MOSC: domain 1 of 1, from 14 to 50: score 4.4, E = 1.5
                CS    ......  HHHHHCCTSS-EEEEEEE-EEEETTSEEEE
                   *->rdgkgl..fgrnlaagkrGiyarVlrpGtirvGDevel<-*
                      ++gk++++  ++l+  ++G+ + V +pG i+vG +v +
  gi|1608979    14    VKGKIVtgSLTVLIGSQGGLACSV-CPGGITVGSPVNP    50

PAAR_motif: domain 2 of 2, from 18 to 30: score 3.2, E = 8.3
                   *->iieGspnvkvnGk<-*
                      i++Gs++v ++++
  gi|1608979    18    IVTGSLTVLIGSQ    30

Glyco_hydro_6: domain 1 of 1, from 48 to 75: score 3.0, E = 1.2
                CS    --CCCHHHHHHHCGGCT-CCHHHHHHHCT
                   *->vnPksaaevwvaArnpgDgrlaaiaekVA<-*
                      vnP+  a+v   A + +D++l+ +a  VA
  gi|1608979    48    VNPQLGAKVLLGA-QDLDFALPSAALPVA    75

RNA_pol_Rpb2_3: domain 1 of 1, from 86 to 97: score 2.9, E = 4.8
                   *->PErGqncGLvns<-*
                      PE+G++cGL+ +
  gi|1608979    86    PEHGAACGLLGH    97

FTZ: domain 1 of 1, from 161 to 174: score -0.5, E = 7.6
                   *->aadFnWsHiEEtlA<-*
                      aa+  WsH+E +l
  gi|1608979   161    AANPRWSHVEQALV    174

RHS_repeat: domain 1 of 12, from 240 to 254: score 2.1, E = 9.7
                   *->aagrltaltlttstdasGtt<-*
                      +agrl++l      d+ G++
  gi|1608979   240    PAGRLVSL-----SDGTGRR    254

APH_6_hur: domain 1 of 1, from 270 to 280: score 1.4, E = 6.5
                   *->glSaaWfiEDG<-*
                      gl+++W ++DG
  gi|1608979   270    GLNGLWGADDG    280

RHS_repeat: domain 2 of 12, from 310 to 345: score 15.4, E = 0.0016
                   *->YDanGrLtavtdpsgpvgqt.YrYDaagrltaltlttstdasG<-*
                      Y+++G+L++v d +g+ + +++++D+ +r+ a+     + asG
  gi|1608979   310    YSSAGDLITVHDRAGQLV-ReFEWDH-HRISAH-----RHASG    345

Amidohydro_2: domain 1 of 1, from 337 to 428: score 1.7, E = 3.3
                CS    EEBS--.                          ....... ... ..
                   *->iDaHaHl..........................pvpglay.rrl.dr
                      i aH H +++ ++ + ++ +++ +  +++++++  ++++y ++++++
  gi|1608979   337    ISAHRHAsgpwhryryesaqpgarviehsnqegLSYRFDYlAQPpGP 383

                CS . -B-CC HHHHTT--SS--S-B-HHHHHHHHHH S--EE--B--
                   p.psdpg.rlpamvrrgydprdaspadllvlgaa.gvaravivaa<-*
                   +++ ++++r  ++ +r  +++ +++a l+ l+a++ ++++   +a
  gi|1608979   384 DgQPRAAtRVSDSLDRIETYYFEGAAGLSRLIAHhKADGSRWLQA    428

Amidase_5: domain 1 of 1, from 346 to 359: score 0.6, E = 8.2
                   *->psYvYvwRlnggasqp<-*
                      p++ Y  R+ ++++++
  gi|1608979   346    PWHRY--RYESAQPGA    359

RHS_repeat: domain 3 of 12, from 429 to 466: score 26.1, E = 1.5e-06
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      YD+ GrL + tdp g+++ ++r D+ grl+ +       ++G+
  gi|1608979   429    YDSFGRLASRTDPLGRSV-HLRRDGQGRLIGV-----QLPDGRS    466

RHS_repeat: domain 4 of 12, from 471 to 509: score 37.4, E = 9e-10
                   *->YD.anGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-
                      +D+a+GrL++ td++g+++  Y+YDa+grlt++     t a+G t
  gi|1608979   471    HDeATGRLLQSTDTAGATT-GYQYDAWGRLTQI-----TQADGST   509

                   *

  gi|1608979     -   -

RHS: domain 1 of 2, from 492 to 506: score 5.0, E = 0.73
                   *->rYdaWGnvleEevsq<-*
                      +YdaWG++++  +++
  gi|1608979   492    QYDAWGRLTQITQAD    506

CSF-1: domain 1 of 1, from 516 to 534: score -0.5, E = 8.1
                   *->qpegSlltqdedrqeelPv<-*
                      +p  ++lt+d++r++e+
  gi|1608979   516    DPQEAPLTCDSPRRIEDAQ    534

RHS_repeat: domain 5 of 12, from 542 to 579: score 31.5, E = 4.2e-08
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      ++++G+L++ td sg ++ +Y+YD +g l+ +     ++a G +
  gi|1608979   542    WSDAGQLLSYTDCSGHST-HYHYDRWGALIEV-----DNALGQR    579

GSPII_N: domain 1 of 1, from 583 to 595: score -0.4, E = 9.8
                   *->qpDeQGrrPlrfQGrL<-*
                      q+D+QGr+   ++ +L
  gi|1608979   583    QRDGQGRI---VASEL    595

RHS_repeat: domain 6 of 12, from 584 to 620: score 19.3, E = 0.00012
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                       D +Gr++a   p+g+   +Y+YD+ag+lt++      d++  +
  gi|1608979   584    RDGQGRIVASELPNGQIE-RYHYDSAGHLTRI------DPAQPA    620

HrpA_pilin: domain 1 of 1, from 603 to 624: score 0.8, E = 2.8
                   *->YmqDsAGkLtPWDPtPnanTttGs<-*
                      Y  DsAG Lt  DP   a+T  +s
  gi|1608979   603    YHYDSAGHLTRIDPAQPAGT--SS    624

RHS_repeat: domain 7 of 12, from 637 to 673: score 24.5, E = 4.1e-06
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      YD  GrL++ t  +g ++  ++YD+agrl +l      + +G
  gi|1608979   637    YDLWGRLVQRT-HGGLTL-AFEYDSAGRLLRL-----VNENGSQ    673

DUF1052: domain 1 of 1, from 651 to 673: score 1.3, E = 3.9
                   *->ltlrFaRaAAaRlmaaelarlsv<-*
                      ltl+F    A Rl++++ +++s
  gi|1608979   651    LTLAFEYDSAGRLLRLVNENGSQ    673

RHS_repeat: domain 8 of 12, from 678 to 715: score 15.6, E = 0.0014
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      +Da++rL++    + +   +Yr+Daag+l  +     td++ +
  gi|1608979   678    WDALDRLVQEEGFDQRLQ-RYRWDAAGQLMEA-----TDGNAAQ    715

DUF1612: domain 1 of 1, from 723 to 731: score -2.0, E = 5.1
                   *->WDEdaRLsE<-*
                      WDE++RL+E
  gi|1608979   723    WDEGGRLAE    731

RHS_repeat: domain 9 of 12, from 723 to 769: score 12.9, E = 0.0081
                   *->YDanGrLta....vtdpsgpvgq.tYrYDaagrltaltltts...td
                      +D+ GrL +++ + t p  p+ +++Y++Daagrlta+    s  +++
  gi|1608979   723    WDEGGRLAErqlpAT-PHAPAQThRYEWDAAGRLTAA----SvwqHT 764

                   asGtt<-*
                   ++ t+
  gi|1608979   765 GENTA    769

MR_MLE_N: domain 1 of 1, from 749 to 765: score 0.9, E = 6.4
                CS    HHHHHHHTTSBHHHHTT
                   *->wDlkaKalnlPladLLG<-*
                      wD++++   +++++  G
  gi|1608979   749    WDAAGRLTAASVWQHTG    765

DUF2084: domain 1 of 1, from 778 to 791: score 1.0, E = 9.1
                   *->rIeleRdenGkite<-*
                      rI+leRd+ G+it+
  gi|1608979   778    RIALERDALGRITA    791

DUF2505: domain 1 of 1, from 812 to 825: score 1.3, E = 5.1
                   *->fdvsaeypatverV<-*
                      +++++++++t++r+
  gi|1608979   812    IEYEHRIAHTLDRL    825

DUF2109: domain 1 of 1, from 818 to 828: score 1.7, E = 8
                   *->IAyTlaggeei<-*
                      IA+Tl++++ +
  gi|1608979   818    IAHTLDRLGGR    828

HlyC: domain 1 of 1, from 828 to 842: score 1.2, E = 5.7
                   *->nktndFevLGnIAWL<-*
                         + +  LG+IAWL
  gi|1608979   828    RQHSQLQGLGEIAWL    842

DUF2220: domain 1 of 1, from 889 to 905: score 1.2, E = 2.6
                   *->qvrrlWdshrgslLaallt<-*
                      qv+r+Wd      L+al+t
  gi|1608979   889    QVQRQWD--SLGRLTALGT    905

RHS_repeat: domain 10 of 12, from 894 to 946: score 11.0, E = 0.029
                   *->YDanGrLta..............vt.dpsgpvgq.tYrYDaagrlta
                      +D++GrLta ++++ +  ++++ + +   g+ + ++Y+YD++g+l+a
  gi|1608979   894    WDSLGRLTAlgttglqalqptdaQAhALIGQILGrRYHYDSLGQLVA 940

                   ltlttstdasGtt<-*
                   +       a+  +
  gi|1608979   941 I-----EQAG--A    946

HIPIP: domain 1 of 1, from 913 to 921: score 1.8, E = 3.3
                CS    TTSHHHHHT
                   *->ekdpqAqAL<-*
                      ++d+qA+AL
  gi|1608979   913    PTDAQAHAL    921

RHS_repeat: domain 11 of 12, from 958 to 987: score 20.6, E = 5.4e-05
                   *->YDanGrLtavtdpsgpvgq.tYrYDaagrl<-*
                      YD++GrL a td+ +p+++++++ D+ag++
  gi|1608979   958    YDSAGRLRAATDSQHPQTTtRWQLDPAGNR    987

Glucodextran_N: domain 1 of 1, from 990 to 997: score -0.6, E = 4.7
                CS    -TTTT---
                   *->ApGaPGaa<-*
                      ApGaPGa+
  gi|1608979   990    APGAPGAT    997

GalP_UDP_tr_C: domain 1 of 1, from 994 to 1016: score 3.9, E = 1.5
                CS    -..............SS-TTCCT
                   *->sgaDPktaLedNkmaevHyewal<-*
                      +ga  +t  +dN  a+vH +w+
  gi|1608979   994    PGATGQTNTQDNWAAQVHAHWRH    1016

RHS_repeat: domain 12 of 12, from 1074 to 1123: score 11.0, E = 0.029
                   *->YDanGrLtavtd.........psgpvgqtYrYDaagr....ltaltl
                      YD +++L+av+ ++ +++ ++ ++ ++  Y+YDa+gr+ ++ + +
  gi|1608979  1074    YDGAHQLIAVRSsqiqgnaeqLRHHSR--YTYDALGRrlkqQVES-- 1116

                   ttstdasGtt<-*
                       d++ t+
  gi|1608979  1117 ---ADGNPTR    1123

CMD: domain 1 of 1, from 1079 to 1100: score 7.4, E = 0.33
                CS    HHHHHHHHHHTT-HHHHHHHHHHH
                   *->ELialavsaanGCeyCieLdaHtr<-*
                      +Lia++ s+++G +   +L++H r
  gi|1608979  1079    QLIAVRSSQIQGNAE--QLRHHSR    1100

DUF883: domain 1 of 1, from 1086 to 1118: score 4.1, E = 2.6
                   *->eraesrLddaRerlsdaedaaverakaAadaad<-*
                      +++++  +++R++ + ++da+ +r k+ ++ ad
  gi|1608979  1086    SQIQGNAEQLRHHSRYTYDALGRRLKQQVESAD    1118

Lipocalin_2: domain 1 of 1, from 1127 to 1139: score 2.2, E = 4
                   *->YGYDvskLiwvpq<-*
                      YG+D ++Li+++
  gi|1608979  1127    YGWDGDRLIHTER    1139

TBP: domain 1 of 1, from 1148 to 1163: score 1.8, E = 9.4
                CS    S..TTEEEETTTCSSEE
                   *->lslpnveYePeqFpGli<-*
                      + ++++ YeP++F +l+
  gi|1608979  1148    H-IEHTIYEPGSFTPLV    1163

MdcG: domain 1 of 1, from 1162 to 1189: score -0.2, E = 7.8
                   *->LvwLspaawaaallacalpdaaappwvaawlrlaaglP<-*
                      Lv+Ls+ a        + ++  +p+++ +++  aaglP
  gi|1608979  1162    LVRLSTTA--------SGDPQNEPHLLVQAI--AAGLP    1189

DUF1630: domain 1 of 1, from 1204 to 1220: score -0.8, E = 6
                   *->eaiissLPdDLqqvLll<-*
                      ++++s++P D+qq   +
  gi|1608979  1204    QTMLSAMPRDMQQDAAR    1220

DUF2063: domain 1 of 1, from 1215 to 1233: score 2.3, E = 5.2
                   *->QqaFaaalRdPeaapvPaG<-*
                      Qq+ a++lR+   + +P+G
  gi|1608979  1215    QQDAARHLRHTLEHGLPPG    1233

Troponin: domain 1 of 1, from 1247 to 1268: score 4.5, E = 1.3
                CS    XXXXXXXXXXXXXXXXXXXXXXX
                   *->elegaeqqreLqElckElharid<-*
                      +l + + q++LqE++kE hari+
  gi|1608979  1247    RLLSGM-QAKLQEQEKEQHARIA    1268

Trp_leader2: domain 1 of 1, from 1256 to 1270: score 4.0, E = 0.75
                   *->mLqEFnqnqKAKlAlh<-*
                       LqE  + q A++A+h
  gi|1608979  1256    -LQEQEKEQHARIAIH    1270

RHS: domain 2 of 2, from 1269 to 1309: score 68.5, E = 4e-21
                   *->vyYYHtDqiGtPLeLtdseGeivWqArYdaWGnvleEevsq<-*
                      +++YH+D++GtP +Ltd+ G+++W A+ d WGnvl+E ++q
  gi|1608979  1269    IHHYHCDHLGTPMALTDQTGQVAWAAKLDPWGNVLQEYNPQ    1309

DUF2135: domain 1 of 1, from 1394 to 1404: score 3.5, E = 3.9
                   *->pvpGtYlVyVN<-*
                      p+ G+Y+V ++
  gi|1608979  1394    PKSGVYQVGAH    1404

Phe_hydrox_dim: domain 1 of 1, from 1406 to 1428: score 5.7, E = 0.24
                CS    SBTTB-STT-............-GGGCTTS-T
                   *->gPSllvmkpeWrkaaaesdkilspqeLAtglv<-*
                      +PSl+v++++         kilsp++LA++++
  gi|1608979  1406    NPSLIVDDKG---------KILSPSDLAKKIK    1428

DUF2117: domain 1 of 1, from 1445 to 1468: score -0.0, E = 9.1
                   *->NtkndrkaktiaekLSelLgLkiesp<-*
                      N   +++ +++a+kL+++Lg k++ p
  gi|1608979  1445    N--TGKGNDPYAKKLANELGAKVSAP    1468

//