hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            182440152.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|182440152|ref|YP_001827871.1|
Accession:      [none]
Description:    hypothetical protein SGR_6359 [Streptomyces griseus subsp. griseus NBRC 13350]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
Adeno_E3_CR1    Adenovirus E3 region protein CR1          7.1      0.094   1
OTU             OTU-like cysteine protease                7.8       0.12   3
BCSC_C          Cellulose synthase operon protein C C     6.2       0.13   1
FRG1            FRG1-like family                          2.8       0.19   1
FCD             FCD domain                                5.8       0.23   1
Peptidase_U35   Caudovirus prohead protease               5.4       0.27   1
OHCU_decarbox   OHCU decarboxylase                        6.5       0.42   1
LRV_FeS         LRV protein FeS4 cluster                  5.6       0.42   2
Annexin         Annexin                                   6.7       0.49   1
Rz1             Lipoprotein Rz1 precursor                 6.1       0.57   1
HGTP_anticodon  Anticodon binding domain                  5.5       0.61   1
He_PIG          Putative Ig domain                        6.0       0.64   1
DUF1896         Domain of unknown function (DUF1896)      4.4       0.67   1
DUF824          Salmonella repeat of unknown function     7.0       0.67   1
TrkA_N          TrkA-N domain                             6.0       0.68   1
SipA            Salmonella invasion protein A             2.6       0.92   1
HATPase_c       Histidine kinase-, DNA gyrase B-, and     4.6       0.99   1
Alpha_TIF       Alpha trans-inducing protein (Alpha-T     2.7       0.99   1
SEP             SEP domain                                4.9          1   1
GvpL_GvpF       Gas vesicle synthesis protein GvpL/Gv     2.5        1.1   1
Abhydrolase_3   alpha/beta hydrolase fold                 3.7        1.2   1
DUF1845         Domain of unknown function (DUF1845)      3.3        1.2   1
PIN             PIN domain                                3.2        1.2   1
FLO_LFY         Floricaula / Leafy protein                1.0        1.3   1
Herpes_ori_bp   Origin of replication binding protein     1.9        1.4   1
APH             Phosphotransferase enzyme family          2.9        1.5   1
Gp49            Phage derived protein Gp49-like (DUF8     4.8        1.8   1
JTB             Jumping translocation breakpoint prot     3.2        1.8   1
DNA_pol_viral_C DNA polymerase (viral) C-terminal dom    -0.2        1.9   1
Plug            TonB-dependent Receptor Plug Domain       3.7        1.9   1
P-mevalo_kinase Phosphomevalonate kinase                  2.0          2   1
IlvB_leader     IlvB leader peptide                       3.8          2   2
DUF179          Uncharacterized ACR, COG1678              2.5          2   1
Pyocin_S        S-type Pyocin                             2.7        2.1   1
PCP_red         Proto-chlorophyllide reductase 57 kD      3.9        2.2   1
DUF1550         Protein of unknown function (DUF1550)     3.0        2.2   1
Gp23            Major capsid protein Gp23                 1.6        2.4   1
Glyco_transf_22 Alg9-like mannosyltransferase family      0.1        2.4   1
Neugrin         Neugrin                                   1.3        2.4   1
DUF1780         Protein of unknown function (DUF1780)     2.0        2.4   1
DUF399          Protein of unknown function, DUF399       2.6        2.5   2
RinB            Transcriptional activator RinB            3.3        2.6   1
DUF1134         Protein of unknown function (DUF1134)     1.3        2.6   1
DUF1485         Protein of unknown function (DUF1485)     2.6        2.7   1
DUF2322         Uncharacterized protein conserved in      3.0        2.7   1
Catalase-rel    Catalase-related immune-responsive        3.2        2.7   1
Sigma70_r3      Sigma-70 region 3                         4.1        2.8   1
SWIRM           SWIRM domain                              3.4          3   1
DUF1740         Protein of unknown function (DUF1740)     2.4          3   1
Senescence      Senescence-associated protein             0.6        3.1   1
DUF586          Protein of unknown function, DUF586       2.7        3.3   1
Peptidase_S15   X-Pro dipeptidyl-peptidase (S15 famil     0.4        3.4   1
CcdA            Post-segregation antitoxin CcdA           3.1        3.6   1
Mob1_phocein    Mob1/phocein family                       1.9        3.7   1
DUF1865         Domain of unknown function (DUF1865)      1.8        3.8   1
MMPL            MMPL family                               3.4        3.8   1
CNP1            CNP1-like family                          2.1        3.9   1
Tellurium_res   Tellurium resistance protein              1.6        3.9   1
DUF2044         Conserved membrane protein (DUF2044)     -1.0          4   1
FrhB_FdhB_C     Coenzyme F420 hydrogenase/dehydrogena     1.8          4   1
RVP             Retroviral aspartyl protease              2.7          4   1
MucBP           MucBP domain                              3.2        4.1   1
Fic             Fic/DOC family                            3.7        4.2   1
DUF413          Protein of unknown function, DUF          2.6        4.2   1
DUF2239         Uncharacterized protein conserved in      0.8        4.4   1
Maf_N           Maf N-terminal region                     3.0        4.6   1
DUF606          Protein of unknown function, DUF606       3.1        4.8   1
DUF1424         Putative rep protein (DUF1424)           -0.2        4.8   1
Pox_A_type_inc  Viral A-type inclusion protein repeat     4.6        4.8   1
ORF6N           ORF6N domain                              1.5        4.8   1
adh_short       short chain dehydrogenase                 1.9        4.8   1
DUF2131         Uncharacterized protein conserved in      2.3          5   1
NIF3            NIF3 (NGG1p interacting factor 3)         1.4          5   1
Plug_translocon Plug domain of Sec61p                     4.1          5   1
Adeno_VII       Adenoviral core protein VII               2.3        5.2   1
Peptidase_S68   Peptidase S68                             3.2        5.3   1
PI3K_1B_p101    Phosphoinositide 3-kinase gamma adapt    -1.1        5.3   1
YdjC            YdjC-like protein                         1.0        5.3   1
GlcNAc_2-epim   N-acylglucosamine 2-epimerase (GlcNAc    -0.2        5.3   1
RecO            Recombination protein O                   0.7        5.4   1
Hp0062          Bacterial protein of unknown function     1.0        5.5   1
SLBB            SLBB domain                               3.5        5.5   1
DUF2168         Uncharacterized protein conserved in      0.1        5.5   1
Pyridox_oxidase Pyridoxamine 5'-phosphate oxidase         2.0        5.6   1
TPR_2           Tetratricopeptide repeat                  3.9        5.6   1
Phage_portal_2  Phage portal protein, lambda family       0.5        5.7   1
Corona_nucleoca Coronavirus nucleocapsid protein          0.4        5.7   1
DmpG_comm       DmpG-like communication domain            2.3        5.9   1
AmoA            Putative ammonia monooxygenase            0.4        5.9   1
DUF834          Domain of unknown function (DUF834)       2.7        6.1   1
DUF2249         Uncharacterized conserved protein (DU     1.7        6.1   1
DUF1853         Domain of unknown function (DUF1853)      2.1        6.2   1
Rubella_E1      Rubella membrane glycoprotein E1         -1.6        6.2   1
CLP_protease    Clp protease                              1.1        6.3   1
FecR            FecR protein                              2.2        6.3   1
Mt_ATP-synt_D   ATP synthase D chain, mitochondrial (     1.0        6.3   1
Cas_Csy4        CRISPR-associated protein (Cas_Csy4)      0.5        6.4   1
BHD_3           Rad4 beta-hairpin domain 3                2.0        6.4   1
MSA_2           Merozoite Surface Antigen 2 (MSA-2) f    -0.3        6.5   1
DUF1624         Protein of unknown function (DUF1624)    -0.3        6.6   1
Albicidin_res   Albicidin resistance domain               1.4        6.7   1
Pertussis_S2S3  Pertussis toxin, subunit 2 and 3, C-t     0.5        6.9   1
ClpS            ATP-dependent Clp protease adaptor pr     3.1        6.9   1
SPOR            Sporulation related domain                1.8        7.1   1
Peptidase_M16   Insulinase (Peptidase family M16)         1.6        7.3   1
PhnH            Bacterial phosphonate metabolism prot     0.9        7.4   1
Terminase_GpA   Phage terminase large subunit (GpA)      -1.2        7.5   1
Trans_reg_C     Transcriptional regulatory protein, C     2.3        7.5   1
LTXXQ           LTXXQ motif                               3.0        7.6   1
DUF2309         Uncharacterized protein conserved in     -1.0        7.7   1
SoxG            Sarcosine oxidase, gamma subunit fami     1.0        7.7   1
HEAT_PBS        PBS lyase HEAT-like repeat                3.9        7.8   2
peroxidase      Peroxidase                                0.9        7.9   1
7TMR-DISMED2    7TMR-DISM extracellular 2                 1.7        7.9   1
Nodulin         Nodulin                                  -1.1        7.9   1
Anthrax_toxA    Anthrax toxin LF subunit                  0.3        8.1   1
MCE             mce related protein                       1.8        8.1   1
DUF348          Domain of unknown function (DUF348)       2.8        8.2   1
DUF1254         Protein of unknown function (DUF1254)     1.1        8.2   1
Peptidase_C41   Hepatitis E cysteine protease             0.7        8.3   1
DUF2231         Predicted membrane protein (DUF2231)      1.2        8.4   1
Thia_YuaJ       Thiamine transporter protein (Thia_Yu     1.1        8.4   1
DUF211          Uncharacterized ArCR, COG1888            -0.1        8.6   1
Neurokinin_B    Neurokinin B                              1.5        8.6   1
RHS_repeat      RHS Repeat                                2.3        8.6   2
TIR             TIR domain                                0.3        8.7   1
DOPA_dioxygen   Dopa 4,5-dioxygenase family               0.9        8.7   1
MxiH            Type III secretion needle MxiH like       2.0        8.7   1
PAS_5           PAS domain                                1.3        8.9   1
AroM            AroM protein                              0.1          9   1
Glyco_hydro_56  Hyaluronidase                            -0.3        9.1   1
Rop             Rop protein                               0.9        9.2   1
Fibritin_C      Fibritin C-terminal region                0.5        9.5   1
Nitroreductase  Nitroreductase family                     1.7        9.5   1
DUF2534         Protein of unknown function (DUF2534)     1.4        9.5   1
Cir_N           N-terminal domain of CBF1 interacting     2.6        9.6   1
Metallophos     Calcineurin-like phosphoesterase          1.4        9.6   1
Omt_N           O-methyltransferase N-terminus            0.7        9.6   1
Kin17_mid       Domain of Kin17 curved DNA-binding pr     1.2        9.8   1
SgaT_UlaA       Putative sugar-specific permease, Sga    -1.1        9.9   1
GFA             Glutathione-dependent formaldehyde-ac     1.5         10   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
MxiH              1/1      64    86 ..     1    25 [.     2.0      8.7
RinB              1/1     102   116 ..     1    15 [.     3.3      2.6
Thia_YuaJ         1/1     110   121 ..     1    12 [.     1.1      8.4
DUF2534           1/1     130   139 ..     1    10 [.     1.4      9.5
RecO              1/1     141   177 ..   223   259 .]     0.7      5.4
peroxidase        1/1     212   225 ..   345   364 .]     0.9      7.9
LRV_FeS           1/2     295   305 ..    48    58 .]     1.1      9.3
SPOR              1/1     499   524 ..    48    77 .]     1.8      7.1
DUF1853           1/1     503   514 ..     1    12 [.     2.1      6.2
HEAT_PBS          1/2     503   537 ..     1    27 []     1.4       39
Anthrax_toxA      1/1     505   520 ..     1    17 [.     0.3      8.1
HGTP_anticodon    1/1     540   567 ..     1    34 [.     5.5     0.61
IlvB_leader       1/2     541   550 ..    22    32 .]     1.2       13
Annexin           1/1     554   568 ..     1    15 [.     6.7     0.49
CNP1              1/1     555   565 ..   153   165 .]     2.1      3.9
DUF399            1/2     562   574 ..   215   228 .]     0.5      9.7
TrkA_N            1/1     611   631 ..   100   121 .]     6.0     0.68
SLBB              1/1     644   669 ..    32    62 .]     3.5      5.5
Peptidase_S15     1/1     825   873 ..    57    93 ..     0.4      3.4
Gp23              1/1     840   856 ..   486   502 .]     1.6      2.4
Pyocin_S          1/1     847   854 ..   175   182 .]     2.7      2.1
CcdA              1/1     890   909 ..    53    72 .]     3.1      3.6
Omt_N             1/1     933   939 ..   115   121 .]     0.7      9.6
LRV_FeS           2/2    1008  1020 ..    46    58 .]     4.4     0.93
Rop               1/1    1030  1045 ..    50    65 .]     0.9      9.2
Fic               1/1    1065  1071 ..    16    22 ..     3.7      4.2
DUF1624           1/1    1116  1124 ..     1     9 [.    -0.3      6.6
GFA               1/1    1118  1143 ..    74    99 .]     1.5       10
7TMR-DISMED2      1/1    1155  1178 ..    82   104 ..     1.7      7.9
Peptidase_C41     1/1    1174  1185 ..     1    12 [.     0.7      8.3
Plug              1/1    1246  1264 ..    85   104 .]     3.7      1.9
FecR              1/1    1264  1278 ..     1    15 [.     2.2      6.3
DUF586            1/1    1305  1313 ..    71    79 .]     2.7      3.3
DUF1424           1/1    1374  1382 ..   321   329 .]    -0.2      4.8
DUF2309           1/1    1435  1445 ..   871   881 .]    -1.0      7.7
DUF2168           1/1    1449  1471 ..   109   131 ..     0.1      5.5
DUF211            1/1    1459  1470 ..     1    11 [.    -0.1      8.6
Alpha_TIF         1/1    1522  1534 ..   360   373 .]     2.7     0.99
Nodulin           1/1    1526  1539 ..   354   367 .]    -1.1      7.9
Maf_N             1/1    1572  1586 ..    23    37 .]     3.0      4.6
OTU               1/3    1632  1644 ..     1    13 [.     5.2     0.73
Rz1               1/1    1649  1677 ..    34    62 .]     6.1     0.57
DUF2131           1/1    1650  1667 ..    50    67 .]     2.3        5
PIN               1/1    1661  1706 ..   100   151 .]     3.2      1.2
AmoA              1/1    1705  1724 ..    23    41 ..     0.4      5.9
TIR               1/1    1729  1738 ..   141   150 .]     0.3      8.7
Cas_Csy4          1/1    1730  1755 ..    77   102 ..     0.5      6.4
Corona_nucleoca   1/1    1738  1752 ..   345   359 ..     0.4      5.7
OTU               2/3    1783  1830 ..   100   157 .]     1.7      7.7
Tellurium_res     1/1    1839  1866 ..     1    25 [.     1.6      3.9
DUF2249           1/1    1892  1907 ..    35    51 ..     1.7      6.1
Peptidase_S68     1/1    1895  1907 ..     1    15 [.     3.2      5.3
DUF2044           1/1    1898  1908 ..   609   619 .]    -1.0        4
FrhB_FdhB_C       1/1    1959  1983 ..   155   186 .]     1.8        4
DUF1780           1/1    1992  2003 ..     1    12 [.     2.0      2.4
Catalase-rel      1/1    2069  2077 ..    77    85 .]     3.2      2.7
Nitroreductase    1/1    2071  2094 ..    79   104 .]     1.7      9.5
SEP               1/1    2171  2187 ..    59    75 .]     4.9        1
Senescence        1/1    2215  2225 ..     1    11 [.     0.6      3.1
DUF413            1/1    2239  2255 ..    78    94 .]     2.6      4.2
ORF6N             1/1    2292  2304 ..     1    13 [.     1.5      4.8
Adeno_E3_CR1      1/1    2315  2327 ..     1    13 [.     7.1    0.094
DUF1845           1/1    2332  2351 ..     1    23 [.     3.3      1.2
FLO_LFY           1/1    2502  2529 ..   334   360 .]     1.0      1.3
DUF348            1/1    2548  2559 ..     1    12 [.     2.8      8.2
Peptidase_M16     1/1    2567  2592 ..   135   160 .]     1.6      7.3
DUF606            1/1    2680  2700 ..   116   136 .]     3.1      4.8
Trans_reg_C       1/1    2774  2803 ..     1    28 [.     2.3      7.5
DUF399            2/2    2782  2800 ..     1    19 [.     2.1      3.5
DUF2239           1/1    2802  2818 ..   131   147 ..     0.8      4.4
DUF1485           1/1    2824  2842 ..   282   300 .]     2.6      2.7
Neugrin           1/1    2826  2841 ..     1    16 [.     1.3      2.4
SgaT_UlaA         1/1    2835  2847 ..   458   470 .]    -1.1      9.9
PAS_5             1/1    2927  2942 ..   126   142 .]     1.3      8.9
DUF179            1/1    2984  2998 ..   149   163 .]     2.5        2
Glyco_hydro_56    1/1    3067  3078 ..     1    12 [.    -0.3      9.1
Neurokinin_B      1/1    3067  3082 ..    44    59 .]     1.5      8.6
BCSC_C            1/1    3138  3212 ..     1    76 [.     6.2     0.13
RHS_repeat        1/2    3181  3192 ..    28    44 .]     0.3       31
AroM              1/1    3183  3199 ..   168   184 ..     0.1        9
Peptidase_U35     1/1    3213  3235 ..   159   183 .]     5.4     0.27
ClpS              1/1    3247  3262 ..    62    83 .]     3.1      6.9
MucBP             1/1    3252  3278 ..     1    27 [.     3.2      4.1
MCE               1/1    3254  3267 ..     1    15 [.     1.8      8.1
He_PIG            1/1    3255  3267 ..    49    61 .]     6.0     0.64
DUF824            1/1    3257  3271 ..    16    30 ..     7.0     0.67
Sigma70_r3        1/1    3292  3313 ..    61    83 .]     4.1      2.8
P-mevalo_kinase   1/1    3309  3315 ..   115   121 .]     2.0        2
FRG1              1/1    3363  3380 ..   164   181 ..     2.8     0.19
Pyridox_oxidase   1/1    3367  3381 ..    12    26 ..     2.0      5.6
GlcNAc_2-epim     1/1    3430  3445 ..     1    16 [.    -0.2      5.3
Adeno_VII         1/1    3457  3489 ..    93   132 .]     2.3      5.2
Glyco_transf_22   1/1    3459  3485 ..   446   472 ..     0.1      2.4
CLP_protease      1/1    3489  3505 ..   168   184 .]     1.1      6.3
DUF1865           1/1    3503  3515 ..     1    13 [.     1.8      3.8
SWIRM             1/1    3647  3666 ..     1    20 [.     3.4        3
OHCU_decarbox     1/1    3648  3680 ..    44    80 ..     6.5     0.42
Albicidin_res     1/1    3654  3671 ..     1    18 [.     1.4      6.7
Pertussis_S2S3    1/1    3701  3723 ..     1    24 [.     0.5      6.9
DUF1254           1/1    3740  3751 ..   113   126 .]     1.1      8.2
OTU               3/3    3781  3791 ..     1    11 [.     1.0       12
SoxG              1/1    3786  3797 ..   149   160 .]     1.0      7.7
PCP_red           1/1    3811  3831 ..    25    45 .]     3.9      2.2
HEAT_PBS          2/2    3830  3850 ..     1    21 [.     2.5       19
LTXXQ             1/1    3870  3882 ..    11    23 .]     3.0      7.6
Mt_ATP-synt_D     1/1    3886  3896 ..   161   180 .]     1.0      6.3
DUF1550           1/1    3896  3908 ..    50    62 .]     3.0      2.2
DNA_pol_viral_C   1/1    4039  4047 ..   237   245 .]    -0.2      1.9
DUF1134           1/1    4068  4091 ..     1    24 [.     1.3      2.6
SipA              1/1    4081  4111 ..   568   598 ..     2.6     0.92
Abhydrolase_3     1/1    4171  4202 ..   216   247 .]     3.7      1.2
DUF1896           1/1    4184  4196 ..   135   147 .]     4.4     0.67
PI3K_1B_p101      1/1    4268  4275 ..   940   947 .]    -1.1      5.3
Phage_portal_2    1/1    4353  4400 ..     1    48 [.     0.5      5.7
DUF1740           1/1    4355  4373 ..     1    19 [.     2.4        3
PhnH              1/1    4357  4370 ..   190   203 .]     0.9      7.4
Kin17_mid         1/1    4389  4404 ..   120   135 .]     1.2      9.8
Cir_N             1/1    4400  4413 ..    24    37 .]     2.6      9.6
HATPase_c         1/1    4493  4512 ..   107   126 .]     4.6     0.99
RVP               1/1    4521  4563 ..    55    97 ..     2.7        4
FCD               1/1    4704  4721 ..     1    18 [.     5.8     0.23
DUF834            1/1    4720  4743 ..     1    25 [.     2.7      6.1
MMPL              1/1    4788  4801 ..     1    14 [.     3.4      3.8
YdjC              1/1    4814  4866 ..   175   228 ..     1.0      5.3
DUF2322           1/1    4888  4902 ..    87   101 .]     3.0      2.7
MSA_2             1/1    4901  4911 ..     1    13 [.    -0.3      6.5
GvpL_GvpF         1/1    4925  4937 ..   263   275 .]     2.5      1.1
Plug_translocon   1/1    4929  4942 ..    22    35 .]     4.1        5
RHS_repeat        2/2    4971  4992 ..    19    44 .]     2.0       11
Terminase_GpA     1/1    5010  5027 ..   650   667 .]    -1.2      7.5
Gp49              1/1    5038  5053 ..    42    57 .]     4.8      1.8
Pox_A_type_inc    1/1    5041  5052 ..     1    12 [.     4.6      4.8
Fibritin_C        1/1    5062  5085 ..   103   127 .]     0.5      9.5
IlvB_leader       2/2    5079  5109 ..     1    32 []     2.6      4.6
Rubella_E1        1/1    5099  5109 ..     1    11 [.    -1.6      6.2
Metallophos       1/1    5102  5111 ..   115   124 .]     1.4      9.6
Herpes_ori_bp     1/1    5114  5151 ..   834   870 .]     1.9      1.4
adh_short         1/1    5133  5145 ..   169   181 .]     1.9      4.8
DUF2231           1/1    5140  5147 ..     1     8 [.     1.2      8.4
APH               1/1    5202  5334 ..     1    53 [.     2.9      1.5
Hp0062            1/1    5308  5321 ..    73    86 .]     1.0      5.5
NIF3              1/1    5325  5344 ..   231   250 .]     1.4        5
BHD_3             1/1    5337  5349 ..    67    79 .]     2.0      6.4
JTB               1/1    5342  5356 ..   106   120 .]     3.2      1.8
TPR_2             1/1    5345  5359 ..    20    34 .]     3.9      5.6
Mob1_phocein      1/1    5378  5395 ..     1    20 [.     1.9      3.7
DmpG_comm         1/1    5531  5545 ..    24    38 ..     2.3      5.9
DOPA_dioxygen     1/1    5602  5611 ..    87    98 ..     0.9      8.7

Alignments of top-scoring domains:
MxiH: domain 1 of 1, from 64 to 86: score 2.0, E = 8.7
                   *->MAdifgwngd.vnLddIaqqldqgan<-*
                      M   + ++g++++L d a+qld++a+
  gi|1824401    64    M---LVDDGGkNYLRDFAEQLDRIAE    86

RinB: domain 1 of 1, from 102 to 116: score 3.3, E = 2.6
                   *->viKqiLRLLFLLAmY<-*
                      vi +i+RLL  +A+Y
  gi|1824401   102    VIAEIIRLLIEIAIY    116

Thia_YuaJ: domain 1 of 1, from 110 to 121: score 1.1, E = 8.4
                   *->lvEiAifaALAm<-*
                      l+EiAi +A+++
  gi|1824401   110    LIEIAIYLAMSF    121

DUF2534: domain 1 of 1, from 130 to 139: score 1.4, E = 9.5
                   *->mImlekLrtk<-*
                       Im++kLr++
  gi|1824401   130    QIMMAKLRSR    139

RecO: domain 1 of 1, from 141 to 177: score 0.7, E = 5.4
                   *->ftaakLkplldskleesslvERlyelsrsflprrelL<-*
                      f+ + L  ll ++ ++ sl E + e+++ f+ r +++
  gi|1824401   141    FILTTLSHLLQRLHLTPSLTEAFAEAFTTFAVRLAMM    177

peroxidase: domain 1 of 1, from 212 to 225: score 0.9, E = 7.9
                CS    HHHHHHHHHHHHHTHHHHHH
                   *->dprTraiVAWKVMLdrfann<-*
                      d + ++iV      ++f+ n
  gi|1824401   212    DKFAKDIV------RSFDGN    225

LRV_FeS: domain 1 of 2, from 295 to 305: score 1.1, E = 9.3
                CS    HHH-GGGGGGG
                   *->FrlNPeLAdeY<-*
                      Fr+NPeL   +
  gi|1824401   295    FRNNPELWRNN    305

SPOR: domain 1 of 1, from 499 to 524: score 1.8, E = 7.1
                CS    SS--TTTHHHHHHHHHH...HH--S-----
                   *->GpfasreeAraalkkLkaasaagisafvvk<-*
                      Gp + re+A + l+ L+    +g+ +  +
  gi|1824401   499    GPGEAREQALRDLAALR----GGLPPSSTE    524

DUF1853: domain 1 of 1, from 503 to 514: score 2.1, E = 6.2
                   *->lrdpavRDLaWl<-*
                      +r++a+RDLa+l
  gi|1824401   503    AREQALRDLAAL    514

HEAT_PBS: domain 1 of 2, from 503 to 537: score 1.4, E = 39
                CS    HHHHHHHHHCCCSS        HCCHHHHHHHHCT
                   *->vRraAaraLgalgd........peAipaLleaLed<-*
                      +R+ A+r L+al+ + +++++++ + + L + L++
  gi|1824401   503    AREQALRDLAALRGglppssteTGVRDSLNAHLAH    537

Anthrax_toxA: domain 1 of 1, from 505 to 520: score 0.3, E = 8.1
                   *->adaLkdeaaakesGvpa<-*
                       +aL+d+aa+++ G+p+
  gi|1824401   505    EQALRDLAALRG-GLPP    520

HGTP_anticodon: domain 1 of 1, from 540 to 567: score 5.5, E = 0.61
                CS    SEEEEESSS.HH-SSHHHHHHHHHHHHHHHHTTT
                   *->qVvviPlgekdeqkeaeeledyAkklaeeLraaG<-*
                      +V+v+P+g + +      ++  A++++++L+  G
  gi|1824401   540    EVRVVPVG-NSP-----SAQLDAEEVRRALKGFG    567

IlvB_leader: domain 1 of 2, from 541 to 550: score 1.2, E = 13
                   *->vRvvvvvGsAP<-*
                      vR vv vG+ P
  gi|1824401   541    VR-VVPVGNSP    550

Annexin: domain 1 of 1, from 554 to 568: score 6.7, E = 0.49
                CS    HHHHHHHHHHSSSSH
                   *->yDAelLrkAmkglGT<-*
                       DAe+ r+A kg+GT
  gi|1824401   554    LDAEEVRRALKGFGT    568

CNP1: domain 1 of 1, from 555 to 565: score 2.1, E = 3.9
                   *->DGRaaeaVrrLka<-*
                      D  a+e++r+Lk+
  gi|1824401   555    D--AEEVRRALKG    565

DUF399: domain 1 of 2, from 562 to 574: score 0.5, E = 9.7
                   *->aYrkglGVPlhlad<-*
                      a  kg+G+P+ +++
  gi|1824401   562    A-LKGFGTPATVDR    574

TrkA_N: domain 1 of 1, from 611 to 631: score 6.0, E = 0.68
                CS    -SSGGGHHHHHH.TTTSEEE-H
                   *->andpehaekLrrnlGADeVisP<-*
                      a +pe ae+L   +GAD+++
  gi|1824401   611    AGSPEAAELLDG-AGADRAVVL    631

SLBB: domain 1 of 1, from 644 to 669: score 3.5, E = 5.5
                   *->GltedadlsrinlarlkavyvimgGpmmgil<-*
                      G t +  +s+++l+r+++     g p+   +
  gi|1824401   644    GETGEPVRSAVELTRQGP-----GDPVQVRP    669

Peptidase_S15: domain 1 of 1, from 825 to 873: score 0.4, E = 3.4
                CS    SEE.......... ... ... B.S      S.S. . .. ..HHHH
                   *->pwtisvtdrefqa.eap.vka.pvd......kAee.f.hi.sYtLND
                      pwt ++td + ++++a+++ a p+++++++++A+++++  +++tL D
  gi|1824401   825    PWTGTATDLHLESgRADgTHAaPGTstgnggPATDqApPGrPGTLRD 871

                CS HH
                   Yf<-*
                   ++
  gi|1824401   872 FL    873

Gp23: domain 1 of 1, from 840 to 856: score 1.6, E = 2.4
                   *->AestkqAPgeriqsGmP<-*
                      A+ t  APg   ++G P
  gi|1824401   840    ADGTHAAPGTSTGNGGP    856

Pyocin_S: domain 1 of 1, from 847 to 854: score 2.7, E = 2.1
                   *->PGvvTGkG<-*
                      PG++TG+G
  gi|1824401   847    PGTSTGNG    854

CcdA: domain 1 of 1, from 890 to 909: score 3.1, E = 3.6
                   *->AelarlidetGsFaDEyRdf<-*
                      A+la + d  GsF D  R+
  gi|1824401   890    AALAAFPDDPGSFYDHDRSP    909

Omt_N: domain 1 of 1, from 933 to 939: score 0.7, E = 9.6
                   *->LDtRAYR<-*
                      +D+ AYR
  gi|1824401   933    MDASAYR    939

LRV_FeS: domain 2 of 2, from 1008 to 1020: score 4.4, E = 0.93
                CS    HHHHH-GGGGGGG
                   *->RFFrlNPeLAdeY<-*
                      RF   NP LA  Y
  gi|1824401  1008    RFLHSNPALATNY    1020

Rop: domain 1 of 1, from 1030 to 1045: score 0.9, E = 9.2
                CS    HHHHHHHHHHHCHSSS
                   *->eeLYrsLsAkvGdela<-*
                      ++L+++  A+vG   a
  gi|1824401  1030    DALFQQHYARVGRPDA    1045

Fic: domain 1 of 1, from 1065 to 1071: score 3.7, E = 4.2
                   *->HPFvDGN<-*
                      HPF DGN
  gi|1824401  1065    HPFQDGN    1071

DUF1624: domain 1 of 1, from 1116 to 1124: score -0.3, E = 6.6
                   *->RfgeIDilR<-*
                      R+g++D++R
  gi|1824401  1116    RDGALDTVR    1124

GFA: domain 1 of 1, from 1118 to 1143: score 1.5, E = 10
                CS    ......TSTTTTEEEE-GGGBSS--S
                   *->galddpapfppvlhvfvdsklpwlsl<-*
                      gald ++p p++ +++vd++l+   +
  gi|1824401  1118    GALDTVRPRPAPAQDAVDPHLESGRG    1143

7TMR-DISMED2: domain 1 of 1, from 1155 to 1178: score 1.7, E = 7.9
                   *->lldgsgsiraqrtGdalpfae.Rq<-*
                      +++g++++ ++ +G a+pfa+ R+
  gi|1824401  1155    PPEGRQPVVTTLSGHAVPFAQlRR    1178

Peptidase_C41: domain 1 of 1, from 1174 to 1185: score 0.7, E = 8.3
                   *->AqCRRWLsAGFH<-*
                      Aq RRW+  G H
  gi|1824401  1174    AQLRRWVPEGPH    1185

Plug: domain 1 of 1, from 1246 to 1264: score 3.7, E = 1.9
                CS    EEEE.SCHTTTTSSTGSSEE
                   *->evlkDGpssalyGagalgGv<-*
                      +v + Gp++al G+g+  G+
  gi|1824401  1246    TVFT-GPPTALPGSGTKRGA    1264

FecR: domain 1 of 1, from 1264 to 1278: score 2.2, E = 6.3
                   *->adyrTavGerrsvtL<-*
                      ady+++ G  r+vtL
  gi|1824401  1264    ADYFAGHGTSRTVTL    1278

DUF586: domain 1 of 1, from 1305 to 1313: score 2.7, E = 3.3
                   *->eGDpDqPiv<-*
                      +GD D+P+v
  gi|1824401  1305    DGDQDRPLV    1313

DUF1424: domain 1 of 1, from 1374 to 1382: score -0.2, E = 4.8
                   *->RLRtPPPGG<-*
                      RL tP PGG
  gi|1824401  1374    RLFTPEPGG    1382

DUF2309: domain 1 of 1, from 1435 to 1445: score -1.0, E = 7.7
                   *->aalryvgggtW<-*
                      aal yv+g++W
  gi|1824401  1435    AALAYVDGLRW    1445

DUF2168: domain 1 of 1, from 1449 to 1471: score 0.1, E = 5.5
                   *->aTsArlypntisyeelRkmleer<-*
                      +T Ar ++++++++ lR+m  +r
  gi|1824401  1449    GTAARYGDGRMTPDLLRRMVIDR    1471

DUF211: domain 1 of 1, from 1459 to 1470: score -0.1, E = 8.6
                   *->Makg.lRRlVLD<-*
                      M +  lRR+V+D
  gi|1824401  1459    MTPDlLRRMVID    1470

Alpha_TIF: domain 1 of 1, from 1522 to 1534: score 2.7, E = 0.99
                   *->GstvEALLddPsdp<-*
                      G+t  ALL++P+ p
  gi|1824401  1522    GTTLDALLPPPP-P    1534

Nodulin: domain 1 of 1, from 1526 to 1539: score -1.1, E = 7.9
                   *->dillaepppgsPPi<-*
                      d+ll++ppp++PP
  gi|1824401  1526    DALLPPPPPELPPT    1539

Maf_N: domain 1 of 1, from 1572 to 1586: score 3.0, E = 4.6
                   *->LnLtpEDAvEaLign<-*
                      L L+pED  E+L
  gi|1824401  1572    LALSPEDTAELLRRR    1586

OTU: domain 1 of 3, from 1632 to 1644: score 5.2, E = 0.73
                   *->pgDGnCLfravsd<-*
                      pg G+CLfra+ d
  gi|1824401  1632    PGGGDCLFRALLD    1644

Rz1: domain 1 of 1, from 1649 to 1677: score 6.1, E = 0.57
                   *->PPaPPAWamqpppDwqklLneiisvSeee<-*
                      +P PPAWa   +  ++ lL e ++ Se
  gi|1824401  1649    RPVPPAWAARNVTRLRELLRERLTGSELL    1677

DUF2131: domain 1 of 1, from 1650 to 1667: score 2.3, E = 5
                   *->PidkaWvaenleqIkaaL<-*
                      P+ +aW a+n++++++ L
  gi|1824401  1650    PVPPAWAARNVTRLRELL    1667

PIN: domain 1 of 1, from 1661 to 1706: score 3.2, E = 1.2
                CS    ...HCCCCT..T.T.SHHHHHHHHHHHHHT-EEEES.HHHHCCHHHH
                   *->TekhrlrrkghkyglspnDaliaAtAkehgiklittnDedfkrvagl
                      T   rlr++   + ++++  l+a+ A+++  ++++    d++++a +
  gi|1824401  1661    T---RLREL--LRERLTGSELLASAAEANPDPVLAV-VDDLRMTAIA 1701

                CS TT-EE
                   evvpi<-*
                   +v+++
  gi|1824401  1702 GVRDP    1706

AmoA: domain 1 of 1, from 1705 to 1724: score 0.4, E = 5.9
                   *->prllkG.iNRRWLllgQaIl<-*
                      +++++G+iNRRW l +Qa++
  gi|1824401  1705    DPDALGrINRRWDLIAQAVV    1724

TIR: domain 1 of 1, from 1729 to 1738: score 0.3, E = 8.7
                CS    CHHHHHHHHH
                   *->ikfWkkalya<-*
                      +++W+++l +
  gi|1824401  1729    GRRWRRLLRD    1738

Cas_Csy4: domain 1 of 1, from 1730 to 1755: score 0.5, E = 6.4
                   *->qsWLkgLrneDYchisevkpVPddvk<-*
                      ++W++ Lr  +Y h  ev+p+P+d++
  gi|1824401  1730    RRWRRLLRDGGYPHLAEVAPTPADAR    1755

Corona_nucleoca: domain 1 of 1, from 1738 to 1752: score 0.4, E = 5.7
                   *->akrypqlAeLVPsva<-*
                      +++yp lAe +P++a
  gi|1824401  1738    DGGYPHLAEVAPTPA    1752

OTU: domain 2 of 3, from 1783 to 1830: score 1.7, E = 7.7
                   *->fAlahilrvpIivydlyklqsgritvfieiygkylplnkkppirlsy
                      +Alahil+  + +   ++  ++r+  +  +++  +p +++  ++lsy
  gi|1824401  1783    QALAHILGLDLRL---VQP-DPRAPGS-TFVTPLNPGGPGGALHLSY 1824

                   lghLeglgeHY<-*
                   +g       H+
  gi|1824401  1825 NG-----TDHF    1830

Tellurium_res: domain 1 of 1, from 1839 to 1866: score 1.6, E = 3.9
                   *->paapaPaPtPappPappPp...paqppV<-*
                       +apa aP+P+ +Pap+P++++p+++ V
  gi|1824401  1839    LPAPASAPAPTSAPAPAPAtedPVGSDV    1866

DUF2249: domain 1 of 1, from 1892 to 1907: score 1.7, E = 6.1
                   *->DPlPLlyQfeaerpFgq<-*
                      DP+PL  Q+e +rp ++
  gi|1824401  1892    DPVPLETQLERHRP-AR    1907

Peptidase_S68: domain 1 of 1, from 1895 to 1907: score 3.2, E = 5.3
                   *->WsdLeTaLrreakkR<-*
                        +LeT+L+r  + R
  gi|1824401  1895    --PLETQLERHRPAR    1907

DUF2044: domain 1 of 1, from 1898 to 1908: score -1.0, E = 4
                   *->keLEreRkeRl<-*
                      ++LEr R +Rl
  gi|1824401  1898    TQLERHRPARL    1908

FrhB_FdhB_C: domain 1 of 1, from 1959 to 1983: score 1.8, E = 4
                   *->ellelAveaGyiEtkpidekkplaglelveKl<-*
                      +ll+++   G+++++ +d +      e+++Kl
  gi|1824401  1959    GLLNGV---GVLTLRSPDQV----AREILGKL    1983

DUF1780: domain 1 of 1, from 1992 to 2003: score 2.0, E = 2.4
                CS    -HHHHHHHHHHH
                   *->deaDyLRLLtiq<-*
                      dea+ LRLLt q
  gi|1824401  1992    DEAELLRLLTDQ    2003

Catalase-rel: domain 1 of 1, from 2069 to 2077: score 3.2, E = 2.7
                CS    HHHHHHHHH
                   *->GarVAkaLg<-*
                      G+rVA+aLg
  gi|1824401  2069    GRRVAAALG    2077

Nitroreductase: domain 1 of 1, from 2071 to 2094: score 1.7, E = 9.5
                CS    ..HH.HHTT-. -T..TEEEEEEEEE-
                   *->eivrvelLgld.PekgyepvallalGy<-*
                      + v+ ++Lg+++P  ++ +  +++lG+
  gi|1824401  2071    R-VA-AALGMGpPL-NWMLKIGVSLGW    2094

SEP: domain 1 of 1, from 2171 to 2187: score 4.9, E = 1
                CS    XXS----------S---
                   *->dYvepkkkfkpFsGeGr<-*
                      +++ p    +pFsG+Gr
  gi|1824401  2171    SWRLPDDLTVPFSGPGR    2187

Senescence: domain 1 of 1, from 2215 to 2225: score 0.6, E = 3.1
                   *->EEVLLrIpGar<-*
                      EEV L I+Gar
  gi|1824401  2215    EEVALAISGAR    2225

DUF413: domain 1 of 1, from 2239 to 2255: score 2.6, E = 4.2
                   *->rkkRfytLcgtkkaand<-*
                      r+ R + L+g+++ +++
  gi|1824401  2239    RPGRLHGLFGRFSGPVS    2255

ORF6N: domain 1 of 1, from 2292 to 2304: score 1.5, E = 4.8
                   *->vneLqvIEyngqR<-*
                      v+ L +++y++qR
  gi|1824401  2292    VRDLAQTTYQNQR    2304

Adeno_E3_CR1: domain 1 of 1, from 2315 to 2327: score 7.1, E = 0.094
                   *->tvyvGsNlTLvGP<-*
                       v+ G N+TL+GP
  gi|1824401  2315    QVTAGPNHTLIGP    2327

DUF1845: domain 1 of 1, from 2332 to 2351: score 3.3, E = 1.2
                   *->qlklGsLLLRSsltKETGRKHHL<-*
                      +l+ G+L +R +l+  TGR H L
  gi|1824401  2332    RLQGGPL-VRADLS--TGRGHYL    2351

FLO_LFY: domain 1 of 1, from 2502 to 2529: score 1.0, E = 1.3
                   *->ahprLs.IWYVPTKLRqLCHaeRskasa<-*
                      +hprL++ WY   +LR   H +R+   a
  gi|1824401  2502    RHPRLAkLWYGDGRLRTALHNDRQVREA    2529

DUF348: domain 1 of 1, from 2548 to 2559: score 2.8, E = 8.2
                   *->pVtvvvDGkekt<-*
                      pVt++ DGk+++
  gi|1824401  2548    PVTLTEDGKVRR    2559

Peptidase_M16: domain 1 of 1, from 2567 to 2592: score 1.6, E = 7.3
                CS    HHHHHHHHHHHHTTTSGGGSHSS-TH
                   *->qevlldnlhaaayrgtpLgrsllgPg<-*
                      +++l+d + ++++++ +L ++++g++
  gi|1824401  2567    RARLTDRRFETTMSERSLRNAVIGTE    2592

DUF606: domain 1 of 1, from 2680 to 2700: score 3.1, E = 4.8
                   *->krplsltrllGlllllaGvvL<-*
                      +rp  ++rl+ ++ll aG+++
  gi|1824401  2680    RRPRGWARLASVGLLGAGLFV    2700

Trans_reg_C: domain 1 of 1, from 2774 to 2803: score 2.3, E = 7.5
                CS    TEE -E -SHHHHHHHHHHHHTTTSEEEHH
                   *->gep.vv.LspkereLLalLllnpGrvvsrd<-*
                      g++++ +  p+er+L ++Ll +p+ v+s +
  gi|1824401  2774    GTRpLPhGQPSERQLVRRLLSAPHVVLSAE    2803

DUF399: domain 2 of 2, from 2782 to 2800: score 2.1, E = 3.5
                   *->tiSpeqLlerLanarvVlv<-*
                        S  qL++rL++a++V++
  gi|1824401  2782    QPSERQLVRRLLSAPHVVL    2800

DUF2239: domain 1 of 1, from 2802 to 2818: score 0.8, E = 4.4
                   *->ahagkDRrRaAqeAAYR<-*
                      a++g++R+R  q+ A+R
  gi|1824401  2802    AEGGRQRQRLVQDTADR    2818

DUF1485: domain 1 of 1, from 2824 to 2842: score 2.6, E = 2.7
                   *->fvfvApflpldeavdrAla<-*
                      +++ Ap  p++ a++rA+a
  gi|1824401  2824    WHVSAPGAPIRTALRRAMA    2842

Neugrin: domain 1 of 1, from 2826 to 2841: score 1.3, E = 2.4
                   *->mEAPGAPPRtLtWEAm<-*
                      + APGAP Rt    Am
  gi|1824401  2826    VSAPGAPIRTALRRAM    2841

SgaT_UlaA: domain 1 of 1, from 2835 to 2847: score -1.1, E = 9.9
                   *->tagwmgeadlsll<-*
                      ta++ ++adls+
  gi|1824401  2835    TALRRAMADLSIA    2847

PAS_5: domain 1 of 1, from 2927 to 2942: score 1.3, E = 8.9
                   *->PLatasgtpdriLGlLa<-*
                      PL++a+g++  + G++a
  gi|1824401  2927    PLQQAPGEQ-AVVGSYA    2942

DUF179: domain 1 of 1, from 2984 to 2998: score 2.5, E = 2
                CS    S-GGGHHHHHHHHGG
                   *->tppeerWqaAlrrlG<-*
                      +++ +rW+aA+   G
  gi|1824401  2984    VAVRDRWTAAMGAVG    2998

Glyco_hydro_56: domain 1 of 1, from 3067 to 3078: score -0.3, E = 9.1
                CS    ----....----
                   *->fraPPvipnrpF<-*
                      +r PP++ +r+F
  gi|1824401  3067    YRLPPFLRGRRF    3078

Neurokinin_B: domain 1 of 1, from 3067 to 3082: score 1.5, E = 8.6
                   *->YqLPPslLrRLydsrs<-*
                      Y LPP l  R + s++
  gi|1824401  3067    YRLPPFLRGRRFPSHP    3082

BCSC_C: domain 1 of 1, from 3138 to 3212: score 6.2, E = 0.13
                   *->lSkLtaaevPlevriPleagdghlffrvdpVsLdAGsldtdngysla
                        +++a++ P +  +P  ++ g+l f+ +pV+ + + l t  gy l+
  gi|1824401  3138    --RYRAWSRPHH--LPVGGSPGQLRFTLTPVTTTVQRLRT--GYELE 3178

                   rFGtgaalgaagsgaavgaa.....sQsasGVal<-*
                   ++ t+a  +aag+++  ga  + + sQ+a+G ++
  gi|1824401  3179 DYRTTARDDAAGTTQDRGADvtlsaSQRAAGSGV    3212

RHS_repeat: domain 1 of 2, from 3181 to 3192: score 0.3, E = 31
                   *->rltaltlttstdasGtt<-*
                      r ta+     +da+Gtt
  gi|1824401  3181    RTTAR-----DDAAGTT    3192

AroM: domain 1 of 1, from 3183 to 3199: score 0.1, E = 9
                   *->sdideAAaeLldqGadL<-*
                      +++d+AA++++d Gad+
  gi|1824401  3183    TARDDAAGTTQDRGADV    3199

Peptidase_U35: domain 1 of 1, from 3213 to 3235: score 5.4, E = 0.27
                   *->vVtfPAypdarvevaarslenvkqe<-*
                      +V +PA +++  ++++rs ++++
  gi|1824401  3213    LVANPALQGT--AARQRSSARTETA    3235

ClpS: domain 1 of 1, from 3247 to 3262: score 3.1, E = 6.9
                   *->EtkveqvkdkarenghPLtctm<-*
                      +t++e+v++++      Lt+tm
  gi|1824401  3247    QTHAEIVTSYT------LTVTM    3262

MucBP: domain 1 of 1, from 3252 to 3278: score 3.2, E = 4.1
                   *->ltktvtvTvhYvDedGnelapdvvQtv<-*
                       ++++t Tv+  D+ G++l p+ + +v
  gi|1824401  3252    IVTSYTLTVTMTDASGEPLGPTATAPV    3278

MCE: domain 1 of 1, from 3254 to 3267: score 1.8, E = 8.1
                   *->rgytvtayFddalgG<-*
                       +yt+t++++da +G
  gi|1824401  3254    TSYTLTVTMTDA-SG    3267

He_PIG: domain 1 of 1, from 3255 to 3267: score 6.0, E = 0.64
                   *->sytftvtatdgsg<-*
                      syt tvt td+sg
  gi|1824401  3255    SYTLTVTMTDASG    3267

DUF824: domain 1 of 1, from 3257 to 3271: score 7.0, E = 0.67
                   *->pltVTvKDaaGnPvp<-*
                      +ltVT +Da+G P++
  gi|1824401  3257    TLTVTMTDASGEPLG    3271

Sigma70_r3: domain 1 of 1, from 3292 to 3313: score 4.1, E = 2.8
                   *->eeeDselgdlleDdeaespedav<-*
                      +e+D++ g l+e + ++ pe av
  gi|1824401  3292    PEGDGAAGALTEQE-IPEPERAV    3313

P-mevalo_kinase: domain 1 of 1, from 3309 to 3315: score 2.0, E = 2
                   *->PERvvTl<-*
                      PER+vTl
  gi|1824401  3309    PERAVTL    3315

FRG1: domain 1 of 1, from 3363 to 3380: score 2.8, E = 0.19
                   *->rinekDkkelkkAkAdGs<-*
                      ++n+ D  +l  A+AdGs
  gi|1824401  3363    AVNVHDALTLATARADGS    3380

Pyridox_oxidase: domain 1 of 1, from 3367 to 3381: score 2.0, E = 5.6
                CS    TSEEEEEEEETTS-E
                   *->pnagvLATvdadGrP<-*
                      ++a +LAT++adG P
  gi|1824401  3367    HDALTLATARADGSP    3381

GlcNAc_2-epim: domain 1 of 1, from 3430 to 3445: score -0.2, E = 5.3
                   *->GfFerLdadGqpldad<-*
                      Gf e+L+a+G+pl+++
  gi|1824401  3430    GFREALGAEGSPLPTQ    3445

Adeno_VII: domain 1 of 1, from 3457 to 3489: score 2.3, E = 5.2
                   *->aaARvryaRRvaasarRRlrRrsrrvrrrpataamraAra<-*
                      a+ R  yaR+     +RR++R++++    p++ amr+  a
  gi|1824401  3457    ADSR-LYARM-----HRRGARLLAVEN-KPRMEAMRRRKA    3489

Glyco_transf_22: domain 1 of 1, from 3459 to 3485: score 0.1, E = 2.4
                   *->alflglvhqyGaplavykvkevmshln<-*
                      +++++++h++Ga l++ ++k+ m++ +
  gi|1824401  3459    SRLYARMHRRGARLLAVENKPRMEAMR    3485

CLP_protease: domain 1 of 1, from 3489 to 3505: score 1.1, E = 6.3
                CS    HHHHHHHTS-SEE-SSS
                   *->AeEAkeYGLIDkViesr<-*
                      A +A+e G++D+V   +
  gi|1824401  3489    ASDALESGIVDNVEGAV    3505

DUF1865: domain 1 of 1, from 3503 to 3515: score 1.8, E = 3.8
                CS    SXXXEE.SXXSS-
                   *->GaGtSspdtgNqn<-*
                      Ga +Ssp  gN+n
  gi|1824401  3503    GAVSSSPMAGNSN    3515

SWIRM: domain 1 of 1, from 3647 to 3666: score 3.4, E = 3
                   *->lkeaaraswldlsalppiEl<-*
                       +++ar++wldlsa++ + l
  gi|1824401  3647    ARARAREAWLDLSADERAAL    3666

OHCU_decarbox: domain 1 of 1, from 3648 to 3680: score 6.5, E = 0.42
                   *->haamraavlaaseedqleaasalirAHPrLGgkaaqa<-*
                      +a++r+a+l++s ++++    al  +HP+L+++++++
  gi|1824401  3648    RARAREAWLDLSADERA----ALGDGHPDLATVLPRS    3680

Albicidin_res: domain 1 of 1, from 3654 to 3671: score 1.4, E = 6.7
                   *->eWpaLVaevRaamdagvd<-*
                      +W++L a+ Raa+ +g +
  gi|1824401  3654    AWLDLSADERAALGDGHP    3671

Pertussis_S2S3: domain 1 of 1, from 3701 to 3723: score 0.5, E = 6.9
                CS    SEEE--S---EEEECCEEEEEEEE
                   *->tirktGqPAaDHYYskvtAtRLLa<-*
                        r+t   AaDH   +  AtRL a
  gi|1824401  3701    -RRHTDAAAADHHRLHLAATRLTA    3723

DUF1254: domain 1 of 1, from 3740 to 3751: score 1.1, E = 8.2
                   *->ivLpPgiwkGdvPe<-*
                      ++  P+ w  ++Pe
  gi|1824401  3740    YT-APD-WRSEAPE    3751

OTU: domain 3 of 3, from 3781 to 3791: score 1.0, E = 12
                   *->pgDGnCLfrav<-*
                      p DG  +f+a+
  gi|1824401  3781    PHDGASFFHAL    3791

SoxG: domain 1 of 1, from 3786 to 3797: score 1.0, E = 7.7
                   *->slWhwLldasaE<-*
                      s++h+Ll ++++
  gi|1824401  3786    SFFHALLAVARD    3797

PCP_red: domain 1 of 1, from 3811 to 3831: score 3.9, E = 2.2
                   *->EkfArekGiteITvEvlyaAK<-*
                      E+fA+    +e+T+E + aA+
  gi|1824401  3811    ERFAARPADPEVTAEAVAAAR    3831

HEAT_PBS: domain 2 of 2, from 3830 to 3850: score 2.5, E = 19
                CS    HHHHHHHHHCCCSSHCCHHHH
                   *->vRraAaraLgalgdpeAipaL<-*
                      +R + a+aL+  g+++ ++aL
  gi|1824401  3830    ARDRLAWALADHGNEDLLDAL    3850

LTXXQ: domain 1 of 1, from 3870 to 3882: score 3.0, E = 7.6
                   *->LTpEQrqqlkrlk<-*
                      LT++Q+++++++
  gi|1824401  3870    LTAAQQAEFDAFG    3882

Mt_ATP-synt_D: domain 1 of 1, from 3886 to 3896: score 1.0, E = 6.3
                   *->ptfWPDPCniGLnHtPeEql<-*
                      +tfWP         tPe  +
  gi|1824401  3886    QTFWP---------TPEQRV    3896

DUF1550: domain 1 of 1, from 3896 to 3908: score 3.0, E = 2.2
                   *->laaLalAlArPfl<-*
                      +a+++ Al rPf+
  gi|1824401  3896    VALAVAALSRPFA    3908

DNA_pol_viral_C: domain 1 of 1, from 4039 to 4047: score -0.2, E = 1.9
                   *->qtCvaWiPP<-*
                      +t  +W PP
  gi|1824401  4039    HTTAPWLPP    4047

DUF1134: domain 1 of 1, from 4068 to 4091: score 1.3, E = 2.6
                   *->sstYsedEiidaahdFFGktagGL<-*
                      + tY++    + +++FFG+ + +L
  gi|1824401  4068    GATYTQGAPTGRGNGFFGALSTAL    4091

SipA: domain 1 of 1, from 4081 to 4111: score 2.6, E = 0.92
                   *->ekllravrkaLepaaakpfaqrRefeelrke<-*
                      + + +a++ aL  aaa+p++ rRe   lr +
  gi|1824401  4081    NGFFGALSTALRQAAAQPGPDRREASRLRTR    4111

Abhydrolase_3: domain 1 of 1, from 4171 to 4202: score 3.7, E = 1.2
                CS    HHHHHHHHHHH H.TT--EEEEEECCEETTGGG
                   *->DegeaYAerLr.aWaGVpVelveypGmiHgFll<-*
                      D ++a Ae ++ a  G  V+lve++G +H ++
  gi|1824401  4171    DADRAVAEWAAaA-TGATVTLVEENGTVHTYAG    4202

DUF1896: domain 1 of 1, from 4184 to 4196: score 4.4, E = 0.67
                CS    HHHHHHHHHTT--
                   *->TGtivlllEeygl<-*
                      TG++v+l Ee+g
  gi|1824401  4184    TGATVTLVEENGT    4196

PI3K_1B_p101: domain 1 of 1, from 4268 to 4275: score -1.1, E = 5.3
                   *->nTFSGalp<-*
                      +TFSGa p
  gi|1824401  4268    STFSGAEP    4275

Phage_portal_2: domain 1 of 1, from 4353 to 4400: score 0.5, E = 5.7
                   *->eafggqatdwaprpnrSADaallprlvilnarardLvrNndlvanav
                       +   +  ++ +r  +S+   l  ++  l a  +dL +  dl+a  +
  gi|1824401  4353    TGLTHEVLHLPRRTRVSPQDVLDLGALALEASSDDLESAEDLAAYFI 4399

                   d<-*
                   d
  gi|1824401  4400 D    4400

DUF1740: domain 1 of 1, from 4355 to 4373: score 2.4, E = 3
                   *->ilkrnselnkrvrenPeDi<-*
                      +++++  l +r+r  P+D+
  gi|1824401  4355    LTHEVLHLPRRTRVSPQDV    4373

PhnH: domain 1 of 1, from 4357 to 4370: score 0.9, E = 7.4
                   *->eavlgLPRTTrvev<-*
                      ++vl LPR Trv++
  gi|1824401  4357    HEVLHLPRRTRVSP    4370

Kin17_mid: domain 1 of 1, from 4389 to 4404: score 1.2, E = 9.8
                   *->kddEereqklleeQIk<-*
                      ++ E   ++++++QI+
  gi|1824401  4389    ESAEDLAAYFIDRQIE    4404

Cir_N: domain 1 of 1, from 4400 to 4413: score 2.6, E = 9.6
                   *->rKKieeLrkEieeE<-*
                      ++ ie +r  ++eE
  gi|1824401  4400    DRQIETRRDALAEE    4413

HATPase_c: domain 1 of 1, from 4493 to 4512: score 4.6, E = 0.99
                CS    EEEEEETTTEEEEEEEEECC
                   *->itvesepggGttftltlPla<-*
                      i+++s+ ++G+ ++l lP++
  gi|1824401  4493    ISYDSRRPRGADIVLVLPET    4512

RVP: domain 1 of 1, from 4521 to 4563: score 2.7, E = 4
                CS    SSEEEEEEEECCEEEEEEE-TTS-BEEEEEEEEEETTSS -SSE
                   *->iGGqiirvkqsdnvlveiggkkvrgqftflvlpstPvnt.nkWa<-*
                      + G + r+ ++  ++ve+ +++++g++  +v+  +P +t+  Wa
  gi|1824401  4521    VSGTTARPTWYPRRPVEVADHPTTGERRLVVHR-SPGETgPDWA    4563

FCD: domain 1 of 1, from 4704 to 4721: score 5.8, E = 0.23
                   *->elyelRaaLEplaarlAa<-*
                      ++y  Raa+E+ aa lAa
  gi|1824401  4704    QVYATRAAIERSAALLAA    4721

DUF834: domain 1 of 1, from 4720 to 4743: score 2.7, E = 6.1
                   *->rarnaavptttadtartaaatregG<-*
                       a++a+v+ +tadt+ +   +re+G
  gi|1824401  4720    AATGAGVR-LTADTSVRLLLPREDG    4743

MMPL: domain 1 of 1, from 4788 to 4801: score 3.4, E = 3.8
                   *->fqSpDGkAayvqvt<-*
                      f+ pDG+Aa+++v+
  gi|1824401  4788    FRGPDGTAATAPVN    4801

YdjC: domain 1 of 1, from 4814 to 4866: score 1.0, E = 5.3
                   *->ega.alkalllvrslaaafrarfyraGistndgf.aGvygfaksmsg
                      + + +++a+++vr+ aa+ ++++++     +++f++Gv+g  ++  g
  gi|1824401  4814    LAQaLTEAARGVRP-AAGVTPDWAARRAGSDPRFtGGVVGAPTP--G 4857

                   amflallla<-*
                   + +  +l +
  gi|1824401  4858 EPYGRALSH    4866

DUF2322: domain 1 of 1, from 4888 to 4902: score 3.0, E = 2.7
                   *->LavieggeaLrvkvv<-*
                      +a++e ge++ ++ v
  gi|1824401  4888    FAWAEVGEGYLIQSV    4902

MSA_2: domain 1 of 1, from 4901 to 4911: score -0.3, E = 6.5
                   *->tatTtTTNdaEas<-*
                        + +TTNd+ a+
  gi|1824401  4901    --SVSTTNDGGAQ    4911

GvpL_GvpF: domain 1 of 1, from 4925 to 4937: score 2.5, E = 1.1
                   *->GPWPPYnFvdihi<-*
                      GP +PY F+++ +
  gi|1824401  4925    GPHAPYHFAQVVL    4937

Plug_translocon: domain 1 of 1, from 4929 to 4942: score 4.1, E = 5
                CS    --TTCHHHHT--TT
                   *->pfywlRailAsnrG<-*
                      p  + +++lAs+ G
  gi|1824401  4929    PYHFAQVVLASEDG    4942

RHS_repeat: domain 2 of 2, from 4971 to 4992: score 2.0, E = 11
                   *->q.tYrYDaagrltaltlttstdasGtt<-*
                      +++Y  D++grl +      td++ ++
  gi|1824401  4971    LdRYDADELGRLARE-----TDRRAEE    4992

Terminase_GpA: domain 1 of 1, from 5010 to 5027: score -1.2, E = 7.5
                   *->AlAaaillGlhRyeeirW<-*
                      A+Aa  l+G+h  e  rW
  gi|1824401  5010    AHAARALAGVHEAEQVRW    5027

Gp49: domain 1 of 1, from 5038 to 5053: score 4.8, E = 1.8
                   *->TpkkDIdtAkqrlkel<-*
                      T ++++d+A++r+++
  gi|1824401  5038    TAQREVDRARARARDA    5053

Pox_A_type_inc: domain 1 of 1, from 5041 to 5052: score 4.6, E = 4.8
                   *->rEldrlRrrIsd<-*
                      rE+dr+R r +d
  gi|1824401  5041    REVDRARARARD    5052

Fibritin_C: domain 1 of 1, from 5062 to 5085: score 0.5, E = 9.5
                   *->ddGVDSSFVrwYvRkdgaWvllsti<-*
                      dd+ D  F r+Y R+ g+ + ++++
  gi|1824401  5062    DDK-DLWFFRAYSRRPGESAHAVNA    5085

IlvB_leader: domain 2 of 2, from 5079 to 5109: score 2.6, E = 4.6
                   *->mttstlnakLLntAhvAAvvvvRvvvvvGsAP<-*
                           +na+LL   ++A       vv  G  P
  gi|1824401  5079    -SAHAVNAALLSEGPSAVSNPLTTVVLHGHTP    5109

Rubella_E1: domain 1 of 1, from 5099 to 5109: score -1.6, E = 6.2
                   *->LtAvvLqGYnP<-*
                      Lt vvL G  P
  gi|1824401  5099    LTTVVLHGHTP    5109

Metallophos: domain 1 of 1, from 5102 to 5111: score 1.4, E = 9.6
                CS    EEEEESSSSE
                   *->lvirGHtHvp<-*
                      +v++GHt +p
  gi|1824401  5102    VVLHGHTPRP    5111

Herpes_ori_bp: domain 1 of 1, from 5114 to 5151: score 1.9, E = 1.4
                   *->rllsflakglepgpDapdsLEa.ALaelpaeaWPrvsG<-*
                      r l+f+++  +p+ D    L+a AL+   a++W r++G
  gi|1824401  5114    RTLRFAEQRHNPASDQDENLDAlALSLARAGLWNRANG    5151

adh_short: domain 1 of 1, from 5133 to 5145: score 1.9, E = 4.8
                CS    HHHHHHHHHHHHG
                   *->LDaLAehRraeGL<-*
                      LDaLA +++++GL
  gi|1824401  5133    LDALALSLARAGL    5145

DUF2231: domain 1 of 1, from 5140 to 5147: score 1.2, E = 8.4
                   *->ffdVGwWN<-*
                      ++++G+WN
  gi|1824401  5140    LARAGLWN    5147

APH: domain 1 of 1, from 5202 to 5334: score 2.9, E = 1.5
                CS    EEEE-----SSSEEEEEE-S -...EEEEEE
                   *->tlrplsgGasnrtylvttgd.gdapryvlrr................
                      tl+ ++  ++  +++  t+ ++     v++++ +++++++ ++++++
  gi|1824401  5202    TLSDFRLTQDAKRVRGATDPdR---GRVVTVdiddrrrtpaprphrp 5245

                CS
                   ..................................................
                   ++ +++++++++ ++++ +++ + ++++++++++ ++ +++ ++++++++
  gi|1824401  5246 eplgeptepgtpapprpasgpapatgspteppgsagsapgragsrtsrrs 5295

                CS                 E-GGTSTT-HHHHHHHHHHHTTT
                   ................appgeaaeelrrEaavlrhLaal<-*
                    +++++++ + +   +a+ ++a e+l++E+++++hLa++
  gi|1824401  5296 vgtspdrgvevpawvrARIRYAEESLAFERRLADHLAEN    5334

Hp0062: domain 1 of 1, from 5308 to 5321: score 1.0, E = 5.5
                   *->AWLKERiRvLEEDY<-*
                      AW++ RiR  EE
  gi|1824401  5308    AWVRARIRYAEESL    5321

NIF3: domain 1 of 1, from 5325 to 5344: score 1.4, E = 5
                   *->kaLaekLkekfgvevefidi<-*
                      ++La++L+e++ v++ef +
  gi|1824401  5325    RRLADHLAENEAVTEEFRKM    5344

BHD_3: domain 1 of 1, from 5337 to 5349: score 2.0, E = 6.4
                   *->Vaeefeeallaaw<-*
                      V eef+++  aaw
  gi|1824401  5337    VTEEFRKMARAAW    5349

JTB: domain 1 of 1, from 5342 to 5356: score 3.2, E = 1.8
                   *->rqLdRkaymrvrkql<-*
                      r   R+a +r r+q+
  gi|1824401  5342    RKMARAAWERARQQF    5356

TPR_2: domain 1 of 1, from 5345 to 5359: score 3.9, E = 5.6
                CS    HHHHHHHHHHH-TT-
                   *->AleayekAleldPnn<-*
                      A++a+e+A + +P++
  gi|1824401  5345    ARAAWERARQQFPRH    5359

Mob1_phocein: domain 1 of 1, from 5378 to 5395: score 1.9, E = 3.7
                CS    XXX---TT---..HHHHTS-
                   *->qqyveatLgsgvadLktiVk<-*
                      ++ +++ L+sg  +L+++V+
  gi|1824401  5378    RPALQQVLRSG--NLRELVT    5395

DmpG_comm: domain 1 of 1, from 5531 to 5545: score 2.3, E = 5.9
                CS    HHHHHHHHHHHHT--
                   *->FLkHAeraaeryGvd<-*
                      FL HA r + r+G+d
  gi|1824401  5531    FLVHAARMRDRWGID    5545

DOPA_dioxygen: domain 1 of 1, from 5602 to 5611: score 0.9, E = 8.7
                   *->PnTEagdelrDH<-*
                      P+T  + elrDH
  gi|1824401  5602    PLT--ERELRDH    5611

//