hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 161506322.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|161506322|ref|YP_001573434.1|
Accession: [none]
Description: hypothetical protein SARI_04518 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
NADase_NGA Nicotine adenine dinucleotide glycohy 5.0 0.14 1
Engrail_1_C_sig Engrailed homeobox C-terminal signatu 5.3 0.59 1
RasGAP_C RasGAP C-terminus 3.1 2.3 1
Form_Nir_trans Formate/nitrite transporter 0.7 3.4 1
Acetyltransf_2 N-acetyltransferase 1.8 3.6 1
KorB_C KorB C-terminal beta-barrel domain 2.5 8 1
Utp12 Dip2/Utp12 Family 0.1 9.2 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
RasGAP_C 1/1 75 90 .. 1 16 [. 3.1 2.3
Engrail_1_C_sig 1/1 92 101 .. 1 11 [. 5.3 0.59
Form_Nir_trans 1/1 183 196 .. 1 14 [. 0.7 3.4
Acetyltransf_2 1/1 184 207 .. 245 268 .] 1.8 3.6
Utp12 1/1 191 203 .. 192 204 .. 0.1 9.2
KorB_C 1/1 203 212 .. 1 10 [. 2.5 8
NADase_NGA 1/1 208 240 .. 1 34 [. 5.0 0.14
Alignments of top-scoring domains:
RasGAP_C: domain 1 of 1, from 75 to 90: score 3.1, E = 2.3
CS XXXXXXXXXXXXXXXX
*->sLkelkekilknlkeL<-*
+L++ ++k+l++l+eL
gi|1615063 75 KLFQHQYKLLSGLHEL 90
Engrail_1_C_sig: domain 1 of 1, from 92 to 101: score 5.3, E = 0.59
*->AsGvkNpLAlq<-*
+G+kN+LAl+
gi|1615063 92 -AGNKNQLALH 101
Form_Nir_trans: domain 1 of 1, from 183 to 196: score 0.7, E = 3.4
*->dylsPaeiaeavva<-*
+ l+Pae++ea+ +
gi|1615063 183 MLLTPAELVEAMRD 196
Acetyltransf_2: domain 1 of 1, from 184 to 207: score 1.8, E = 3.6
CS ESSHHHHHHHHHCTT---GCTCCH
*->lltaeEledvLkerFGIvLdaklv<-*
llt++El +++++ GI+L +++
gi|1615063 184 LLTPAELVEAMRDDLGINLADPDK 207
Utp12: domain 1 of 1, from 191 to 203: score 0.1, E = 9.2
*->vkklrdviGfNla<-*
v++ rd++G+Nla
gi|1615063 191 VEAMRDDLGINLA 203
KorB_C: domain 1 of 1, from 203 to 212: score 2.5, E = 8
CS --TTB-SSEE
*->sDPDklkKal<-*
+DPDk K++
gi|1615063 203 ADPDKRNKPI 212
NADase_NGA: domain 1 of 1, from 208 to 240: score 5.0, E = 0.14
*->mRnKKvtLAHivAKtsvAiALAGAmGssLLAnst<-*
RnK + L AK A ALA A G + A st
gi|1615063 208 -RNKPIHLISCYAKRGAAQALADATGREVYAYST 240
//