hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            162455742.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|162455742|ref|YP_001618109.1|
Accession:      [none]
Description:    Rhs family carbohydrate-binding protein [Sorangium cellulosum 'So ce 56']

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
RHS_repeat      RHS Repeat                              225.5    1.4e-64  14
RHS             RHS protein                              21.6    3.8e-06   1
PIG-L           GlcNAc-PI de-N-acetylase                  4.5       0.59   1
Pox_N2L         Poxvirus N2L protein                      4.0       0.69   1
Oxidored_molyb  Oxidoreductase molybdopterin binding      4.3       0.96   1
Glyco_transf_28 Glycosyltransferase family 28 N-termi     4.4          1   1
HYR             HYR domain                                4.4        1.1   1
DUF2203         Uncharacterized conserved protein (DU     3.7        1.3   1
KAR9            Yeast cortical protein KAR9              -0.4        2.3   1
MOSC_N          MOSC N-terminal beta barrel domain        2.8        2.6   1
VanW            VanW like protein                         2.4        3.5   1
Glyoxalase      Glyoxalase/Bleomycin resistance prote     2.1        3.5   1
Kunitz_BPTI     Kunitz/Bovine pancreatic trypsin inhi     1.8          4   1
DUF765          Circovirus protein of unknown functio     2.3        4.1   1
DUF592          Protein of unknown function (DUF592)      0.1        4.3   1
DUF2313         Uncharacterized protein conserved in      1.2        4.5   1
Hormone_2       Peptide hormone                           4.6        4.7   1
PB1             PB1 domain                                2.7        5.1   1
Troponin        Troponin                                  2.3        5.2   1
BA14K           BA14K-like protein                        3.5        5.4   1
DUF2394         Domain of unknown function (DUF2394)      2.7        5.4   1
Mycobact_memb   Mycobacterium membrane protein            1.6        5.6   1
MCR_beta_N      Methyl-coenzyme M reductase beta subu     1.2        5.6   1
PSP1            PSP1 C-terminal conserved region          1.7        5.8   1
Lys-AminoMut_A  D-Lysine 5,6-aminomutase alpha subuni     0.1        5.8   1
B-block_TFIIIC  B-block binding subunit of TFIIIC         0.2        5.9   1
DUF2584         Protein of unknown function (DUF2584)     1.5          6   1
DUF1336         Protein of unknown function (DUF1336)     0.6        6.7   1
DUF920          Bacterial protein of unknown function     1.1        7.4   1
PBP_dimer       Penicillin-binding Protein dimerisati     1.1        7.4   1
WRC             WRC                                       2.7        7.5   1
Tup_N           Tup N-terminal                            1.7        7.6   1
KR              KR domain                                 0.7        8.1   1
MerR            MerR family regulatory protein            3.2        8.1   1
MethyltransfD12 D12 class N6 adenine-specific DNA met     0.2        8.5   1
DUF1561         Protein of unknown function (DUF1561)    -2.2        8.6   1
S_layer_N       S-layer like family, N-terminal regio    -0.1        9.6   1
Ribosomal_L14   Ribosomal protein L14p/L23e               1.2        9.8   1
efhand_Ca_insen Ca2+ insensitive EF hand                  1.2        9.8   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Pox_N2L           1/1      46    75 ..     1    33 [.     4.0     0.69
MCR_beta_N        1/1      61    68 ..   175   182 .]     1.2      5.6
VanW              1/1      61    83 ..   121   143 .]     2.4      3.5
Mycobact_memb     1/1      97   102 ..   135   140 .]     1.6      5.6
KR                1/1     124   152 ..    82   110 ..     0.7      8.1
MOSC_N            1/1     209   246 ..    72   110 ..     2.8      2.6
DUF1336           1/1     214   225 ..     1    13 [.     0.6      6.7
MethyltransfD12   1/1     279   305 ..   251   278 ..     0.2      8.5
PIG-L             1/1     297   323 ..    99   128 ..     4.5     0.59
RHS_repeat        1/14    298   338 ..     1    44 []    10.6    0.038
PB1               1/1     303   332 ..    63    89 .]     2.7      5.1
DUF592            1/1     309   317 ..   168   176 .]     0.1      4.3
DUF920            1/1     313   325 ..   104   116 ..     1.1      7.4
RHS_repeat        2/14    347   384 ..     1    44 []    19.3  0.00012
Kunitz_BPTI       1/1     381   403 ..    12    35 ..     1.8        4
WRC               1/1     390   399 ..     1    10 [.     2.7      7.5
DUF1561           1/1     392   397 ..   656   661 .]    -2.2      8.6
PSP1              1/1     435   446 ..     1    13 [.     1.7      5.8
RHS_repeat        3/14    455   492 ..     1    44 []    24.8  3.5e-06
RHS_repeat        4/14    516   553 ..     1    44 []    25.1  2.9e-06
RHS_repeat        5/14    558   595 ..     1    44 []    20.2  7.1e-05
Tup_N             1/1     597   606 ..    71    80 .]     1.7      7.6
RHS_repeat        6/14    601   637 ..     2    44 .]    28.0  4.4e-07
B-block_TFIIIC    1/1     626   642 ..   532   548 .]     0.2      5.9
RHS_repeat        7/14    642   679 ..     1    44 []     8.8     0.12
KAR9              1/1     659   675 ..   869   885 .]    -0.4      2.3
Troponin          1/1     661   673 ..   132   145 .]     2.3      5.2
RHS_repeat        8/14    684   699 ..     1    16 [.     3.6      3.7
RHS_repeat        9/14    708   742 ..     4    44 .]     8.3     0.17
Hormone_2         1/1     716   721 ..     1     6 [.     4.6      4.7
HYR               1/1     748   761 ..    61    74 ..     4.4      1.1
PBP_dimer         1/1     766   780 ..   181   195 .]     1.1      7.4
RHS_repeat       10/14    769   805 ..     1    44 []    22.5  1.6e-05
Oxidored_molyb    1/1     805   828 ..     1    27 [.     4.3     0.96
RHS_repeat       11/14    806   826 ..    18    44 .]     4.1      2.6
Lys-AminoMut_A    1/1     819   841 ..     1    23 [.     0.1      5.8
S_layer_N         1/1     819   828 ..   315   324 .]    -0.1      9.6
Glyoxalase        1/1     820   828 ..   141   149 .]     2.1      3.5
DUF2394           1/1     873   886 ..    29    44 .]     2.7      5.4
RHS_repeat       12/14    877   914 ..     1    44 []    29.4  1.8e-07
RHS_repeat       13/14    947   965 ..    21    44 .]     9.3    0.089
RHS_repeat       14/14    969   998 ..     1    31 [.    11.5    0.021
MerR              1/1     972   988 ..    22    39 .]     3.2      8.1
Ribosomal_L14     1/1     976   988 ..    78    90 ..     1.2      9.8
DUF2313           1/1     977   990 ..   178   191 .]     1.2      4.5
RHS               1/1    1066  1101 ..     6    41 .]    21.6  3.8e-06
BA14K             1/1    1119  1142 ..     1    24 [.     3.5      5.4
DUF2203           1/1    1129  1137 ..     1     9 [.     3.7      1.3
efhand_Ca_insen   1/1    1218  1226 ..     1    10 [.     1.2      9.8
DUF2584           1/1    1238  1246 ..    74    82 .]     1.5        6
Glyco_transf_28   1/1    1272  1296 ..   122   146 ..     4.4        1
DUF765            1/1    1287  1314 ..     1    29 []     2.3      4.1

Alignments of top-scoring domains:
Pox_N2L: domain 1 of 1, from 46 to 75: score 4.0, E = 0.69
                   *->lsdsdiDntedeiveivldetlLPegssydiqL<-*
                      ls+s+ D  e   +ei   +++L egss+di L
  gi|1624557    46    LSSSATDTGER--IEIG-GAPVLLEGSSMDIEL    75

MCR_beta_N: domain 1 of 1, from 61 to 68: score 1.2, E = 5.6
                CS    --GGG-SS
                   *->giPqklEG<-*
                      g+P++lEG
  gi|1624557    61    GAPVLLEG    68

VanW: domain 1 of 1, from 61 to 83: score 2.4, E = 3.5
                   *->dypiyIeaslddghltgeiysdg<-*
                      ++p+++e+s++d +l g+i + g
  gi|1624557    61    GAPVLLEGSSMDIELPGNIPCQG    83

Mycobact_memb: domain 1 of 1, from 97 to 102: score 1.6, E = 5.6
                   *->ClVKSa<-*
                      C+VKSa
  gi|1624557    97    CFVKSA    102

KR: domain 1 of 1, from 124 to 152: score 0.7, E = 8.1
                   *->laeiradgpPlrGViHaAGvlrDallanm<-*
                      +a+ +a+   + GV+ aAG++++a+++n+
  gi|1624557   124    VAGSKAQVAQIGGVLLAAGIVQTATVDNT    152

MOSC_N: domain 1 of 1, from 209 to 246: score 2.8, E = 2.6
                   *->eAFEDWEPeedggLtltAPGmppLsvplaClvsankaqr<-*
                      +A+  W   ++++L+l+++++++++v+ + +++ ++++r
  gi|1624557   209    HAYHQWIEIDGDVLRLRDADGATITVRDT-KPREPAFHR    246

DUF1336: domain 1 of 1, from 214 to 225: score 0.6, E = 6.7
                   *->WskepdpstFkvR<-*
                      W  e+d+++ ++R
  gi|1624557   214    WI-EIDGDVLRLR    225

MethyltransfD12: domain 1 of 1, from 279 to 305: score 0.2, E = 8.5
                CS    HHHHHHHH..HCTT-EEEEEEESEETTE
                   *->Latvlkslskskfgikfllsnsfeklik<-*
                      ++t+l+++s +++g+k++l ++ e+l +
  gi|1624557   279    GRTFLREIS-NESGHKVVLEYDAERLVR    305

PIG-L: domain 1 of 1, from 297 to 323: score 4.5, E = 0.59
                CS    HHHHHHHHHHHHHH-ECEEEEE-TTTTTSS
                   *->eelaaaLarlirevrPdvVitpdpnGgdgH<-*
                      e +a++L+r+++ +r +vV+t+d    dgH
  gi|1624557   297    EYDAERLVRIVDTARRTVVLTHDG---DGH    323

RHS_repeat: domain 1 of 14, from 298 to 338: score 10.6, E = 0.038
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltltts...tdasGtt
                      YD + rL+ + d++ +++  +++D+ g++++l    +  +  ++G+t
  gi|1624557   298    YD-AERLVRIVDTARRTV-VLTHDGDGHIVRL----QvfpPGGEGRT 338

                   <-*

  gi|1624557     -     -

PB1: domain 1 of 1, from 303 to 332: score 2.7, E = 5.1
                CS    HHHHHHHHHHT..T.  STC SEEEEEEET
                   *->Leeaieearsllses..ksk.tlrlhvfpa<-*
                      L + +++ar+++ +++++ ++++rl+vfp
  gi|1624557   303    LVRIVDTARRTVVLThdGDGhIVRLQVFPP    332

DUF592: domain 1 of 1, from 309 to 317: score 0.1, E = 4.3
                   *->tAkKILVLT<-*
                      tA++ +VLT
  gi|1624557   309    TARRTVVLT    317

DUF920: domain 1 of 1, from 313 to 325: score 1.1, E = 7.4
                   *->TVVRkpnGEGHAV<-*
                      TVV++ +G+GH V
  gi|1624557   313    TVVLTHDGDGHIV    325

RHS_repeat: domain 2 of 14, from 347 to 384: score 19.3, E = 0.00012
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      Y++ G L+ vtd+ g +  tY+YD+ +r+ ++     t + G
  gi|1624557   347    YSDGGELVKVTDALGHAE-TYGYDEQRRMNHR-----TLPTGLS    384

Kunitz_BPTI: domain 1 of 1, from 381 to 403: score 1.8, E = 4
                CS    STSECEEEEEETTTTEEEEEEECS
                   *->kgsilpRyyYnpstgqCepFiYgG<-*
                      +g    +y Y+p++g+C++ +  G
  gi|1624557   381    TGLS-FHYVYDPESGRCVRSWGDG    403

WRC: domain 1 of 1, from 390 to 399: score 2.7, E = 7.5
                   *->daepgRCrRt<-*
                      d+e+gRC R+
  gi|1624557   390    DPESGRCVRS    399

DUF1561: domain 1 of 1, from 392 to 397: score -2.2, E = 8.6
                   *->rSGRCa<-*
                      +SGRC+
  gi|1624557   392    ESGRCV    397

PSP1: domain 1 of 1, from 435 to 446: score 1.7, E = 5.8
                   *->plksviRvADtde<-*
                      +++sv+R+A +++
  gi|1624557   435    EDGSVVREA-SPD    446

RHS_repeat: domain 3 of 14, from 455 to 492: score 24.8, E = 3.5e-06
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      +Da+G L+ +++++g ++ t++ D++g+lt++     td  G++
  gi|1624557   455    FDADGLLLKTKNAAGDTL-TFTRDGRGNLTRI-----TDSIGRV    492

RHS_repeat: domain 4 of 14, from 516 to 553: score 25.1, E = 2.9e-06
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      YD ++rLt v+++sg+ + t++YD+ grl a+     + ++G +
  gi|1624557   516    YDHRNRLTWVRYTSGAFL-TLTYDEQGRLAAV-----HGPDGLR    553

RHS_repeat: domain 5 of 14, from 558 to 595: score 20.2, E = 7.1e-05
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      YD++++  + ++p+++ + ++r+Da+gr +        d+ G++
  gi|1624557   558    YDEQHNAAEERTPRDGLR-RWRHDALGRPIVY-----VDPLGRV    595

Tup_N: domain 1 of 1, from 597 to 606: score 1.7, E = 7.6
                   *->KreLEsRggq<-*
                      +reL++ g++
  gi|1624557   597    RRELDALGRP    606

RHS_repeat: domain 6 of 14, from 601 to 637: score 28.0, E = 4.4e-07
                   *->DanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      Da+Gr ta   p+g+++ ++++Da+grlt++     td+ G++
  gi|1624557   601    DALGRPTALHLPDGTSL-RFEHDALGRLTRR-----TDTLGRV    637

B-block_TFIIIC: domain 1 of 1, from 626 to 642: score 0.2, E = 5.9
                   *->aivrdtedeGrirfyRy<-*
                      +++r t+  Gr  ++Ry
  gi|1624557   626    RLTRRTDTLGRVETFRY    642

RHS_repeat: domain 7 of 14, from 642 to 679: score 8.8, E = 0.12
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      Y  +   ++vt p+g+ +  +++D   rl ++      +++G+t
  gi|1624557   642    YTGLKSPVEVTQPDGAIW-SLSFDLNERLQQV-----KNPKGET    679

KAR9: domain 1 of 1, from 659 to 675: score -0.4, E = 2.3
                   *->WvprskhknlvhrLKeP<-*
                      W+ ++++++++ + K P
  gi|1624557   659    WSLSFDLNERLQQVKNP    675

Troponin: domain 1 of 1, from 661 to 673: score 2.3, E = 5.2
                CS    -SSCHHHHHHHHHH
                   *->vsmDkLRanLKeVK<-*
                      +s+D L + L++VK
  gi|1624557   661    LSFD-LNERLQQVK    673

RHS_repeat: domain 8 of 14, from 684 to 699: score 3.6, E = 3.7
                   *->YDanGrLtavtdpsgp<-*
                      YD++G+L + + ++g+
  gi|1624557   684    YDRAGNLREYRSYDGR    699

RHS_repeat: domain 9 of 14, from 708 to 742: score 8.3, E = 0.17
                   *->nGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                      nGrL  v  ++g+ +  +r+D+agr+ a       ++ G++
  gi|1624557   708    NGRLARVDHADGTFR-ALRHDGAGRILAE-----ETPHGVV    742

Hormone_2: domain 1 of 1, from 716 to 721: score 4.6, E = 4.7
                   *->HaDGtF<-*
                      HaDGtF
  gi|1624557   716    HADGTF    721

HYR: domain 1 of 1, from 748 to 761: score 4.4, E = 1.1
                   *->EettVtYtatDnaG<-*
                      E+ +V+Y+++D+aG
  gi|1624557   748    EDLVVEYIFEDPAG    761

PBP_dimer: domain 1 of 1, from 766 to 780: score 1.1, E = 7.4
                   *->kyevDarGrviptls<-*
                      ++e+D+ Grv+ ++
  gi|1624557   766    RVERDPLGRVVAETQ    780

RHS_repeat: domain 10 of 14, from 769 to 805: score 22.5, E = 1.6e-05
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrltaltlttstdasGtt<-*
                       D +Gr++a t ++g+   +Y+YDa +r ta+     + + G +
  gi|1624557   769    RDPLGRVVAET-QNGRMI-RYEYDAQNRCTAR-----HLPTGHI    805

Oxidored_molyb: domain 1 of 1, from 805 to 828: score 4.3, E = 0.96
                   *->yvrnhdgvvPeygdvpeidladWrLeV<-*
                       +r++   ++e+g+v ++d++++r+e+
  gi|1624557   805    ITRYT---YDEEGNVSSLDHDGYRVEI    828

RHS_repeat: domain 11 of 14, from 806 to 826: score 4.1, E = 2.6
                   *->gqtYrYDaagrltaltlttstdasGtt<-*
                      + +Y+YD++g++ +l     +  + ++
  gi|1624557   806    T-RYTYDEEGNVSSL-----DHDGYRV    826

Lys-AminoMut_A: domain 1 of 1, from 819 to 841: score 0.1, E = 5.8
                CS    S---HHHHHHHHHHHHHHHHHHH
                   *->LnLDfalVerARelArrIaadvq<-*
                      L+ D  +Ve  R+lA+ +++ v+
  gi|1624557   819    LDHDGYRVEIQRDLAGSVVRKVF    841

S_layer_N: domain 1 of 1, from 819 to 828: score -0.1, E = 9.6
                   *->vefdGYeVkI<-*
                      ++ dGY+V+I
  gi|1624557   819    LDHDGYRVEI    828

Glyoxalase: domain 1 of 1, from 820 to 828: score 2.1, E = 3.5
                CS    TTTEEEEEE
                   *->DPdGnliEl<-*
                      D+dG+++E+
  gi|1624557   820    DHDGYRVEI    828

DUF2394: domain 1 of 1, from 873 to 886: score 2.7, E = 5.4
                   *->rvYrldaaadGkLtpa<-*
                      r+Y++d  a+G L+++
  gi|1624557   873    RLYAYD--AAGALVER    886

RHS_repeat: domain 12 of 14, from 877 to 914: score 29.4, E = 1.8e-07
                   *->YDanGrLtavtdpsgpvgq.t.YrYDaagrltaltlttstdasGtt<
                      YDa+G L++    +++++   +Y+YD +g+l a+      +++G++
  gi|1624557   877    YDAAGALVE---RNDRRWGiSrYSYDRLGMLLAA-----SSPKGRE  914

                   -*

  gi|1624557     -    -

RHS_repeat: domain 13 of 14, from 947 to 965: score 9.3, E = 0.089
                   *->YrYDaagrltaltlttstdasGtt<-*
                      Y YDaa+r+t+      t  +G+t
  gi|1624557   947    YAYDAANRRTRE-----TRSDGAT    965

RHS_repeat: domain 14 of 14, from 969 to 998: score 11.5, E = 0.021
                   *->YDanGrLtavtdpsgpvgqtYrYDaagrlta<-*
                      +D +G+L +v+ p+g+++  + YDa+ r+++
  gi|1624557   969    WDCRGQLREVRRPDGTRV-LFAYDAFSRRVR    998

MerR: domain 1 of 1, from 972 to 988: score 3.2, E = 8.1
                CS    TTSSS-SCEETTTS-EEE
                   *->eGLllppprrtegGyRrY<-*
                      +G +l++ rr++g++ ++
  gi|1624557   972    RG-QLREVRRPDGTRVLF    988

Ribosomal_L14: domain 1 of 1, from 976 to 988: score 1.2, E = 9.8
                CS    S-EE-TTSEEEEE
                   *->KelkRkDGsfirF<-*
                      +e++R+DG+++ F
  gi|1624557   976    REVRRPDGTRVLF    988

DUF2313: domain 1 of 1, from 977 to 990: score 1.2, E = 4.5
                   *->erlkPAHTvviFaY<-*
                      e ++P +T v+FaY
  gi|1624557   977    EVRRPDGTRVLFAY    990

RHS: domain 1 of 1, from 1066 to 1101: score 21.6, E = 3.8e-06
                   *->tDqiGtPLeLtdseGeivWqArYdaWGnvleEevsq<-*
                      tD++Gt  eL+ +eGe++W+A + a G ++e  ++
  gi|1624557  1066    TDHVGTTTELIGPEGEVAWSAHHSAFGIITEAARPK    1101

BA14K: domain 1 of 1, from 1119 to 1142: score 3.5, E = 5.4
                   *->qhiawCsaRYRSYdPrdnTyqgyd<-*
                      +  + C+ RYR +dP + ++++ d
  gi|1624557  1119    EETELCYVRYRYFDPKTARFLSPD    1142

DUF2203: domain 1 of 1, from 1129 to 1137: score 3.7, E = 1.3
                   *->ryFtldEAr<-*
                      ryF++++Ar
  gi|1624557  1129    RYFDPKTAR    1137

efhand_Ca_insen: domain 1 of 1, from 1218 to 1226: score 1.2, E = 9.8
                   *->DtdTaEQViq<-*
                       t+T++Q++q
  gi|1624557  1218    -THTPDQLLQ    1226

DUF2584: domain 1 of 1, from 1238 to 1246: score 1.5, E = 6
                   *->eLvSLnStN<-*
                      +L+ LnS N
  gi|1624557  1238    QLITLNSCN    1246

Glyco_transf_28: domain 1 of 1, from 1272 to 1296: score 4.4, E = 1
                CS    HHHHHCTTTSEEEEECHHHHHHHHH
                   *->davigfGGyvalpaliaallagipi<-*
                      d+v+g+G+y+a p+++a    + p+
  gi|1624557  1272    DLVWGVGQYIAPPVGVANSVTWTPT    1296

DUF765: domain 1 of 1, from 1287 to 1314: score 2.3, E = 4.1
                   *->mAsstPAsPAPsDiLssvPqseRPPGRWt<-*
                      +A s    P P ++  s+P   RP G W
  gi|1624557  1287    VANSVTWTPTPDELGKSMPDLTRP-GQWN    1314

//