hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 182440152.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|182440152|ref|YP_001827871.1|
Accession: [none]
Description: hypothetical protein SGR_6359 [Streptomyces griseus subsp. griseus NBRC 13350]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
Adeno_E3_CR1 Adenovirus E3 region protein CR1 7.1 0.094 1
OTU OTU-like cysteine protease 7.8 0.12 3
BCSC_C Cellulose synthase operon protein C C 6.2 0.13 1
FRG1 FRG1-like family 2.8 0.19 1
FCD FCD domain 5.8 0.23 1
Peptidase_U35 Caudovirus prohead protease 5.4 0.27 1
OHCU_decarbox OHCU decarboxylase 6.5 0.42 1
LRV_FeS LRV protein FeS4 cluster 5.6 0.42 2
Annexin Annexin 6.7 0.49 1
Rz1 Lipoprotein Rz1 precursor 6.1 0.57 1
HGTP_anticodon Anticodon binding domain 5.5 0.61 1
He_PIG Putative Ig domain 6.0 0.64 1
DUF1896 Domain of unknown function (DUF1896) 4.4 0.67 1
DUF824 Salmonella repeat of unknown function 7.0 0.67 1
TrkA_N TrkA-N domain 6.0 0.68 1
SipA Salmonella invasion protein A 2.6 0.92 1
HATPase_c Histidine kinase-, DNA gyrase B-, and 4.6 0.99 1
Alpha_TIF Alpha trans-inducing protein (Alpha-T 2.7 0.99 1
SEP SEP domain 4.9 1 1
GvpL_GvpF Gas vesicle synthesis protein GvpL/Gv 2.5 1.1 1
Abhydrolase_3 alpha/beta hydrolase fold 3.7 1.2 1
DUF1845 Domain of unknown function (DUF1845) 3.3 1.2 1
PIN PIN domain 3.2 1.2 1
FLO_LFY Floricaula / Leafy protein 1.0 1.3 1
Herpes_ori_bp Origin of replication binding protein 1.9 1.4 1
APH Phosphotransferase enzyme family 2.9 1.5 1
Gp49 Phage derived protein Gp49-like (DUF8 4.8 1.8 1
JTB Jumping translocation breakpoint prot 3.2 1.8 1
DNA_pol_viral_C DNA polymerase (viral) C-terminal dom -0.2 1.9 1
Plug TonB-dependent Receptor Plug Domain 3.7 1.9 1
P-mevalo_kinase Phosphomevalonate kinase 2.0 2 1
IlvB_leader IlvB leader peptide 3.8 2 2
DUF179 Uncharacterized ACR, COG1678 2.5 2 1
Pyocin_S S-type Pyocin 2.7 2.1 1
PCP_red Proto-chlorophyllide reductase 57 kD 3.9 2.2 1
DUF1550 Protein of unknown function (DUF1550) 3.0 2.2 1
Gp23 Major capsid protein Gp23 1.6 2.4 1
Glyco_transf_22 Alg9-like mannosyltransferase family 0.1 2.4 1
Neugrin Neugrin 1.3 2.4 1
DUF1780 Protein of unknown function (DUF1780) 2.0 2.4 1
DUF399 Protein of unknown function, DUF399 2.6 2.5 2
RinB Transcriptional activator RinB 3.3 2.6 1
DUF1134 Protein of unknown function (DUF1134) 1.3 2.6 1
DUF1485 Protein of unknown function (DUF1485) 2.6 2.7 1
DUF2322 Uncharacterized protein conserved in 3.0 2.7 1
Catalase-rel Catalase-related immune-responsive 3.2 2.7 1
Sigma70_r3 Sigma-70 region 3 4.1 2.8 1
SWIRM SWIRM domain 3.4 3 1
DUF1740 Protein of unknown function (DUF1740) 2.4 3 1
Senescence Senescence-associated protein 0.6 3.1 1
DUF586 Protein of unknown function, DUF586 2.7 3.3 1
Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 famil 0.4 3.4 1
CcdA Post-segregation antitoxin CcdA 3.1 3.6 1
Mob1_phocein Mob1/phocein family 1.9 3.7 1
DUF1865 Domain of unknown function (DUF1865) 1.8 3.8 1
MMPL MMPL family 3.4 3.8 1
CNP1 CNP1-like family 2.1 3.9 1
Tellurium_res Tellurium resistance protein 1.6 3.9 1
DUF2044 Conserved membrane protein (DUF2044) -1.0 4 1
FrhB_FdhB_C Coenzyme F420 hydrogenase/dehydrogena 1.8 4 1
RVP Retroviral aspartyl protease 2.7 4 1
MucBP MucBP domain 3.2 4.1 1
Fic Fic/DOC family 3.7 4.2 1
DUF413 Protein of unknown function, DUF 2.6 4.2 1
DUF2239 Uncharacterized protein conserved in 0.8 4.4 1
Maf_N Maf N-terminal region 3.0 4.6 1
DUF606 Protein of unknown function, DUF606 3.1 4.8 1
DUF1424 Putative rep protein (DUF1424) -0.2 4.8 1
Pox_A_type_inc Viral A-type inclusion protein repeat 4.6 4.8 1
ORF6N ORF6N domain 1.5 4.8 1
adh_short short chain dehydrogenase 1.9 4.8 1
DUF2131 Uncharacterized protein conserved in 2.3 5 1
NIF3 NIF3 (NGG1p interacting factor 3) 1.4 5 1
Plug_translocon Plug domain of Sec61p 4.1 5 1
Adeno_VII Adenoviral core protein VII 2.3 5.2 1
Peptidase_S68 Peptidase S68 3.2 5.3 1
PI3K_1B_p101 Phosphoinositide 3-kinase gamma adapt -1.1 5.3 1
YdjC YdjC-like protein 1.0 5.3 1
GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc -0.2 5.3 1
RecO Recombination protein O 0.7 5.4 1
Hp0062 Bacterial protein of unknown function 1.0 5.5 1
SLBB SLBB domain 3.5 5.5 1
DUF2168 Uncharacterized protein conserved in 0.1 5.5 1
Pyridox_oxidase Pyridoxamine 5'-phosphate oxidase 2.0 5.6 1
TPR_2 Tetratricopeptide repeat 3.9 5.6 1
Phage_portal_2 Phage portal protein, lambda family 0.5 5.7 1
Corona_nucleoca Coronavirus nucleocapsid protein 0.4 5.7 1
DmpG_comm DmpG-like communication domain 2.3 5.9 1
AmoA Putative ammonia monooxygenase 0.4 5.9 1
DUF834 Domain of unknown function (DUF834) 2.7 6.1 1
DUF2249 Uncharacterized conserved protein (DU 1.7 6.1 1
DUF1853 Domain of unknown function (DUF1853) 2.1 6.2 1
Rubella_E1 Rubella membrane glycoprotein E1 -1.6 6.2 1
CLP_protease Clp protease 1.1 6.3 1
FecR FecR protein 2.2 6.3 1
Mt_ATP-synt_D ATP synthase D chain, mitochondrial ( 1.0 6.3 1
Cas_Csy4 CRISPR-associated protein (Cas_Csy4) 0.5 6.4 1
BHD_3 Rad4 beta-hairpin domain 3 2.0 6.4 1
MSA_2 Merozoite Surface Antigen 2 (MSA-2) f -0.3 6.5 1
DUF1624 Protein of unknown function (DUF1624) -0.3 6.6 1
Albicidin_res Albicidin resistance domain 1.4 6.7 1
Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-t 0.5 6.9 1
ClpS ATP-dependent Clp protease adaptor pr 3.1 6.9 1
SPOR Sporulation related domain 1.8 7.1 1
Peptidase_M16 Insulinase (Peptidase family M16) 1.6 7.3 1
PhnH Bacterial phosphonate metabolism prot 0.9 7.4 1
Terminase_GpA Phage terminase large subunit (GpA) -1.2 7.5 1
Trans_reg_C Transcriptional regulatory protein, C 2.3 7.5 1
LTXXQ LTXXQ motif 3.0 7.6 1
DUF2309 Uncharacterized protein conserved in -1.0 7.7 1
SoxG Sarcosine oxidase, gamma subunit fami 1.0 7.7 1
HEAT_PBS PBS lyase HEAT-like repeat 3.9 7.8 2
peroxidase Peroxidase 0.9 7.9 1
7TMR-DISMED2 7TMR-DISM extracellular 2 1.7 7.9 1
Nodulin Nodulin -1.1 7.9 1
Anthrax_toxA Anthrax toxin LF subunit 0.3 8.1 1
MCE mce related protein 1.8 8.1 1
DUF348 Domain of unknown function (DUF348) 2.8 8.2 1
DUF1254 Protein of unknown function (DUF1254) 1.1 8.2 1
Peptidase_C41 Hepatitis E cysteine protease 0.7 8.3 1
DUF2231 Predicted membrane protein (DUF2231) 1.2 8.4 1
Thia_YuaJ Thiamine transporter protein (Thia_Yu 1.1 8.4 1
DUF211 Uncharacterized ArCR, COG1888 -0.1 8.6 1
Neurokinin_B Neurokinin B 1.5 8.6 1
RHS_repeat RHS Repeat 2.3 8.6 2
TIR TIR domain 0.3 8.7 1
DOPA_dioxygen Dopa 4,5-dioxygenase family 0.9 8.7 1
MxiH Type III secretion needle MxiH like 2.0 8.7 1
PAS_5 PAS domain 1.3 8.9 1
AroM AroM protein 0.1 9 1
Glyco_hydro_56 Hyaluronidase -0.3 9.1 1
Rop Rop protein 0.9 9.2 1
Fibritin_C Fibritin C-terminal region 0.5 9.5 1
Nitroreductase Nitroreductase family 1.7 9.5 1
DUF2534 Protein of unknown function (DUF2534) 1.4 9.5 1
Cir_N N-terminal domain of CBF1 interacting 2.6 9.6 1
Metallophos Calcineurin-like phosphoesterase 1.4 9.6 1
Omt_N O-methyltransferase N-terminus 0.7 9.6 1
Kin17_mid Domain of Kin17 curved DNA-binding pr 1.2 9.8 1
SgaT_UlaA Putative sugar-specific permease, Sga -1.1 9.9 1
GFA Glutathione-dependent formaldehyde-ac 1.5 10 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
MxiH 1/1 64 86 .. 1 25 [. 2.0 8.7
RinB 1/1 102 116 .. 1 15 [. 3.3 2.6
Thia_YuaJ 1/1 110 121 .. 1 12 [. 1.1 8.4
DUF2534 1/1 130 139 .. 1 10 [. 1.4 9.5
RecO 1/1 141 177 .. 223 259 .] 0.7 5.4
peroxidase 1/1 212 225 .. 345 364 .] 0.9 7.9
LRV_FeS 1/2 295 305 .. 48 58 .] 1.1 9.3
SPOR 1/1 499 524 .. 48 77 .] 1.8 7.1
DUF1853 1/1 503 514 .. 1 12 [. 2.1 6.2
HEAT_PBS 1/2 503 537 .. 1 27 [] 1.4 39
Anthrax_toxA 1/1 505 520 .. 1 17 [. 0.3 8.1
HGTP_anticodon 1/1 540 567 .. 1 34 [. 5.5 0.61
IlvB_leader 1/2 541 550 .. 22 32 .] 1.2 13
Annexin 1/1 554 568 .. 1 15 [. 6.7 0.49
CNP1 1/1 555 565 .. 153 165 .] 2.1 3.9
DUF399 1/2 562 574 .. 215 228 .] 0.5 9.7
TrkA_N 1/1 611 631 .. 100 121 .] 6.0 0.68
SLBB 1/1 644 669 .. 32 62 .] 3.5 5.5
Peptidase_S15 1/1 825 873 .. 57 93 .. 0.4 3.4
Gp23 1/1 840 856 .. 486 502 .] 1.6 2.4
Pyocin_S 1/1 847 854 .. 175 182 .] 2.7 2.1
CcdA 1/1 890 909 .. 53 72 .] 3.1 3.6
Omt_N 1/1 933 939 .. 115 121 .] 0.7 9.6
LRV_FeS 2/2 1008 1020 .. 46 58 .] 4.4 0.93
Rop 1/1 1030 1045 .. 50 65 .] 0.9 9.2
Fic 1/1 1065 1071 .. 16 22 .. 3.7 4.2
DUF1624 1/1 1116 1124 .. 1 9 [. -0.3 6.6
GFA 1/1 1118 1143 .. 74 99 .] 1.5 10
7TMR-DISMED2 1/1 1155 1178 .. 82 104 .. 1.7 7.9
Peptidase_C41 1/1 1174 1185 .. 1 12 [. 0.7 8.3
Plug 1/1 1246 1264 .. 85 104 .] 3.7 1.9
FecR 1/1 1264 1278 .. 1 15 [. 2.2 6.3
DUF586 1/1 1305 1313 .. 71 79 .] 2.7 3.3
DUF1424 1/1 1374 1382 .. 321 329 .] -0.2 4.8
DUF2309 1/1 1435 1445 .. 871 881 .] -1.0 7.7
DUF2168 1/1 1449 1471 .. 109 131 .. 0.1 5.5
DUF211 1/1 1459 1470 .. 1 11 [. -0.1 8.6
Alpha_TIF 1/1 1522 1534 .. 360 373 .] 2.7 0.99
Nodulin 1/1 1526 1539 .. 354 367 .] -1.1 7.9
Maf_N 1/1 1572 1586 .. 23 37 .] 3.0 4.6
OTU 1/3 1632 1644 .. 1 13 [. 5.2 0.73
Rz1 1/1 1649 1677 .. 34 62 .] 6.1 0.57
DUF2131 1/1 1650 1667 .. 50 67 .] 2.3 5
PIN 1/1 1661 1706 .. 100 151 .] 3.2 1.2
AmoA 1/1 1705 1724 .. 23 41 .. 0.4 5.9
TIR 1/1 1729 1738 .. 141 150 .] 0.3 8.7
Cas_Csy4 1/1 1730 1755 .. 77 102 .. 0.5 6.4
Corona_nucleoca 1/1 1738 1752 .. 345 359 .. 0.4 5.7
OTU 2/3 1783 1830 .. 100 157 .] 1.7 7.7
Tellurium_res 1/1 1839 1866 .. 1 25 [. 1.6 3.9
DUF2249 1/1 1892 1907 .. 35 51 .. 1.7 6.1
Peptidase_S68 1/1 1895 1907 .. 1 15 [. 3.2 5.3
DUF2044 1/1 1898 1908 .. 609 619 .] -1.0 4
FrhB_FdhB_C 1/1 1959 1983 .. 155 186 .] 1.8 4
DUF1780 1/1 1992 2003 .. 1 12 [. 2.0 2.4
Catalase-rel 1/1 2069 2077 .. 77 85 .] 3.2 2.7
Nitroreductase 1/1 2071 2094 .. 79 104 .] 1.7 9.5
SEP 1/1 2171 2187 .. 59 75 .] 4.9 1
Senescence 1/1 2215 2225 .. 1 11 [. 0.6 3.1
DUF413 1/1 2239 2255 .. 78 94 .] 2.6 4.2
ORF6N 1/1 2292 2304 .. 1 13 [. 1.5 4.8
Adeno_E3_CR1 1/1 2315 2327 .. 1 13 [. 7.1 0.094
DUF1845 1/1 2332 2351 .. 1 23 [. 3.3 1.2
FLO_LFY 1/1 2502 2529 .. 334 360 .] 1.0 1.3
DUF348 1/1 2548 2559 .. 1 12 [. 2.8 8.2
Peptidase_M16 1/1 2567 2592 .. 135 160 .] 1.6 7.3
DUF606 1/1 2680 2700 .. 116 136 .] 3.1 4.8
Trans_reg_C 1/1 2774 2803 .. 1 28 [. 2.3 7.5
DUF399 2/2 2782 2800 .. 1 19 [. 2.1 3.5
DUF2239 1/1 2802 2818 .. 131 147 .. 0.8 4.4
DUF1485 1/1 2824 2842 .. 282 300 .] 2.6 2.7
Neugrin 1/1 2826 2841 .. 1 16 [. 1.3 2.4
SgaT_UlaA 1/1 2835 2847 .. 458 470 .] -1.1 9.9
PAS_5 1/1 2927 2942 .. 126 142 .] 1.3 8.9
DUF179 1/1 2984 2998 .. 149 163 .] 2.5 2
Glyco_hydro_56 1/1 3067 3078 .. 1 12 [. -0.3 9.1
Neurokinin_B 1/1 3067 3082 .. 44 59 .] 1.5 8.6
BCSC_C 1/1 3138 3212 .. 1 76 [. 6.2 0.13
RHS_repeat 1/2 3181 3192 .. 28 44 .] 0.3 31
AroM 1/1 3183 3199 .. 168 184 .. 0.1 9
Peptidase_U35 1/1 3213 3235 .. 159 183 .] 5.4 0.27
ClpS 1/1 3247 3262 .. 62 83 .] 3.1 6.9
MucBP 1/1 3252 3278 .. 1 27 [. 3.2 4.1
MCE 1/1 3254 3267 .. 1 15 [. 1.8 8.1
He_PIG 1/1 3255 3267 .. 49 61 .] 6.0 0.64
DUF824 1/1 3257 3271 .. 16 30 .. 7.0 0.67
Sigma70_r3 1/1 3292 3313 .. 61 83 .] 4.1 2.8
P-mevalo_kinase 1/1 3309 3315 .. 115 121 .] 2.0 2
FRG1 1/1 3363 3380 .. 164 181 .. 2.8 0.19
Pyridox_oxidase 1/1 3367 3381 .. 12 26 .. 2.0 5.6
GlcNAc_2-epim 1/1 3430 3445 .. 1 16 [. -0.2 5.3
Adeno_VII 1/1 3457 3489 .. 93 132 .] 2.3 5.2
Glyco_transf_22 1/1 3459 3485 .. 446 472 .. 0.1 2.4
CLP_protease 1/1 3489 3505 .. 168 184 .] 1.1 6.3
DUF1865 1/1 3503 3515 .. 1 13 [. 1.8 3.8
SWIRM 1/1 3647 3666 .. 1 20 [. 3.4 3
OHCU_decarbox 1/1 3648 3680 .. 44 80 .. 6.5 0.42
Albicidin_res 1/1 3654 3671 .. 1 18 [. 1.4 6.7
Pertussis_S2S3 1/1 3701 3723 .. 1 24 [. 0.5 6.9
DUF1254 1/1 3740 3751 .. 113 126 .] 1.1 8.2
OTU 3/3 3781 3791 .. 1 11 [. 1.0 12
SoxG 1/1 3786 3797 .. 149 160 .] 1.0 7.7
PCP_red 1/1 3811 3831 .. 25 45 .] 3.9 2.2
HEAT_PBS 2/2 3830 3850 .. 1 21 [. 2.5 19
LTXXQ 1/1 3870 3882 .. 11 23 .] 3.0 7.6
Mt_ATP-synt_D 1/1 3886 3896 .. 161 180 .] 1.0 6.3
DUF1550 1/1 3896 3908 .. 50 62 .] 3.0 2.2
DNA_pol_viral_C 1/1 4039 4047 .. 237 245 .] -0.2 1.9
DUF1134 1/1 4068 4091 .. 1 24 [. 1.3 2.6
SipA 1/1 4081 4111 .. 568 598 .. 2.6 0.92
Abhydrolase_3 1/1 4171 4202 .. 216 247 .] 3.7 1.2
DUF1896 1/1 4184 4196 .. 135 147 .] 4.4 0.67
PI3K_1B_p101 1/1 4268 4275 .. 940 947 .] -1.1 5.3
Phage_portal_2 1/1 4353 4400 .. 1 48 [. 0.5 5.7
DUF1740 1/1 4355 4373 .. 1 19 [. 2.4 3
PhnH 1/1 4357 4370 .. 190 203 .] 0.9 7.4
Kin17_mid 1/1 4389 4404 .. 120 135 .] 1.2 9.8
Cir_N 1/1 4400 4413 .. 24 37 .] 2.6 9.6
HATPase_c 1/1 4493 4512 .. 107 126 .] 4.6 0.99
RVP 1/1 4521 4563 .. 55 97 .. 2.7 4
FCD 1/1 4704 4721 .. 1 18 [. 5.8 0.23
DUF834 1/1 4720 4743 .. 1 25 [. 2.7 6.1
MMPL 1/1 4788 4801 .. 1 14 [. 3.4 3.8
YdjC 1/1 4814 4866 .. 175 228 .. 1.0 5.3
DUF2322 1/1 4888 4902 .. 87 101 .] 3.0 2.7
MSA_2 1/1 4901 4911 .. 1 13 [. -0.3 6.5
GvpL_GvpF 1/1 4925 4937 .. 263 275 .] 2.5 1.1
Plug_translocon 1/1 4929 4942 .. 22 35 .] 4.1 5
RHS_repeat 2/2 4971 4992 .. 19 44 .] 2.0 11
Terminase_GpA 1/1 5010 5027 .. 650 667 .] -1.2 7.5
Gp49 1/1 5038 5053 .. 42 57 .] 4.8 1.8
Pox_A_type_inc 1/1 5041 5052 .. 1 12 [. 4.6 4.8
Fibritin_C 1/1 5062 5085 .. 103 127 .] 0.5 9.5
IlvB_leader 2/2 5079 5109 .. 1 32 [] 2.6 4.6
Rubella_E1 1/1 5099 5109 .. 1 11 [. -1.6 6.2
Metallophos 1/1 5102 5111 .. 115 124 .] 1.4 9.6
Herpes_ori_bp 1/1 5114 5151 .. 834 870 .] 1.9 1.4
adh_short 1/1 5133 5145 .. 169 181 .] 1.9 4.8
DUF2231 1/1 5140 5147 .. 1 8 [. 1.2 8.4
APH 1/1 5202 5334 .. 1 53 [. 2.9 1.5
Hp0062 1/1 5308 5321 .. 73 86 .] 1.0 5.5
NIF3 1/1 5325 5344 .. 231 250 .] 1.4 5
BHD_3 1/1 5337 5349 .. 67 79 .] 2.0 6.4
JTB 1/1 5342 5356 .. 106 120 .] 3.2 1.8
TPR_2 1/1 5345 5359 .. 20 34 .] 3.9 5.6
Mob1_phocein 1/1 5378 5395 .. 1 20 [. 1.9 3.7
DmpG_comm 1/1 5531 5545 .. 24 38 .. 2.3 5.9
DOPA_dioxygen 1/1 5602 5611 .. 87 98 .. 0.9 8.7
Alignments of top-scoring domains:
MxiH: domain 1 of 1, from 64 to 86: score 2.0, E = 8.7
*->MAdifgwngd.vnLddIaqqldqgan<-*
M + ++g++++L d a+qld++a+
gi|1824401 64 M---LVDDGGkNYLRDFAEQLDRIAE 86
RinB: domain 1 of 1, from 102 to 116: score 3.3, E = 2.6
*->viKqiLRLLFLLAmY<-*
vi +i+RLL +A+Y
gi|1824401 102 VIAEIIRLLIEIAIY 116
Thia_YuaJ: domain 1 of 1, from 110 to 121: score 1.1, E = 8.4
*->lvEiAifaALAm<-*
l+EiAi +A+++
gi|1824401 110 LIEIAIYLAMSF 121
DUF2534: domain 1 of 1, from 130 to 139: score 1.4, E = 9.5
*->mImlekLrtk<-*
Im++kLr++
gi|1824401 130 QIMMAKLRSR 139
RecO: domain 1 of 1, from 141 to 177: score 0.7, E = 5.4
*->ftaakLkplldskleesslvERlyelsrsflprrelL<-*
f+ + L ll ++ ++ sl E + e+++ f+ r +++
gi|1824401 141 FILTTLSHLLQRLHLTPSLTEAFAEAFTTFAVRLAMM 177
peroxidase: domain 1 of 1, from 212 to 225: score 0.9, E = 7.9
CS HHHHHHHHHHHHHTHHHHHH
*->dprTraiVAWKVMLdrfann<-*
d + ++iV ++f+ n
gi|1824401 212 DKFAKDIV------RSFDGN 225
LRV_FeS: domain 1 of 2, from 295 to 305: score 1.1, E = 9.3
CS HHH-GGGGGGG
*->FrlNPeLAdeY<-*
Fr+NPeL +
gi|1824401 295 FRNNPELWRNN 305
SPOR: domain 1 of 1, from 499 to 524: score 1.8, E = 7.1
CS SS--TTTHHHHHHHHHH...HH--S-----
*->GpfasreeAraalkkLkaasaagisafvvk<-*
Gp + re+A + l+ L+ +g+ + +
gi|1824401 499 GPGEAREQALRDLAALR----GGLPPSSTE 524
DUF1853: domain 1 of 1, from 503 to 514: score 2.1, E = 6.2
*->lrdpavRDLaWl<-*
+r++a+RDLa+l
gi|1824401 503 AREQALRDLAAL 514
HEAT_PBS: domain 1 of 2, from 503 to 537: score 1.4, E = 39
CS HHHHHHHHHCCCSS HCCHHHHHHHHCT
*->vRraAaraLgalgd........peAipaLleaLed<-*
+R+ A+r L+al+ + +++++++ + + L + L++
gi|1824401 503 AREQALRDLAALRGglppssteTGVRDSLNAHLAH 537
Anthrax_toxA: domain 1 of 1, from 505 to 520: score 0.3, E = 8.1
*->adaLkdeaaakesGvpa<-*
+aL+d+aa+++ G+p+
gi|1824401 505 EQALRDLAALRG-GLPP 520
HGTP_anticodon: domain 1 of 1, from 540 to 567: score 5.5, E = 0.61
CS SEEEEESSS.HH-SSHHHHHHHHHHHHHHHHTTT
*->qVvviPlgekdeqkeaeeledyAkklaeeLraaG<-*
+V+v+P+g + + ++ A++++++L+ G
gi|1824401 540 EVRVVPVG-NSP-----SAQLDAEEVRRALKGFG 567
IlvB_leader: domain 1 of 2, from 541 to 550: score 1.2, E = 13
*->vRvvvvvGsAP<-*
vR vv vG+ P
gi|1824401 541 VR-VVPVGNSP 550
Annexin: domain 1 of 1, from 554 to 568: score 6.7, E = 0.49
CS HHHHHHHHHHSSSSH
*->yDAelLrkAmkglGT<-*
DAe+ r+A kg+GT
gi|1824401 554 LDAEEVRRALKGFGT 568
CNP1: domain 1 of 1, from 555 to 565: score 2.1, E = 3.9
*->DGRaaeaVrrLka<-*
D a+e++r+Lk+
gi|1824401 555 D--AEEVRRALKG 565
DUF399: domain 1 of 2, from 562 to 574: score 0.5, E = 9.7
*->aYrkglGVPlhlad<-*
a kg+G+P+ +++
gi|1824401 562 A-LKGFGTPATVDR 574
TrkA_N: domain 1 of 1, from 611 to 631: score 6.0, E = 0.68
CS -SSGGGHHHHHH.TTTSEEE-H
*->andpehaekLrrnlGADeVisP<-*
a +pe ae+L +GAD+++
gi|1824401 611 AGSPEAAELLDG-AGADRAVVL 631
SLBB: domain 1 of 1, from 644 to 669: score 3.5, E = 5.5
*->GltedadlsrinlarlkavyvimgGpmmgil<-*
G t + +s+++l+r+++ g p+ +
gi|1824401 644 GETGEPVRSAVELTRQGP-----GDPVQVRP 669
Peptidase_S15: domain 1 of 1, from 825 to 873: score 0.4, E = 3.4
CS SEE.......... ... ... B.S S.S. . .. ..HHHH
*->pwtisvtdrefqa.eap.vka.pvd......kAee.f.hi.sYtLND
pwt ++td + ++++a+++ a p+++++++++A+++++ +++tL D
gi|1824401 825 PWTGTATDLHLESgRADgTHAaPGTstgnggPATDqApPGrPGTLRD 871
CS HH
Yf<-*
++
gi|1824401 872 FL 873
Gp23: domain 1 of 1, from 840 to 856: score 1.6, E = 2.4
*->AestkqAPgeriqsGmP<-*
A+ t APg ++G P
gi|1824401 840 ADGTHAAPGTSTGNGGP 856
Pyocin_S: domain 1 of 1, from 847 to 854: score 2.7, E = 2.1
*->PGvvTGkG<-*
PG++TG+G
gi|1824401 847 PGTSTGNG 854
CcdA: domain 1 of 1, from 890 to 909: score 3.1, E = 3.6
*->AelarlidetGsFaDEyRdf<-*
A+la + d GsF D R+
gi|1824401 890 AALAAFPDDPGSFYDHDRSP 909
Omt_N: domain 1 of 1, from 933 to 939: score 0.7, E = 9.6
*->LDtRAYR<-*
+D+ AYR
gi|1824401 933 MDASAYR 939
LRV_FeS: domain 2 of 2, from 1008 to 1020: score 4.4, E = 0.93
CS HHHHH-GGGGGGG
*->RFFrlNPeLAdeY<-*
RF NP LA Y
gi|1824401 1008 RFLHSNPALATNY 1020
Rop: domain 1 of 1, from 1030 to 1045: score 0.9, E = 9.2
CS HHHHHHHHHHHCHSSS
*->eeLYrsLsAkvGdela<-*
++L+++ A+vG a
gi|1824401 1030 DALFQQHYARVGRPDA 1045
Fic: domain 1 of 1, from 1065 to 1071: score 3.7, E = 4.2
*->HPFvDGN<-*
HPF DGN
gi|1824401 1065 HPFQDGN 1071
DUF1624: domain 1 of 1, from 1116 to 1124: score -0.3, E = 6.6
*->RfgeIDilR<-*
R+g++D++R
gi|1824401 1116 RDGALDTVR 1124
GFA: domain 1 of 1, from 1118 to 1143: score 1.5, E = 10
CS ......TSTTTTEEEE-GGGBSS--S
*->galddpapfppvlhvfvdsklpwlsl<-*
gald ++p p++ +++vd++l+ +
gi|1824401 1118 GALDTVRPRPAPAQDAVDPHLESGRG 1143
7TMR-DISMED2: domain 1 of 1, from 1155 to 1178: score 1.7, E = 7.9
*->lldgsgsiraqrtGdalpfae.Rq<-*
+++g++++ ++ +G a+pfa+ R+
gi|1824401 1155 PPEGRQPVVTTLSGHAVPFAQlRR 1178
Peptidase_C41: domain 1 of 1, from 1174 to 1185: score 0.7, E = 8.3
*->AqCRRWLsAGFH<-*
Aq RRW+ G H
gi|1824401 1174 AQLRRWVPEGPH 1185
Plug: domain 1 of 1, from 1246 to 1264: score 3.7, E = 1.9
CS EEEE.SCHTTTTSSTGSSEE
*->evlkDGpssalyGagalgGv<-*
+v + Gp++al G+g+ G+
gi|1824401 1246 TVFT-GPPTALPGSGTKRGA 1264
FecR: domain 1 of 1, from 1264 to 1278: score 2.2, E = 6.3
*->adyrTavGerrsvtL<-*
ady+++ G r+vtL
gi|1824401 1264 ADYFAGHGTSRTVTL 1278
DUF586: domain 1 of 1, from 1305 to 1313: score 2.7, E = 3.3
*->eGDpDqPiv<-*
+GD D+P+v
gi|1824401 1305 DGDQDRPLV 1313
DUF1424: domain 1 of 1, from 1374 to 1382: score -0.2, E = 4.8
*->RLRtPPPGG<-*
RL tP PGG
gi|1824401 1374 RLFTPEPGG 1382
DUF2309: domain 1 of 1, from 1435 to 1445: score -1.0, E = 7.7
*->aalryvgggtW<-*
aal yv+g++W
gi|1824401 1435 AALAYVDGLRW 1445
DUF2168: domain 1 of 1, from 1449 to 1471: score 0.1, E = 5.5
*->aTsArlypntisyeelRkmleer<-*
+T Ar ++++++++ lR+m +r
gi|1824401 1449 GTAARYGDGRMTPDLLRRMVIDR 1471
DUF211: domain 1 of 1, from 1459 to 1470: score -0.1, E = 8.6
*->Makg.lRRlVLD<-*
M + lRR+V+D
gi|1824401 1459 MTPDlLRRMVID 1470
Alpha_TIF: domain 1 of 1, from 1522 to 1534: score 2.7, E = 0.99
*->GstvEALLddPsdp<-*
G+t ALL++P+ p
gi|1824401 1522 GTTLDALLPPPP-P 1534
Nodulin: domain 1 of 1, from 1526 to 1539: score -1.1, E = 7.9
*->dillaepppgsPPi<-*
d+ll++ppp++PP
gi|1824401 1526 DALLPPPPPELPPT 1539
Maf_N: domain 1 of 1, from 1572 to 1586: score 3.0, E = 4.6
*->LnLtpEDAvEaLign<-*
L L+pED E+L
gi|1824401 1572 LALSPEDTAELLRRR 1586
OTU: domain 1 of 3, from 1632 to 1644: score 5.2, E = 0.73
*->pgDGnCLfravsd<-*
pg G+CLfra+ d
gi|1824401 1632 PGGGDCLFRALLD 1644
Rz1: domain 1 of 1, from 1649 to 1677: score 6.1, E = 0.57
*->PPaPPAWamqpppDwqklLneiisvSeee<-*
+P PPAWa + ++ lL e ++ Se
gi|1824401 1649 RPVPPAWAARNVTRLRELLRERLTGSELL 1677
DUF2131: domain 1 of 1, from 1650 to 1667: score 2.3, E = 5
*->PidkaWvaenleqIkaaL<-*
P+ +aW a+n++++++ L
gi|1824401 1650 PVPPAWAARNVTRLRELL 1667
PIN: domain 1 of 1, from 1661 to 1706: score 3.2, E = 1.2
CS ...HCCCCT..T.T.SHHHHHHHHHHHHHT-EEEES.HHHHCCHHHH
*->TekhrlrrkghkyglspnDaliaAtAkehgiklittnDedfkrvagl
T rlr++ + ++++ l+a+ A+++ ++++ d++++a +
gi|1824401 1661 T---RLREL--LRERLTGSELLASAAEANPDPVLAV-VDDLRMTAIA 1701
CS TT-EE
evvpi<-*
+v+++
gi|1824401 1702 GVRDP 1706
AmoA: domain 1 of 1, from 1705 to 1724: score 0.4, E = 5.9
*->prllkG.iNRRWLllgQaIl<-*
+++++G+iNRRW l +Qa++
gi|1824401 1705 DPDALGrINRRWDLIAQAVV 1724
TIR: domain 1 of 1, from 1729 to 1738: score 0.3, E = 8.7
CS CHHHHHHHHH
*->ikfWkkalya<-*
+++W+++l +
gi|1824401 1729 GRRWRRLLRD 1738
Cas_Csy4: domain 1 of 1, from 1730 to 1755: score 0.5, E = 6.4
*->qsWLkgLrneDYchisevkpVPddvk<-*
++W++ Lr +Y h ev+p+P+d++
gi|1824401 1730 RRWRRLLRDGGYPHLAEVAPTPADAR 1755
Corona_nucleoca: domain 1 of 1, from 1738 to 1752: score 0.4, E = 5.7
*->akrypqlAeLVPsva<-*
+++yp lAe +P++a
gi|1824401 1738 DGGYPHLAEVAPTPA 1752
OTU: domain 2 of 3, from 1783 to 1830: score 1.7, E = 7.7
*->fAlahilrvpIivydlyklqsgritvfieiygkylplnkkppirlsy
+Alahil+ + + ++ ++r+ + +++ +p +++ ++lsy
gi|1824401 1783 QALAHILGLDLRL---VQP-DPRAPGS-TFVTPLNPGGPGGALHLSY 1824
lghLeglgeHY<-*
+g H+
gi|1824401 1825 NG-----TDHF 1830
Tellurium_res: domain 1 of 1, from 1839 to 1866: score 1.6, E = 3.9
*->paapaPaPtPappPappPp...paqppV<-*
+apa aP+P+ +Pap+P++++p+++ V
gi|1824401 1839 LPAPASAPAPTSAPAPAPAtedPVGSDV 1866
DUF2249: domain 1 of 1, from 1892 to 1907: score 1.7, E = 6.1
*->DPlPLlyQfeaerpFgq<-*
DP+PL Q+e +rp ++
gi|1824401 1892 DPVPLETQLERHRP-AR 1907
Peptidase_S68: domain 1 of 1, from 1895 to 1907: score 3.2, E = 5.3
*->WsdLeTaLrreakkR<-*
+LeT+L+r + R
gi|1824401 1895 --PLETQLERHRPAR 1907
DUF2044: domain 1 of 1, from 1898 to 1908: score -1.0, E = 4
*->keLEreRkeRl<-*
++LEr R +Rl
gi|1824401 1898 TQLERHRPARL 1908
FrhB_FdhB_C: domain 1 of 1, from 1959 to 1983: score 1.8, E = 4
*->ellelAveaGyiEtkpidekkplaglelveKl<-*
+ll+++ G+++++ +d + e+++Kl
gi|1824401 1959 GLLNGV---GVLTLRSPDQV----AREILGKL 1983
DUF1780: domain 1 of 1, from 1992 to 2003: score 2.0, E = 2.4
CS -HHHHHHHHHHH
*->deaDyLRLLtiq<-*
dea+ LRLLt q
gi|1824401 1992 DEAELLRLLTDQ 2003
Catalase-rel: domain 1 of 1, from 2069 to 2077: score 3.2, E = 2.7
CS HHHHHHHHH
*->GarVAkaLg<-*
G+rVA+aLg
gi|1824401 2069 GRRVAAALG 2077
Nitroreductase: domain 1 of 1, from 2071 to 2094: score 1.7, E = 9.5
CS ..HH.HHTT-. -T..TEEEEEEEEE-
*->eivrvelLgld.PekgyepvallalGy<-*
+ v+ ++Lg+++P ++ + +++lG+
gi|1824401 2071 R-VA-AALGMGpPL-NWMLKIGVSLGW 2094
SEP: domain 1 of 1, from 2171 to 2187: score 4.9, E = 1
CS XXS----------S---
*->dYvepkkkfkpFsGeGr<-*
+++ p +pFsG+Gr
gi|1824401 2171 SWRLPDDLTVPFSGPGR 2187
Senescence: domain 1 of 1, from 2215 to 2225: score 0.6, E = 3.1
*->EEVLLrIpGar<-*
EEV L I+Gar
gi|1824401 2215 EEVALAISGAR 2225
DUF413: domain 1 of 1, from 2239 to 2255: score 2.6, E = 4.2
*->rkkRfytLcgtkkaand<-*
r+ R + L+g+++ +++
gi|1824401 2239 RPGRLHGLFGRFSGPVS 2255
ORF6N: domain 1 of 1, from 2292 to 2304: score 1.5, E = 4.8
*->vneLqvIEyngqR<-*
v+ L +++y++qR
gi|1824401 2292 VRDLAQTTYQNQR 2304
Adeno_E3_CR1: domain 1 of 1, from 2315 to 2327: score 7.1, E = 0.094
*->tvyvGsNlTLvGP<-*
v+ G N+TL+GP
gi|1824401 2315 QVTAGPNHTLIGP 2327
DUF1845: domain 1 of 1, from 2332 to 2351: score 3.3, E = 1.2
*->qlklGsLLLRSsltKETGRKHHL<-*
+l+ G+L +R +l+ TGR H L
gi|1824401 2332 RLQGGPL-VRADLS--TGRGHYL 2351
FLO_LFY: domain 1 of 1, from 2502 to 2529: score 1.0, E = 1.3
*->ahprLs.IWYVPTKLRqLCHaeRskasa<-*
+hprL++ WY +LR H +R+ a
gi|1824401 2502 RHPRLAkLWYGDGRLRTALHNDRQVREA 2529
DUF348: domain 1 of 1, from 2548 to 2559: score 2.8, E = 8.2
*->pVtvvvDGkekt<-*
pVt++ DGk+++
gi|1824401 2548 PVTLTEDGKVRR 2559
Peptidase_M16: domain 1 of 1, from 2567 to 2592: score 1.6, E = 7.3
CS HHHHHHHHHHHHTTTSGGGSHSS-TH
*->qevlldnlhaaayrgtpLgrsllgPg<-*
+++l+d + ++++++ +L ++++g++
gi|1824401 2567 RARLTDRRFETTMSERSLRNAVIGTE 2592
DUF606: domain 1 of 1, from 2680 to 2700: score 3.1, E = 4.8
*->krplsltrllGlllllaGvvL<-*
+rp ++rl+ ++ll aG+++
gi|1824401 2680 RRPRGWARLASVGLLGAGLFV 2700
Trans_reg_C: domain 1 of 1, from 2774 to 2803: score 2.3, E = 7.5
CS TEE -E -SHHHHHHHHHHHHTTTSEEEHH
*->gep.vv.LspkereLLalLllnpGrvvsrd<-*
g++++ + p+er+L ++Ll +p+ v+s +
gi|1824401 2774 GTRpLPhGQPSERQLVRRLLSAPHVVLSAE 2803
DUF399: domain 2 of 2, from 2782 to 2800: score 2.1, E = 3.5
*->tiSpeqLlerLanarvVlv<-*
S qL++rL++a++V++
gi|1824401 2782 QPSERQLVRRLLSAPHVVL 2800
DUF2239: domain 1 of 1, from 2802 to 2818: score 0.8, E = 4.4
*->ahagkDRrRaAqeAAYR<-*
a++g++R+R q+ A+R
gi|1824401 2802 AEGGRQRQRLVQDTADR 2818
DUF1485: domain 1 of 1, from 2824 to 2842: score 2.6, E = 2.7
*->fvfvApflpldeavdrAla<-*
+++ Ap p++ a++rA+a
gi|1824401 2824 WHVSAPGAPIRTALRRAMA 2842
Neugrin: domain 1 of 1, from 2826 to 2841: score 1.3, E = 2.4
*->mEAPGAPPRtLtWEAm<-*
+ APGAP Rt Am
gi|1824401 2826 VSAPGAPIRTALRRAM 2841
SgaT_UlaA: domain 1 of 1, from 2835 to 2847: score -1.1, E = 9.9
*->tagwmgeadlsll<-*
ta++ ++adls+
gi|1824401 2835 TALRRAMADLSIA 2847
PAS_5: domain 1 of 1, from 2927 to 2942: score 1.3, E = 8.9
*->PLatasgtpdriLGlLa<-*
PL++a+g++ + G++a
gi|1824401 2927 PLQQAPGEQ-AVVGSYA 2942
DUF179: domain 1 of 1, from 2984 to 2998: score 2.5, E = 2
CS S-GGGHHHHHHHHGG
*->tppeerWqaAlrrlG<-*
+++ +rW+aA+ G
gi|1824401 2984 VAVRDRWTAAMGAVG 2998
Glyco_hydro_56: domain 1 of 1, from 3067 to 3078: score -0.3, E = 9.1
CS ----....----
*->fraPPvipnrpF<-*
+r PP++ +r+F
gi|1824401 3067 YRLPPFLRGRRF 3078
Neurokinin_B: domain 1 of 1, from 3067 to 3082: score 1.5, E = 8.6
*->YqLPPslLrRLydsrs<-*
Y LPP l R + s++
gi|1824401 3067 YRLPPFLRGRRFPSHP 3082
BCSC_C: domain 1 of 1, from 3138 to 3212: score 6.2, E = 0.13
*->lSkLtaaevPlevriPleagdghlffrvdpVsLdAGsldtdngysla
+++a++ P + +P ++ g+l f+ +pV+ + + l t gy l+
gi|1824401 3138 --RYRAWSRPHH--LPVGGSPGQLRFTLTPVTTTVQRLRT--GYELE 3178
rFGtgaalgaagsgaavgaa.....sQsasGVal<-*
++ t+a +aag+++ ga + + sQ+a+G ++
gi|1824401 3179 DYRTTARDDAAGTTQDRGADvtlsaSQRAAGSGV 3212
RHS_repeat: domain 1 of 2, from 3181 to 3192: score 0.3, E = 31
*->rltaltlttstdasGtt<-*
r ta+ +da+Gtt
gi|1824401 3181 RTTAR-----DDAAGTT 3192
AroM: domain 1 of 1, from 3183 to 3199: score 0.1, E = 9
*->sdideAAaeLldqGadL<-*
+++d+AA++++d Gad+
gi|1824401 3183 TARDDAAGTTQDRGADV 3199
Peptidase_U35: domain 1 of 1, from 3213 to 3235: score 5.4, E = 0.27
*->vVtfPAypdarvevaarslenvkqe<-*
+V +PA +++ ++++rs ++++
gi|1824401 3213 LVANPALQGT--AARQRSSARTETA 3235
ClpS: domain 1 of 1, from 3247 to 3262: score 3.1, E = 6.9
*->EtkveqvkdkarenghPLtctm<-*
+t++e+v++++ Lt+tm
gi|1824401 3247 QTHAEIVTSYT------LTVTM 3262
MucBP: domain 1 of 1, from 3252 to 3278: score 3.2, E = 4.1
*->ltktvtvTvhYvDedGnelapdvvQtv<-*
++++t Tv+ D+ G++l p+ + +v
gi|1824401 3252 IVTSYTLTVTMTDASGEPLGPTATAPV 3278
MCE: domain 1 of 1, from 3254 to 3267: score 1.8, E = 8.1
*->rgytvtayFddalgG<-*
+yt+t++++da +G
gi|1824401 3254 TSYTLTVTMTDA-SG 3267
He_PIG: domain 1 of 1, from 3255 to 3267: score 6.0, E = 0.64
*->sytftvtatdgsg<-*
syt tvt td+sg
gi|1824401 3255 SYTLTVTMTDASG 3267
DUF824: domain 1 of 1, from 3257 to 3271: score 7.0, E = 0.67
*->pltVTvKDaaGnPvp<-*
+ltVT +Da+G P++
gi|1824401 3257 TLTVTMTDASGEPLG 3271
Sigma70_r3: domain 1 of 1, from 3292 to 3313: score 4.1, E = 2.8
*->eeeDselgdlleDdeaespedav<-*
+e+D++ g l+e + ++ pe av
gi|1824401 3292 PEGDGAAGALTEQE-IPEPERAV 3313
P-mevalo_kinase: domain 1 of 1, from 3309 to 3315: score 2.0, E = 2
*->PERvvTl<-*
PER+vTl
gi|1824401 3309 PERAVTL 3315
FRG1: domain 1 of 1, from 3363 to 3380: score 2.8, E = 0.19
*->rinekDkkelkkAkAdGs<-*
++n+ D +l A+AdGs
gi|1824401 3363 AVNVHDALTLATARADGS 3380
Pyridox_oxidase: domain 1 of 1, from 3367 to 3381: score 2.0, E = 5.6
CS TSEEEEEEEETTS-E
*->pnagvLATvdadGrP<-*
++a +LAT++adG P
gi|1824401 3367 HDALTLATARADGSP 3381
GlcNAc_2-epim: domain 1 of 1, from 3430 to 3445: score -0.2, E = 5.3
*->GfFerLdadGqpldad<-*
Gf e+L+a+G+pl+++
gi|1824401 3430 GFREALGAEGSPLPTQ 3445
Adeno_VII: domain 1 of 1, from 3457 to 3489: score 2.3, E = 5.2
*->aaARvryaRRvaasarRRlrRrsrrvrrrpataamraAra<-*
a+ R yaR+ +RR++R++++ p++ amr+ a
gi|1824401 3457 ADSR-LYARM-----HRRGARLLAVEN-KPRMEAMRRRKA 3489
Glyco_transf_22: domain 1 of 1, from 3459 to 3485: score 0.1, E = 2.4
*->alflglvhqyGaplavykvkevmshln<-*
+++++++h++Ga l++ ++k+ m++ +
gi|1824401 3459 SRLYARMHRRGARLLAVENKPRMEAMR 3485
CLP_protease: domain 1 of 1, from 3489 to 3505: score 1.1, E = 6.3
CS HHHHHHHTS-SEE-SSS
*->AeEAkeYGLIDkViesr<-*
A +A+e G++D+V +
gi|1824401 3489 ASDALESGIVDNVEGAV 3505
DUF1865: domain 1 of 1, from 3503 to 3515: score 1.8, E = 3.8
CS SXXXEE.SXXSS-
*->GaGtSspdtgNqn<-*
Ga +Ssp gN+n
gi|1824401 3503 GAVSSSPMAGNSN 3515
SWIRM: domain 1 of 1, from 3647 to 3666: score 3.4, E = 3
*->lkeaaraswldlsalppiEl<-*
+++ar++wldlsa++ + l
gi|1824401 3647 ARARAREAWLDLSADERAAL 3666
OHCU_decarbox: domain 1 of 1, from 3648 to 3680: score 6.5, E = 0.42
*->haamraavlaaseedqleaasalirAHPrLGgkaaqa<-*
+a++r+a+l++s ++++ al +HP+L+++++++
gi|1824401 3648 RARAREAWLDLSADERA----ALGDGHPDLATVLPRS 3680
Albicidin_res: domain 1 of 1, from 3654 to 3671: score 1.4, E = 6.7
*->eWpaLVaevRaamdagvd<-*
+W++L a+ Raa+ +g +
gi|1824401 3654 AWLDLSADERAALGDGHP 3671
Pertussis_S2S3: domain 1 of 1, from 3701 to 3723: score 0.5, E = 6.9
CS SEEE--S---EEEECCEEEEEEEE
*->tirktGqPAaDHYYskvtAtRLLa<-*
r+t AaDH + AtRL a
gi|1824401 3701 -RRHTDAAAADHHRLHLAATRLTA 3723
DUF1254: domain 1 of 1, from 3740 to 3751: score 1.1, E = 8.2
*->ivLpPgiwkGdvPe<-*
++ P+ w ++Pe
gi|1824401 3740 YT-APD-WRSEAPE 3751
OTU: domain 3 of 3, from 3781 to 3791: score 1.0, E = 12
*->pgDGnCLfrav<-*
p DG +f+a+
gi|1824401 3781 PHDGASFFHAL 3791
SoxG: domain 1 of 1, from 3786 to 3797: score 1.0, E = 7.7
*->slWhwLldasaE<-*
s++h+Ll ++++
gi|1824401 3786 SFFHALLAVARD 3797
PCP_red: domain 1 of 1, from 3811 to 3831: score 3.9, E = 2.2
*->EkfArekGiteITvEvlyaAK<-*
E+fA+ +e+T+E + aA+
gi|1824401 3811 ERFAARPADPEVTAEAVAAAR 3831
HEAT_PBS: domain 2 of 2, from 3830 to 3850: score 2.5, E = 19
CS HHHHHHHHHCCCSSHCCHHHH
*->vRraAaraLgalgdpeAipaL<-*
+R + a+aL+ g+++ ++aL
gi|1824401 3830 ARDRLAWALADHGNEDLLDAL 3850
LTXXQ: domain 1 of 1, from 3870 to 3882: score 3.0, E = 7.6
*->LTpEQrqqlkrlk<-*
LT++Q+++++++
gi|1824401 3870 LTAAQQAEFDAFG 3882
Mt_ATP-synt_D: domain 1 of 1, from 3886 to 3896: score 1.0, E = 6.3
*->ptfWPDPCniGLnHtPeEql<-*
+tfWP tPe +
gi|1824401 3886 QTFWP---------TPEQRV 3896
DUF1550: domain 1 of 1, from 3896 to 3908: score 3.0, E = 2.2
*->laaLalAlArPfl<-*
+a+++ Al rPf+
gi|1824401 3896 VALAVAALSRPFA 3908
DNA_pol_viral_C: domain 1 of 1, from 4039 to 4047: score -0.2, E = 1.9
*->qtCvaWiPP<-*
+t +W PP
gi|1824401 4039 HTTAPWLPP 4047
DUF1134: domain 1 of 1, from 4068 to 4091: score 1.3, E = 2.6
*->sstYsedEiidaahdFFGktagGL<-*
+ tY++ + +++FFG+ + +L
gi|1824401 4068 GATYTQGAPTGRGNGFFGALSTAL 4091
SipA: domain 1 of 1, from 4081 to 4111: score 2.6, E = 0.92
*->ekllravrkaLepaaakpfaqrRefeelrke<-*
+ + +a++ aL aaa+p++ rRe lr +
gi|1824401 4081 NGFFGALSTALRQAAAQPGPDRREASRLRTR 4111
Abhydrolase_3: domain 1 of 1, from 4171 to 4202: score 3.7, E = 1.2
CS HHHHHHHHHHH H.TT--EEEEEECCEETTGGG
*->DegeaYAerLr.aWaGVpVelveypGmiHgFll<-*
D ++a Ae ++ a G V+lve++G +H ++
gi|1824401 4171 DADRAVAEWAAaA-TGATVTLVEENGTVHTYAG 4202
DUF1896: domain 1 of 1, from 4184 to 4196: score 4.4, E = 0.67
CS HHHHHHHHHTT--
*->TGtivlllEeygl<-*
TG++v+l Ee+g
gi|1824401 4184 TGATVTLVEENGT 4196
PI3K_1B_p101: domain 1 of 1, from 4268 to 4275: score -1.1, E = 5.3
*->nTFSGalp<-*
+TFSGa p
gi|1824401 4268 STFSGAEP 4275
Phage_portal_2: domain 1 of 1, from 4353 to 4400: score 0.5, E = 5.7
*->eafggqatdwaprpnrSADaallprlvilnarardLvrNndlvanav
+ + ++ +r +S+ l ++ l a +dL + dl+a +
gi|1824401 4353 TGLTHEVLHLPRRTRVSPQDVLDLGALALEASSDDLESAEDLAAYFI 4399
d<-*
d
gi|1824401 4400 D 4400
DUF1740: domain 1 of 1, from 4355 to 4373: score 2.4, E = 3
*->ilkrnselnkrvrenPeDi<-*
+++++ l +r+r P+D+
gi|1824401 4355 LTHEVLHLPRRTRVSPQDV 4373
PhnH: domain 1 of 1, from 4357 to 4370: score 0.9, E = 7.4
*->eavlgLPRTTrvev<-*
++vl LPR Trv++
gi|1824401 4357 HEVLHLPRRTRVSP 4370
Kin17_mid: domain 1 of 1, from 4389 to 4404: score 1.2, E = 9.8
*->kddEereqklleeQIk<-*
++ E ++++++QI+
gi|1824401 4389 ESAEDLAAYFIDRQIE 4404
Cir_N: domain 1 of 1, from 4400 to 4413: score 2.6, E = 9.6
*->rKKieeLrkEieeE<-*
++ ie +r ++eE
gi|1824401 4400 DRQIETRRDALAEE 4413
HATPase_c: domain 1 of 1, from 4493 to 4512: score 4.6, E = 0.99
CS EEEEEETTTEEEEEEEEECC
*->itvesepggGttftltlPla<-*
i+++s+ ++G+ ++l lP++
gi|1824401 4493 ISYDSRRPRGADIVLVLPET 4512
RVP: domain 1 of 1, from 4521 to 4563: score 2.7, E = 4
CS SSEEEEEEEECCEEEEEEE-TTS-BEEEEEEEEEETTSS -SSE
*->iGGqiirvkqsdnvlveiggkkvrgqftflvlpstPvnt.nkWa<-*
+ G + r+ ++ ++ve+ +++++g++ +v+ +P +t+ Wa
gi|1824401 4521 VSGTTARPTWYPRRPVEVADHPTTGERRLVVHR-SPGETgPDWA 4563
FCD: domain 1 of 1, from 4704 to 4721: score 5.8, E = 0.23
*->elyelRaaLEplaarlAa<-*
++y Raa+E+ aa lAa
gi|1824401 4704 QVYATRAAIERSAALLAA 4721
DUF834: domain 1 of 1, from 4720 to 4743: score 2.7, E = 6.1
*->rarnaavptttadtartaaatregG<-*
a++a+v+ +tadt+ + +re+G
gi|1824401 4720 AATGAGVR-LTADTSVRLLLPREDG 4743
MMPL: domain 1 of 1, from 4788 to 4801: score 3.4, E = 3.8
*->fqSpDGkAayvqvt<-*
f+ pDG+Aa+++v+
gi|1824401 4788 FRGPDGTAATAPVN 4801
YdjC: domain 1 of 1, from 4814 to 4866: score 1.0, E = 5.3
*->ega.alkalllvrslaaafrarfyraGistndgf.aGvygfaksmsg
+ + +++a+++vr+ aa+ ++++++ +++f++Gv+g ++ g
gi|1824401 4814 LAQaLTEAARGVRP-AAGVTPDWAARRAGSDPRFtGGVVGAPTP--G 4857
amflallla<-*
+ + +l +
gi|1824401 4858 EPYGRALSH 4866
DUF2322: domain 1 of 1, from 4888 to 4902: score 3.0, E = 2.7
*->LavieggeaLrvkvv<-*
+a++e ge++ ++ v
gi|1824401 4888 FAWAEVGEGYLIQSV 4902
MSA_2: domain 1 of 1, from 4901 to 4911: score -0.3, E = 6.5
*->tatTtTTNdaEas<-*
+ +TTNd+ a+
gi|1824401 4901 --SVSTTNDGGAQ 4911
GvpL_GvpF: domain 1 of 1, from 4925 to 4937: score 2.5, E = 1.1
*->GPWPPYnFvdihi<-*
GP +PY F+++ +
gi|1824401 4925 GPHAPYHFAQVVL 4937
Plug_translocon: domain 1 of 1, from 4929 to 4942: score 4.1, E = 5
CS --TTCHHHHT--TT
*->pfywlRailAsnrG<-*
p + +++lAs+ G
gi|1824401 4929 PYHFAQVVLASEDG 4942
RHS_repeat: domain 2 of 2, from 4971 to 4992: score 2.0, E = 11
*->q.tYrYDaagrltaltlttstdasGtt<-*
+++Y D++grl + td++ ++
gi|1824401 4971 LdRYDADELGRLARE-----TDRRAEE 4992
Terminase_GpA: domain 1 of 1, from 5010 to 5027: score -1.2, E = 7.5
*->AlAaaillGlhRyeeirW<-*
A+Aa l+G+h e rW
gi|1824401 5010 AHAARALAGVHEAEQVRW 5027
Gp49: domain 1 of 1, from 5038 to 5053: score 4.8, E = 1.8
*->TpkkDIdtAkqrlkel<-*
T ++++d+A++r+++
gi|1824401 5038 TAQREVDRARARARDA 5053
Pox_A_type_inc: domain 1 of 1, from 5041 to 5052: score 4.6, E = 4.8
*->rEldrlRrrIsd<-*
rE+dr+R r +d
gi|1824401 5041 REVDRARARARD 5052
Fibritin_C: domain 1 of 1, from 5062 to 5085: score 0.5, E = 9.5
*->ddGVDSSFVrwYvRkdgaWvllsti<-*
dd+ D F r+Y R+ g+ + ++++
gi|1824401 5062 DDK-DLWFFRAYSRRPGESAHAVNA 5085
IlvB_leader: domain 2 of 2, from 5079 to 5109: score 2.6, E = 4.6
*->mttstlnakLLntAhvAAvvvvRvvvvvGsAP<-*
+na+LL ++A vv G P
gi|1824401 5079 -SAHAVNAALLSEGPSAVSNPLTTVVLHGHTP 5109
Rubella_E1: domain 1 of 1, from 5099 to 5109: score -1.6, E = 6.2
*->LtAvvLqGYnP<-*
Lt vvL G P
gi|1824401 5099 LTTVVLHGHTP 5109
Metallophos: domain 1 of 1, from 5102 to 5111: score 1.4, E = 9.6
CS EEEEESSSSE
*->lvirGHtHvp<-*
+v++GHt +p
gi|1824401 5102 VVLHGHTPRP 5111
Herpes_ori_bp: domain 1 of 1, from 5114 to 5151: score 1.9, E = 1.4
*->rllsflakglepgpDapdsLEa.ALaelpaeaWPrvsG<-*
r l+f+++ +p+ D L+a AL+ a++W r++G
gi|1824401 5114 RTLRFAEQRHNPASDQDENLDAlALSLARAGLWNRANG 5151
adh_short: domain 1 of 1, from 5133 to 5145: score 1.9, E = 4.8
CS HHHHHHHHHHHHG
*->LDaLAehRraeGL<-*
LDaLA +++++GL
gi|1824401 5133 LDALALSLARAGL 5145
DUF2231: domain 1 of 1, from 5140 to 5147: score 1.2, E = 8.4
*->ffdVGwWN<-*
++++G+WN
gi|1824401 5140 LARAGLWN 5147
APH: domain 1 of 1, from 5202 to 5334: score 2.9, E = 1.5
CS EEEE-----SSSEEEEEE-S -...EEEEEE
*->tlrplsgGasnrtylvttgd.gdapryvlrr................
tl+ ++ ++ +++ t+ ++ v++++ +++++++ ++++++
gi|1824401 5202 TLSDFRLTQDAKRVRGATDPdR---GRVVTVdiddrrrtpaprphrp 5245
CS
..................................................
++ +++++++++ ++++ +++ + ++++++++++ ++ +++ ++++++++
gi|1824401 5246 eplgeptepgtpapprpasgpapatgspteppgsagsapgragsrtsrrs 5295
CS E-GGTSTT-HHHHHHHHHHHTTT
................appgeaaeelrrEaavlrhLaal<-*
+++++++ + + +a+ ++a e+l++E+++++hLa++
gi|1824401 5296 vgtspdrgvevpawvrARIRYAEESLAFERRLADHLAEN 5334
Hp0062: domain 1 of 1, from 5308 to 5321: score 1.0, E = 5.5
*->AWLKERiRvLEEDY<-*
AW++ RiR EE
gi|1824401 5308 AWVRARIRYAEESL 5321
NIF3: domain 1 of 1, from 5325 to 5344: score 1.4, E = 5
*->kaLaekLkekfgvevefidi<-*
++La++L+e++ v++ef +
gi|1824401 5325 RRLADHLAENEAVTEEFRKM 5344
BHD_3: domain 1 of 1, from 5337 to 5349: score 2.0, E = 6.4
*->Vaeefeeallaaw<-*
V eef+++ aaw
gi|1824401 5337 VTEEFRKMARAAW 5349
JTB: domain 1 of 1, from 5342 to 5356: score 3.2, E = 1.8
*->rqLdRkaymrvrkql<-*
r R+a +r r+q+
gi|1824401 5342 RKMARAAWERARQQF 5356
TPR_2: domain 1 of 1, from 5345 to 5359: score 3.9, E = 5.6
CS HHHHHHHHHHH-TT-
*->AleayekAleldPnn<-*
A++a+e+A + +P++
gi|1824401 5345 ARAAWERARQQFPRH 5359
Mob1_phocein: domain 1 of 1, from 5378 to 5395: score 1.9, E = 3.7
CS XXX---TT---..HHHHTS-
*->qqyveatLgsgvadLktiVk<-*
++ +++ L+sg +L+++V+
gi|1824401 5378 RPALQQVLRSG--NLRELVT 5395
DmpG_comm: domain 1 of 1, from 5531 to 5545: score 2.3, E = 5.9
CS HHHHHHHHHHHHT--
*->FLkHAeraaeryGvd<-*
FL HA r + r+G+d
gi|1824401 5531 FLVHAARMRDRWGID 5545
DOPA_dioxygen: domain 1 of 1, from 5602 to 5611: score 0.9, E = 8.7
*->PnTEagdelrDH<-*
P+T + elrDH
gi|1824401 5602 PLT--ERELRDH 5611
//