hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 192360952.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|192360952|ref|YP_001981111.1|
Accession: [none]
Description: Putative Ig domain family [Cellvibrio japonicus Ueda107]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
He_PIG Putative Ig domain 129.5 5.5e-36 12
Chlam_PMP Chlamydia polymorphic membrane protei 36.4 1.2e-08 6
PKD PKD domain 21.3 5.4e-06 5
HYR HYR domain 13.4 0.0023 1
FG-GAP FG-GAP repeat 14.8 0.0024 1
A2M_N_2 Alpha-2-macroglobulin family N-termin 11.2 0.017 1
Cna_B Cna protein B-type domain 7.4 0.096 2
FSA_C Fragile site-associated protein C-ter 3.6 0.16 1
YadA YadA-like C-terminal region 6.2 0.23 1
FlaE Flagellar basal body protein FlaE 6.0 0.27 2
HET Heterokaryon incompatibility protein 3.3 0.31 1
Big_2 Bacterial Ig-like domain (group 2) 6.4 0.36 1
GBP_C Guanylate-binding protein, C-terminal 4.4 0.43 2
SUN Beta-glucosidase (SUN family) 3.9 0.48 1
Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminu 5.5 0.55 2
LEA_6 Late embryogenesis abundant protein 1 6.2 0.61 4
DUF1254 Protein of unknown function (DUF1254) 4.4 0.83 1
BCDHK_Adom3 Mitochondrial branched-chain alpha-ke 3.6 0.83 1
DUF2501 Protein of unknown function (DUF2501) 1.6 0.86 1
Binary_toxB Clostridial binary toxin B/anthrax to 2.5 0.88 1
META META domain 5.9 0.91 1
AIG2 AIG2-like family 3.3 1.1 1
Ribosomal_L3 Ribosomal protein L3 3.0 1.1 1
Apocytochr_F_C Apocytochrome F, C-terminal 3.6 1.4 2
Alginate_lyase Alginate lyase 2.1 1.4 1
DUF461 Protein of unknown function (DUF461) 4.1 1.5 1
CD34_antigen CD34/Podocalyxin family 2.8 1.7 1
Tn916-Xis Excisionase from transposon Tn916 3.5 1.8 6
CNPase 2',3'-cyclic nucleotide 3'-phosphodie 2.1 2.1 1
Ribonuc_red_2_N Class II vitamin B12-dependent ribonu 2.4 2.5 1
Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain 3.5 2.6 1
DUF802 Domain of unknown function (DUF802) 4.3 3 1
OprD outer membrane porin, OprD family 1.1 3.1 1
Pneumo_ncap Pneumovirus nucleocapsid protein 0.7 3.4 1
DUF1857 Domain of unknown function (DUF1857) 1.8 3.6 1
Herpes_U47 Herpesvirus glycoprotein U47 -0.5 3.8 1
Y_Y_Y Y_Y_Y domain 2.9 3.9 1
Ydc2-catalyt Mitochondrial resolvase Ydc2, catalyt 0.1 4 1
DUF824 Salmonella repeat of unknown function 4.1 4.1 1
Cecropin Cecropin family 4.1 4.2 2
Secretin_N_2 Secretin N-terminal domain 2.2 4.2 1
PhageMin_Tail Phage-related minor tail protein 2.1 4.3 1
CBM_6 Carbohydrate binding module (family 6 1.6 4.3 1
PGI Phosphoglucose isomerase 0.8 4.4 1
Pneumo_NS1 Pneumovirus NS1 protein 1.6 4.6 1
DUF1513 Protein of unknown function (DUF1513) 1.3 4.6 1
E1_DerP2_DerF2 ML domain 1.7 4.7 1
I-set Immunoglobulin I-set domain 2.7 4.8 2
Imp-YgjV Bacterial inner membrane protein 2.1 5 1
Ephrin_lbd Ephrin receptor ligand binding domain 1.3 5 1
PGAMP Planctomycete PGAMP 3.1 5.1 1
L27_N L27_N 2.9 5.3 1
CDK2AP Cyclin-dependent kinase 2-associated 1.2 5.4 1
SurA_N SurA N-terminal domain 1.4 5.6 1
RepA1_leader Tap RepA1 leader peptide 3.4 5.9 1
FliX Class II flagellar assembly regulator 0.3 6.1 1
DUF1343 Protein of unknown function (DUF1343) 0.1 6.2 1
HATPase_c Histidine kinase-, DNA gyrase B-, and 1.8 6.3 1
MIF Macrophage migration inhibitory facto 1.3 6.4 1
ATP-synt_ab ATP synthase alpha/beta family, nucle 0.7 6.4 3
GreA_GreB Prokaryotic transcription elongation 2.5 6.5 1
CopC Copper resistance protein CopC 1.2 6.5 1
HMA Heavy-metal-associated domain 2.3 6.5 1
DUF2271 Predicted periplasmic protein (DUF227 1.2 6.6 1
DUF1110 Protein of unknown function (DUF1110) 0.4 6.6 1
TSP_3 Thrombospondin type 3 repeat 3.7 6.6 1
FTP Fungalysin/Thermolysin Propeptide Mot 2.7 6.7 3
DUF2134 Predicted membrane protein (DUF2134) 1.6 6.8 2
Lamp Lysosome-associated membrane glycopro 0.4 7 1
NEAT Iron Transport-associated domain 1.8 7 1
Snf7 Snf7 1.1 7.1 1
Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) -0.1 7.2 1
DUF1927 Domain of unknown function (DUF1927) 2.3 7.5 1
Peptidase_C25_C Peptidase family C25, C terminal ig-l 1.3 8 1
TetR_C_4 YsiA-like protein, C-terminal region 1.4 8.1 1
RIP Ribosome inactivating protein 0.2 8.2 1
Poty_coat Potyvirus coat protein 0.0 8.2 1
DUF1521 Domain of Unknown Function (DUF1521) -0.4 8.2 1
Pyr_redox_2 Pyridine nucleotide-disulphide oxidor 0.1 8.3 1
Transketolase_N Transketolase, thiamine diphosphate b -0.6 8.4 1
eIF-6 eIF-6 family 0.1 9 1
Phage_DNA_bind Helix-destabilising protein 1.7 9 1
FerA FerA (NUC095) domain 2.7 9 1
Collar Phage Tail Collar Domain 2.2 9.1 1
Big_1 Bacterial Ig-like domain (group 1) 0.6 9.2 1
MetW Methionine biosynthesis protein MetW 0.5 9.4 1
CfAFP Choristoneura fumiferana antifreeze p 0.2 9.5 1
Wound_ind Wound-inducible basic protein family 1.0 9.5 1
SLAP Bacterial surface layer protein -1.6 9.5 1
DUF1509 Protein of unknown function (DUF1509) -1.3 9.9 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
DUF802 1/1 152 169 .. 41 58 .] 4.3 3
SurA_N 1/1 154 162 .. 129 137 .] 1.4 5.6
HET 1/1 250 260 .. 1 11 [. 3.3 0.31
Secretin_N_2 1/1 277 291 .. 92 107 .] 2.2 4.2
FlaE 1/2 291 361 .. 47 102 .] 2.5 3
Ephrin_lbd 1/1 388 400 .. 165 177 .] 1.3 5
SUN 1/1 425 455 .. 1 31 [. 3.9 0.48
FTP 1/3 440 461 .. 1 20 [. 0.6 29
Chlam_PMP 1/6 466 483 .. 5 19 .] 0.3 87
Tn916-Xis 1/6 484 497 .. 12 25 .. 0.6 13
FTP 2/3 540 561 .. 1 20 [. 0.7 25
Tn916-Xis 2/6 584 597 .. 12 25 .. 0.6 13
FTP 3/3 640 661 .. 1 20 [. 1.4 16
Tn916-Xis 3/6 684 697 .. 12 25 .. 0.6 13
Tn916-Xis 4/6 784 797 .. 12 25 .. 0.6 13
Tn916-Xis 5/6 884 897 .. 12 25 .. 0.6 13
Tn916-Xis 6/6 984 997 .. 12 25 .. 0.6 13
PKD 1/5 997 1016 .. 72 92 .] 1.4 6.6
L27_N 1/1 1009 1020 .. 38 49 .] 2.9 5.3
CBM_6 1/1 1052 1075 .. 46 68 .. 1.6 4.3
CfAFP 1/1 1075 1083 .. 130 138 .] 0.2 9.5
NEAT 1/1 1084 1095 .. 1 12 [. 1.8 7
Y_Y_Y 1/1 1088 1116 .. 38 69 .] 2.9 3.9
He_PIG 1/12 1089 1104 .. 46 61 .] 0.6 23
Big_2 1/1 1119 1143 .. 1 27 [. 6.4 0.36
I-set 1/2 1121 1141 .. 1 21 [. 1.3 12
A2M_N_2 1/1 1123 1143 .. 1 21 [. 11.2 0.017
DUF461 1/1 1129 1149 .. 87 109 .. 4.1 1.5
DUF1927 1/1 1130 1142 .. 10 22 .. 2.3 7.5
E1_DerP2_DerF2 1/1 1132 1159 .. 94 120 .. 1.7 4.7
Pyr_redox_2 1/1 1151 1161 .. 275 285 .] 0.1 8.3
GBP_C 1/2 1154 1166 .. 1 13 [. 0.5 5.5
Snf7 1/1 1217 1226 .. 188 197 .] 1.1 7.1
DUF2134 1/2 1242 1255 .. 103 115 .] 0.8 12
PKD 2/5 1247 1314 .. 1 92 [] 0.9 9.9
Cna_B 1/2 1255 1291 .. 2 36 .. 6.7 0.16
GreA_GreB 1/1 1256 1268 .. 10 22 .. 2.5 6.5
HYR 1/1 1284 1316 .. 54 86 .] 13.4 0.0023
Cecropin 1/2 1322 1332 .. 21 31 .] 4.1 4.2
DUF1110 1/1 1351 1372 .. 180 203 .] 0.4 6.6
CDK2AP 1/1 1363 1382 .. 180 199 .] 1.2 5.4
TetR_C_4 1/1 1388 1403 .. 118 133 .] 1.4 8.1
He_PIG 2/12 1447 1469 .. 1 23 [. 0.5 24
FliX 1/1 1463 1487 .. 1 30 [. 0.3 6.1
GBP_C 2/2 1468 1477 .. 1 10 [. 3.8 0.61
PKD 3/5 1496 1521 .. 67 92 .] 7.2 0.12
eIF-6 1/1 1540 1552 .. 1 14 [. 0.1 9
Big_1 1/1 1563 1590 .. 1 30 [. 0.6 9.2
DUF2134 2/2 1577 1593 .. 94 115 .] 0.8 12
DUF1521 1/1 1592 1609 .. 158 175 .] -0.4 8.2
RIP 1/1 1680 1692 .. 1 17 [. 0.2 8.2
MIF 1/1 1685 1700 .. 100 115 .] 1.3 6.4
FG-GAP 1/1 1717 1738 .. 8 36 .] 14.8 0.0024
Ydc2-catalyt 1/1 1737 1746 .. 1 10 [. 0.1 4
Chlam_PMP 2/6 1777 1796 .. 1 19 [] 11.0 0.1
Chlam_PMP 3/6 1804 1822 .. 1 19 [] 8.5 0.52
Cna_B 2/2 1822 1843 .. 1 21 [. 0.7 11
Chlam_PMP 4/6 1831 1849 .. 1 19 [] 6.0 2.4
Cecropin 2/2 1844 1859 .. 16 31 .] 0.0 60
Chlam_PMP 5/6 1857 1878 .. 1 19 [] 6.7 1.6
Herpes_U47 1/1 1876 1896 .. 658 678 .] -0.5 3.8
Chlam_PMP 6/6 1886 1904 .. 1 19 [] 3.9 8.8
CD34_antigen 1/1 2070 2080 .. 209 219 .] 2.8 1.7
PGI 1/1 2125 2142 .. 496 513 .] 0.8 4.4
Apocytochr_F_C 1/2 2130 2153 .. 1 24 [. 1.9 4.3
I-set 2/2 2190 2201 .. 85 96 .] 1.4 11
META 1/1 2223 2252 .. 82 105 .] 5.9 0.91
Pneumo_NS1 1/1 2249 2264 .. 121 136 .] 1.6 4.6
SLAP 1/1 2281 2295 .. 1 15 [. -1.6 9.5
Ribosomal_L3 1/1 2325 2335 .. 288 298 .] 3.0 1.1
He_PIG 3/12 2399 2442 .. 1 61 [] 15.9 0.001
LEA_6 1/4 2458 2465 .. 56 63 .. 1.6 11
He_PIG 4/12 2461 2487 .. 36 61 .] 5.0 1.2
ATP-synt_ab 1/3 2485 2492 .. 204 211 .] 0.2 8.9
He_PIG 5/12 2492 2535 .. 1 61 [] 19.8 7.7e-05
Alpha-L-AF_C 1/2 2522 2543 .. 200 225 .] 2.8 3
LEA_6 2/4 2551 2558 .. 56 63 .. 1.6 11
He_PIG 6/12 2554 2580 .. 36 61 .] 5.0 1.2
ATP-synt_ab 2/3 2578 2585 .. 204 211 .] 0.2 8.9
He_PIG 7/12 2585 2628 .. 1 61 [] 19.8 7.7e-05
Alpha-L-AF_C 2/2 2615 2636 .. 200 225 .] 2.8 3
LEA_6 3/4 2644 2651 .. 56 63 .. 1.6 11
He_PIG 8/12 2647 2673 .. 36 61 .] 5.0 1.2
ATP-synt_ab 3/3 2671 2678 .. 204 211 .] 0.2 8.9
FSA_C 1/1 2676 2730 .. 603 662 .. 3.6 0.16
He_PIG 9/12 2678 2721 .. 1 61 [] 16.9 0.00053
Peptidase_S13 1/1 2763 2776 .. 386 399 .] -0.1 7.2
He_PIG 10/12 2770 2813 .. 1 61 [] 21.4 2.7e-05
DUF1254 1/1 2823 2850 .. 34 61 .. 4.4 0.83
LEA_6 4/4 2829 2836 .. 56 63 .. 1.6 11
DUF1509 1/1 2839 2855 .. 404 420 .] -1.3 9.9
Poty_coat 1/1 2852 2866 .. 1 15 [. 0.0 8.2
He_PIG 11/12 2863 2906 .. 1 61 [] 15.4 0.0014
DUF1857 1/1 2886 2906 .. 96 119 .. 1.8 3.6
Peptidase_C25_C 1/1 2923 2938 .. 1 16 [. 1.3 8
BCDHK_Adom3 1/1 2943 2951 .. 1 9 [. 3.6 0.83
PhageMin_Tail 1/1 2947 2977 .. 1 35 [. 2.1 4.3
FerA 1/1 2951 2969 .. 1 19 [. 2.7 9
Alpha_adaptin_C 1/1 2957 2969 .. 102 114 .] 3.5 2.6
DUF2271 1/1 2997 3012 .. 86 101 .. 1.2 6.6
Phage_DNA_bind 1/1 3032 3043 .. 1 13 [. 1.7 9
Ribonuc_red_2_N 1/1 3077 3086 .. 1 10 [. 2.4 2.5
PGAMP 1/1 3084 3095 .. 24 35 .] 3.1 5.1
PKD 4/5 3150 3172 .. 1 36 [. 2.7 2.7
HATPase_c 1/1 3151 3215 .. 21 46 .. 1.8 6.3
Lamp 1/1 3157 3174 .. 1 18 [. 0.4 7
FlaE 2/2 3196 3225 .. 1 31 [. 3.5 1.6
He_PIG 12/12 3203 3216 .. 48 61 .] 4.3 2
PKD 5/5 3203 3227 .. 68 92 .] 9.1 0.029
AIG2 1/1 3207 3227 .. 98 119 .] 3.3 1.1
DUF824 1/1 3207 3227 .. 17 36 .. 4.1 4.1
Binary_toxB 1/1 3237 3248 .. 1 12 [. 2.5 0.88
TSP_3 1/1 3238 3252 .. 1 15 [] 3.7 6.6
Collar 1/1 3256 3268 .. 45 57 .] 2.2 9.1
DUF1343 1/1 3276 3282 .. 1 7 [. 0.1 6.2
Apocytochr_F_C 2/2 3379 3386 .. 1 8 [. 1.7 4.8
Pneumo_ncap 1/1 3412 3422 .. 382 392 .] 0.7 3.4
Alginate_lyase 1/1 3474 3500 .. 1 29 [. 2.1 1.4
CopC 1/1 3474 3497 .. 1 26 [. 1.2 6.5
RepA1_leader 1/1 3474 3496 .. 1 25 [] 3.4 5.9
DUF2501 1/1 3481 3499 .. 1 19 [. 1.6 0.86
OprD 1/1 3482 3501 .. 1 26 [. 1.1 3.1
CNPase 1/1 3493 3502 .. 1 10 [. 2.1 2.1
Transketolase_N 1/1 3500 3511 .. 284 295 .. -0.6 8.4
HMA 1/1 3509 3534 .. 40 64 .] 2.3 6.5
Wound_ind 1/1 3509 3514 .. 1 7 [. 1.0 9.5
YadA 1/1 3542 3552 .. 70 80 .] 6.2 0.23
DUF1513 1/1 3549 3559 .. 306 316 .] 1.3 4.6
MetW 1/1 3613 3623 .. 185 195 .] 0.5 9.4
Imp-YgjV 1/1 3661 3674 .. 154 167 .] 2.1 5
Alignments of top-scoring domains:
DUF802: domain 1 of 1, from 152 to 169: score 4.3, E = 3
*->aaLeqfAqtFeqrsaaLl<-*
a+L q +tF ++++aL+
gi|1923609 152 AMLKQEVETFAALQGALV 169
SurA_N: domain 1 of 1, from 154 to 162: score 1.4, E = 5.6
*->sdqEVdnfL<-*
++qEV++f+
gi|1923609 154 LKQEVETFA 162
HET: domain 1 of 1, from 250 to 260: score 3.3, E = 0.31
*->YitLSYvWGdp<-*
Y LS +WG++
gi|1923609 250 YNSLSFCWGPA 260
Secretin_N_2: domain 1 of 1, from 277 to 291: score 2.2, E = 4.2
*->LtaPgdGryslStsta<-*
Lt ++dGr +l++s a
gi|1923609 277 LT-SQDGRIVLTASPA 291
FlaE: domain 1 of 2, from 291 to 361: score 2.5, E = 3
*->vtvydtdd........LtFD.snG..ttitsanvggaapvsitLdl.
+ v++++++ + + + +t + s+G ++ ++++ +ga+ ++tL+
gi|1923609 291 AAVLSSGPnwgagyslITQNaSAGqnSGWIEFSADGANLSAFTLSSv 337
...lTqfag.stfstvsavsa.Q.DGy<-*
+++ T + + + v+++ +Q+DG
gi|1923609 338 trgYTMYEScTS---VTVTGTrQsDGT 361
Ephrin_lbd: domain 1 of 1, from 388 to 400: score 1.3, E = 5
*->iALvSVRVFYKKC<-*
iAL SVRV + C
gi|1923609 388 IALTSVRVSFNSC 400
SUN: domain 1 of 1, from 425 to 455: score 3.9, E = 0.48
*->tsvlsStaasattssAAssatsSssedsase<-*
+vl S +++at+ A s++t+ + + ++
gi|1923609 425 NTVLPSISGTATVGNALSTTTGTWTDADGDS 455
FTP: domain 1 of 3, from 440 to 461: score 0.6, E = 29
*->dlkvv.ktttdpnGk.thvRfq<-*
l+ +++t+td++G++ +++q
gi|1923609 440 ALSTTtGTWTDADGDsLTYTYQ 461
Chlam_PMP: domain 1 of 6, from 466 to 483: score 0.3, E = 87
*->sgNsa...aggGGAiyas<-*
++Ns+++ a+ GGA++as
gi|1923609 466 DNNSGtnlAAIGGATSAS 483
Tn916-Xis: domain 1 of 6, from 484 to 497: score 0.6, E = 13
CS SEEEHHHHHHHT--
*->YtLtiEEAsKYFRi<-*
YtLt +A KY R+
gi|1923609 484 YTLTTSDAHKYLRV 497
FTP: domain 2 of 3, from 540 to 561: score 0.7, E = 25
*->dlkvv.ktttdpnGk.thvRfq<-*
l+ +++t+td++G++ +++q
gi|1923609 540 ALSTTnGTWTDADGDsLTYTYQ 561
Tn916-Xis: domain 2 of 6, from 584 to 597: score 0.6, E = 13
CS SEEEHHHHHHHT--
*->YtLtiEEAsKYFRi<-*
YtLt +A KY R+
gi|1923609 584 YTLTTSDAHKYLRV 597
FTP: domain 3 of 3, from 640 to 661: score 1.4, E = 16
*->dlkvv.ktttdpnGk.thvRfq<-*
l+ +++++td++G+++ +++q
gi|1923609 640 ALSTTdGSWTDADGDsRTYTYQ 661
Tn916-Xis: domain 3 of 6, from 684 to 697: score 0.6, E = 13
CS SEEEHHHHHHHT--
*->YtLtiEEAsKYFRi<-*
YtLt +A KY R+
gi|1923609 684 YTLTTSDAHKYLRV 697
Tn916-Xis: domain 4 of 6, from 784 to 797: score 0.6, E = 13
CS SEEEHHHHHHHT--
*->YtLtiEEAsKYFRi<-*
YtLt +A KY R+
gi|1923609 784 YTLTTSDAHKYLRV 797
Tn916-Xis: domain 5 of 6, from 884 to 897: score 0.6, E = 13
CS SEEEHHHHHHHT--
*->YtLtiEEAsKYFRi<-*
YtLt +A KY R+
gi|1923609 884 YTLTTSDAHKYLRV 897
Tn916-Xis: domain 6 of 6, from 984 to 997: score 0.6, E = 13
CS SEEEHHHHHHHT--
*->YtLtiEEAsKYFRi<-*
YtLt +A KY R+
gi|1923609 984 YTLTTSDAHKYLRV 997
PKD: domain 1 of 5, from 997 to 1016: score 1.4, E = 6.6
CS EEEEEEETTCEEEEEEEEEEE
*->VtLtvsngvgsasattttvtV<-*
V +t+++g+g + + t+++
gi|1923609 997 VEVTANDGNGGTQTA-TSIYT 1016
L27_N: domain 1 of 1, from 1009 to 1020: score 2.9, E = 5.3
*->qaAfsihnAVAq<-*
q A si+ AVA
gi|1923609 1009 QTATSIYTAVAN 1020
CBM_6: domain 1 of 1, from 1052 to 1075: score 1.6, E = 4.3
CS SEEEEEEEEEEESSSE. .EEEEE
*->ggaysftarvAnggggg.ggsiei<-*
+++ +ft+++A+g+g +++gs++i
gi|1923609 1052 DADTTFTYSFATGAGDTdNGSFNI 1075
CfAFP: domain 1 of 1, from 1075 to 1083: score 0.2, E = 9.5
CS EES-EEEE-
*->isGCtlrAn<-*
isG +lrAn
gi|1923609 1075 ISGSSLRAN 1083
NEAT: domain 1 of 1, from 1084 to 1095: score 1.8, E = 7
*->asnnLadGtYtI<-*
+s++La GtY++
gi|1923609 1084 DSSTLAAGTYSV 1095
Y_Y_Y: domain 1 of 1, from 1088 to 1116: score 2.9, E = 3.9
*->LppGkYtikvkakdkdgnwsyddiasltftvl<-*
L +G+Y ++++++d ++ +d + +t+t+
gi|1923609 1088 LAAGTYSVLIRTTD-SFAGVFD--KAFTITIV 1116
He_PIG: domain 1 of 12, from 1089 to 1104: score 0.6, E = 23
*->qpGsytftvtatdgsg<-*
++G+y++ + td++
gi|1923609 1089 AAGTYSVLIRTTDSFA 1104
Big_2: domain 1 of 1, from 1119 to 1143: score 6.4, E = 0.36
CS EEEEEEETTT.TEEES--SEEETTSEE
*->avtsvtvsptgntaslakGatlqlkat<-*
++t+ ++ +asl++G+t +l+ t
gi|1923609 1119 ISPTITIGSD--KASLKAGETATLTLT 1143
I-set: domain 1 of 2, from 1121 to 1141: score 1.3, E = 12
CS -EEEE--EEEEEETTCEEEEE
*->PkFtqkpkdveVqeGesarFe<-*
P++t+ + + Ge+a+++
gi|1923609 1121 PTITIGSDKASLKAGETATLT 1141
A2M_N_2: domain 1 of 1, from 1123 to 1143: score 11.2, E = 0.017
*->LklsldkkeykvGetakvtvt<-*
+ + dk+++k+Geta++t+t
gi|1923609 1123 ITIGSDKASLKAGETATLTLT 1143
DUF461: domain 1 of 1, from 1129 to 1149: score 4.1, E = 1.5
CS -S---TTCEEEEEE--TTT..--
*->kqpLkeGdtVplTLtFedgGrgt<-*
k+ Lk+G+t +lTLt + + ++
gi|1923609 1129 KASLKAGETATLTLTLSEA--SS 1149
DUF1927: domain 1 of 1, from 1130 to 1142: score 2.3, E = 7.5
CS SEEETTCEEEEEE
*->afLkaGeeteltL<-*
a+LkaGe+++ltL
gi|1923609 1130 ASLKAGETATLTL 1142
E1_DerP2_DerF2: domain 1 of 1, from 1132 to 1159: score 1.7, E = 4.7
CS B-TTSEEEEEEEE E-STTS-TTEEEEE
*->lkkGetvtytlsl.pipkeyPpgkytVe<-*
lk+Get t+tl+l++ + + g++tV+
gi|1923609 1132 LKAGETATLTLTLsEASSDFAAGDVTVT 1159
Pyr_redox_2: domain 1 of 1, from 1151 to 1161: score 0.1, E = 8.3
CS EECGGGGCESS
RF xxxxxxxxxxx
*->yAaGDvaeggp<-*
+AaGDv+ g
gi|1923609 1151 FAAGDVTVTGG 1161
GBP_C: domain 1 of 2, from 1154 to 1166: score 0.5, E = 5.5
*->GGiiVTGprLatL<-*
G+++VTG L ++
gi|1923609 1154 GDVTVTGGTLSGF 1166
Snf7: domain 1 of 1, from 1217 to 1226: score 1.1, E = 7.1
*->eLPsvPsgel<-*
eLP++Ps+++
gi|1923609 1217 ELPDAPSTPV 1226
DUF2134: domain 1 of 2, from 1242 to 1255: score 0.8, E = 12
*->l.ppsrtlsAtAtA<-*
++++++t++ tA A
gi|1923609 1242 TnNTTPTITGTAEA 1255
PKD: domain 2 of 5, from 1247 to 1314: score 0.9, E = 9.9
CS EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS.SSS
*->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdFGDggsp
++ + +++++g tVt+ +++ Gs G +
gi|1923609 1247 PTIT------GTAEAGSTVTLYDTD------GST-----VLGT---T 1273
CS EEEECSSEEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
gttstepnvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-*
+ t+++ ++t + ++ +G++++t t+++++g++s+ ++ +t+
gi|1923609 1274 TATGGNWSITTSALS----EGDHDLTATATDAAGNVSVASAALTI 1314
Cna_B: domain 1 of 2, from 1255 to 1291: score 6.7, E = 0.16
CS TT-EEEEEETTEEE E--TTSEEEEEEE....-SEE
*->eGAeftLldkdgnv......tTdenGkytftnLPKykppGd<-*
+G ++tL+d dg++ ++++ T+ n+++t L ++Gd
gi|1923609 1255 AGSTVTLYDTDGSTvlgtttATGGNWSITTSAL----SEGD 1291
GreA_GreB: domain 1 of 1, from 1256 to 1268: score 2.5, E = 6.5
*->GatVeiyNdDsde<-*
G+tV++y++D+++
gi|1923609 1256 GSTVTLYDTDGST 1268
HYR: domain 1 of 1, from 1284 to 1316: score 13.4, E = 0.0023
*->GdfFpvGEettVtYtatDnaGN..eAdsCtFtVtV<-*
++ +++G +++ t+tatD+aGN + A s +t+t+
gi|1923609 1284 TSALSEG-DHDLTATATDAAGNvsVA-SAALTITI 1316
Cecropin: domain 1 of 2, from 1322 to 1332: score 4.1, E = 4.2
*->AkPAvkviaqa<-*
AkPA++v+a+a
gi|1923609 1322 AKPAAPVLATA 1332
DUF1110: domain 1 of 1, from 1351 to 1372: score 0.4, E = 6.6
*->LeAAIGnaelGtelAvdARqDVSg<-*
L++A+G +e + v AR DV g
gi|1923609 1351 LQGAVGSVE--ANAIVHARSDVEG 1372
CDK2AP: domain 1 of 1, from 1363 to 1382: score 1.2, E = 5.4
*->IiHARllVReCLaeteRnar<-*
I+HAR+ V +L t na
gi|1923609 1363 IVHARSDVEGGLTNTTANAD 1382
TetR_C_4: domain 1 of 1, from 1388 to 1403: score 1.4, E = 8.1
CS -CGGGHHHHHHHHHH-
*->DLvaLaepvyeLLihG<-*
D+ Lae++++L i +
gi|1923609 1388 DISGLAENTHQLQINA 1403
He_PIG: domain 2 of 12, from 1447 to 1469: score 0.5, E = 24
*->tytlTk.psdgslasysttpgggg<-*
+++l ++ + g+ asys t++ggg
gi|1923609 1447 SFSL-SgAETGTKASYSITSSGGG 1469
FliX: domain 1 of 1, from 1463 to 1487: score 0.3, E = 6.1
*->MrisGprgttaasggkakksrasGgksaFa<-*
i++++g+ta++g++ ++++ ++F+
gi|1923609 1463 --ITSSGGGTAVTGSGLD--VSTAT-QQFT 1487
GBP_C: domain 2 of 2, from 1468 to 1477: score 3.8, E = 0.61
*->GGiiVTGprL<-*
GG++VTG++L
gi|1923609 1468 GGTAVTGSGL 1477
PKD: domain 3 of 5, from 1496 to 1521: score 7.2, E = 0.12
CS SEEEEEEEEEEETTCEEEEEEEEEEE
*->pGtYtVtLtvsngvgsasattttvtV<-*
+Gt tV+Lt ++ +g+++++t t+
gi|1923609 1496 DGTLTVSLTLNDLAGNSATQTNTIAK 1521
eIF-6: domain 1 of 1, from 1540 to 1552: score 0.1, E = 9
CS EEE-BTTB-.-HHH
*->tRlqfeGnpcnIGV<-*
+ + feG++ +IGV
gi|1923609 1540 EPIVFEGSN-YIGV 1552
Big_1: domain 1 of 1, from 1563 to 1590: score 0.6, E = 9.2
CS XGG EEEEECCEEEES-SEEESSSS--EEEE
*->ivd..qltAsitsiiadkttavAngndaiTlT<-*
vd+++ltA t ++++ng+++iTlT
gi|1923609 1563 SVDngTLTAITTGGA----GILGNGTASITLT 1590
DUF2134: domain 2 of 2, from 1577 to 1593: score 0.8, E = 12
*->agilGilfGlppsrtlsAtAtA<-*
agilG ++ ++ t+tA
gi|1923609 1577 AGILGN-----GTASITLTGTA 1593
DUF1521: domain 1 of 1, from 1592 to 1609: score -0.4, E = 8.2
*->tqadldltengaiygdgk<-*
t++d++ ng iy +g
gi|1923609 1592 TASDINTALNGLIYQPGN 1609
RIP: domain 1 of 1, from 1680 to 1692: score 0.2, E = 8.2
CS -EEE....EEESTT--H
*->kptvKFTEtFtlegats<-*
++t+ tF+l+ at+
gi|1923609 1680 EDTI----TFDLDSATA 1692
MIF: domain 1 of 1, from 1685 to 1700: score 1.3, E = 6.4
CS EE-GGGEEETTEEGGG
*->fDleaaqvGfnGstla<-*
fDl++a+ G G t +
gi|1923609 1685 FDLDSATAGNQGGTIT 1700
FG-GAP: domain 1 of 1, from 1717 to 1738: score 14.8, E = 0.0024
CS C-TTSSSSSEEEEEETCCCSCC TSEEEEE
*->gDlnGDGrpDlvvgaPgadggt.dgsvyll<-*
gDl+GDGrpD+ + ++++ + +++
gi|1923609 1717 GDLDGDGRPDVTL-------SAnN-ASRVM 1738
Ydc2-catalyt: domain 1 of 1, from 1737 to 1746: score 0.1, E = 4
CS EEEEEE-STT
*->ILSIDmGIrN<-*
++S+D G++N
gi|1923609 1737 VMSVDTGLSN 1746
Chlam_PMP: domain 2 of 6, from 1777 to 1796: score 11.0, E = 0.1
*->ditFsgNsa.aggGGAiyas<-*
d+++++N ++ gGG+iy+s
gi|1923609 1777 DSVITNNNEpGIGGGGIYGS 1796
Chlam_PMP: domain 3 of 6, from 1804 to 1822: score 8.5, E = 0.52
*->ditFsgNsaaggGGAiyas<-*
++t+s+N+++++GG+i
gi|1923609 1804 NSTISNNTSGSFGGGIRIV 1822
Cna_B: domain 2 of 2, from 1822 to 1843: score 0.7, E = 11
CS -TT-EEEEEETTEEE E--TTS
*->LeGAeftLldkdgnv.tTdenG<-*
+ G + L++++ + +t+d+nG
gi|1923609 1822 VGGSTLNLINSTVSGnTSDDNG 1843
Chlam_PMP: domain 4 of 6, from 1831 to 1849: score 6.0, E = 2.4
*->ditFsgNsaaggGGAiyas<-*
++t sgN++ +GG+i
gi|1923609 1831 NSTVSGNTSDDNGGGIQYA 1849
Cecropin: domain 2 of 2, from 1844 to 1859: score 0.0, E = 60
*->AvIkiAkPAvkviaqa<-*
++I+ A+P + ++ +
gi|1923609 1844 GGIQYAGPGLTMVNTT 1859
Chlam_PMP: domain 5 of 6, from 1857 to 1878: score 6.7, E = 1.6
*->ditFsgNsa...aggGGAiyas<-*
++t sgN+a++++++GG++ s
gi|1923609 1857 NTTVSGNTArgtNSDGGGLQVS 1878
Herpes_U47: domain 1 of 1, from 1876 to 1896: score -0.5, E = 3.8
*->nvssqttniYPqtiteRstev<-*
+vss t n+Y ti + +
gi|1923609 1876 QVSSGTANVYNSTIAGNAAGH 1896
Chlam_PMP: domain 6 of 6, from 1886 to 1904: score 3.9, E = 8.8
*->ditFsgNsaaggGGAiyas<-*
++t+ gN+a+ GG+++a+
gi|1923609 1886 NSTIAGNAAGHAGGGVSAN 1904
CD34_antigen: domain 1 of 1, from 2070 to 2080: score 2.8, E = 1.7
*->dsDvFeeDThL<-*
dsD+ ++DT+L
gi|1923609 2070 DSDITVSDTEL 2080
PGI: domain 1 of 1, from 2125 to 2142: score 0.8, E = 4.4
CS TSTT...SSTHHHHHHHH
*->LegsrkvsgfdssTngLi<-*
L++++ +++fd sT+g +
gi|1923609 2125 LKNGQNIASFDTSTAGQL 2142
Apocytochr_F_C: domain 1 of 2, from 2130 to 2153: score 1.9, E = 4.3
CS SSS--B-SS-EEEEEEEE-TTS-E
*->NNnvynAsaaGrIskItklEkGGy<-*
N++++ s aG+ + I ++ +G++
gi|1923609 2130 NIASFDTSTAGQLTIIFTNANGET 2153
I-set: domain 2 of 2, from 2190 to 2201: score 1.4, E = 11
CS TEEEEEEEEEEE
*->aGeaeasaeLtV<-*
+G+++ +a+Lt+
gi|1923609 2190 GGSVTETASLTI 2201
META: domain 1 of 1, from 2223 to 2252: score 5.9, E = 0.91
*->qaflsaLsavtsysvegg......tLtLtn<-*
+a s++s++t ++ve+g++ + tLtLtn
gi|1923609 2223 GAAVSLFSGATATTVEAGqsliglTLTLTN 2252
Pneumo_NS1: domain 1 of 1, from 2249 to 2264: score 1.6, E = 4.6
*->elakYsnqLseLLGld<-*
+l++ sn +e+LGld
gi|1923609 2249 TLTNLSNGSAEILGLD 2264
SLAP: domain 1 of 1, from 2281 to 2295: score -1.6, E = 9.5
*->ndVdVTPsislnaav<-*
n V+VT s+++++a+
gi|1923609 2281 NAVNVTVSVTGTTAS 2295
Ribosomal_L3: domain 1 of 1, from 2325 to 2335: score 3.0, E = 1.1
*->PGpkkrlVtir<-*
PG+ +r+Vti+
gi|1923609 2325 PGTQNRVVTIT 2335
He_PIG: domain 3 of 12, from 2399 to 2442: score 15.9, E = 0.001
*->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
t+++ + Ps+ +d +tG++tGtPt +
gi|1923609 2399 TFSI-----------------ANQPSWAAFDTATGALTGTPTNA-DV 2427
G.sytftvtatdgsg<-*
G++ + ++++dg
gi|1923609 2428 GtTNGIVISVSDGLA 2442
LEA_6: domain 1 of 4, from 2458 to 2465: score 1.6, E = 11
*->DAPTlSGa<-*
DAPT+SG+
gi|1923609 2458 DAPTISGT 2465
He_PIG: domain 4 of 12, from 2461 to 2487: score 5.0, E = 1.2
*->ritGtPtptvqpG.sytftvtatdgsg<-*
+i+GtP+++v +G +y+ft ta+d +
gi|1923609 2461 TISGTPATSVNQGaAYSFTPTASDIDV 2487
ATP-synt_ab: domain 1 of 3, from 2485 to 2492: score 0.2, E = 8.9
CS B-TTT-B-
RF xxxxxxxx
*->IDvllSvS<-*
IDv++S+S
gi|1923609 2485 IDVGDSLS 2492
He_PIG: domain 5 of 12, from 2492 to 2535: score 19.8, E = 7.7e-05
*->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
++++ + Ps+ +++ +tG ++GtP
gi|1923609 2492 SFSI-----------------ANMPSWASFNTATGELSGTPGND-DV 2520
G.sytftvtatdgsg<-*
G+++ + ++++dgs
gi|1923609 2521 GtTSGIVISVSDGSA 2535
Alpha-L-AF_C: domain 1 of 2, from 2522 to 2543: score 2.8, E = 3
CS .SB---EEE.TT...EEEEEE-SSEE
*->vksfggakvaedvsggtltvtLPplS<-*
++s++ ++v +d g +++LP++S
gi|1923609 2522 TTSGIVISV-SD---GSASASLPAFS 2543
LEA_6: domain 2 of 4, from 2551 to 2558: score 1.6, E = 11
*->DAPTlSGa<-*
DAPT+SG+
gi|1923609 2551 DAPTISGT 2558
He_PIG: domain 6 of 12, from 2554 to 2580: score 5.0, E = 1.2
*->ritGtPtptvqpG.sytftvtatdgsg<-*
+i+GtP+++v +G +y+ft ta+d +
gi|1923609 2554 TISGTPATSVNQGaAYSFTPTASDIDV 2580
ATP-synt_ab: domain 2 of 3, from 2578 to 2585: score 0.2, E = 8.9
CS B-TTT-B-
RF xxxxxxxx
*->IDvllSvS<-*
IDv++S+S
gi|1923609 2578 IDVGDSLS 2585
He_PIG: domain 7 of 12, from 2585 to 2628: score 19.8, E = 7.7e-05
*->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
++++ + Ps+ +++ +tG ++GtP
gi|1923609 2585 SFSI-----------------ANMPSWASFNTATGELSGTPGND-DV 2613
G.sytftvtatdgsg<-*
G+++ + ++++dgs
gi|1923609 2614 GtTSGIVISVSDGSA 2628
Alpha-L-AF_C: domain 2 of 2, from 2615 to 2636: score 2.8, E = 3
CS .SB---EEE.TT...EEEEEE-SSEE
*->vksfggakvaedvsggtltvtLPplS<-*
++s++ ++v +d g +++LP++S
gi|1923609 2615 TTSGIVISV-SD---GSASASLPAFS 2636
LEA_6: domain 3 of 4, from 2644 to 2651: score 1.6, E = 11
*->DAPTlSGa<-*
DAPT+SG+
gi|1923609 2644 DAPTISGT 2651
He_PIG: domain 8 of 12, from 2647 to 2673: score 5.0, E = 1.2
*->ritGtPtptvqpG.sytftvtatdgsg<-*
+i+GtP+++v +G +y+ft ta+d +
gi|1923609 2647 TISGTPATSVNQGaAYSFTPTASDIDV 2673
ATP-synt_ab: domain 3 of 3, from 2671 to 2678: score 0.2, E = 8.9
CS B-TTT-B-
RF xxxxxxxx
*->IDvllSvS<-*
IDv++S+S
gi|1923609 2671 IDVGDSLS 2678
FSA_C: domain 1 of 1, from 2676 to 2730: score 3.6, E = 0.16
*->slanaiANgssAieiNesssekiaslskesvlsGtkssvtivvvdsd
sl+ +iAN+ s + N+++ e s+ ++ Gt s + i v d+d
gi|1923609 2676 SLSFSIANMPSWASFNTATGEL--SGTPGNDDVGTTSGIVISVSDGD 2720
lesqeGsPPtfDL<-*
s P+f+L
gi|1923609 2721 DSA---SLPAFNL 2730
He_PIG: domain 9 of 12, from 2678 to 2721: score 16.9, E = 0.00053
*->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
++++ + Ps+ +++ +tG ++GtP
gi|1923609 2678 SFSI-----------------ANMPSWASFNTATGELSGTPGND-DV 2706
G.sytftvtatdgsg<-*
G+++ + ++++dg
gi|1923609 2707 GtTSGIVISVSDGDD 2721
Peptidase_S13: domain 1 of 1, from 2763 to 2776: score -0.1, E = 7.2
CS CTTC-EEEEEEEEE
*->tdsGrklaFsfisN<-*
+++G++l+Fs+++
gi|1923609 2763 DADGDTLTFSIVNK 2776
He_PIG: domain 10 of 12, from 2770 to 2813: score 21.4, E = 2.7e-05
*->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
t+++ + Ps+ +++++tG ++GtPt +
gi|1923609 2770 TFSI-----------------VNKPSWASFNNATGELSGTPTNA-DV 2798
G.sytftvtatdgsg<-*
G++ + ++++dg
gi|1923609 2799 GtTNGIVISVSDGDE 2813
DUF1254: domain 1 of 1, from 2823 to 2850: score 4.4, E = 0.83
*->qflhfsrlpdpddtgvvtPNnDTlYSsa<-*
+++++++ p+ ++t+ ++ N+DT+YS++
gi|1923609 2823 TVVNVNDAPTISGTPGTSVNQDTVYSFS 2850
LEA_6: domain 4 of 4, from 2829 to 2836: score 1.6, E = 11
*->DAPTlSGa<-*
DAPT+SG+
gi|1923609 2829 DAPTISGT 2836
DUF1509: domain 1 of 1, from 2839 to 2855: score -1.3, E = 9.9
*->ttiRdltVLvsSseeed<-*
t + ++tV S+ ++d
gi|1923609 2839 TSVNQDTVYSFSPTASD 2855
Poty_coat: domain 1 of 1, from 2852 to 2866: score 0.0, E = 8.2
*->kDrDVnagtsGtfsv<-*
D+++g++ tfs+
gi|1923609 2852 TASDIDVGDTLTFSI 2866
He_PIG: domain 11 of 12, from 2863 to 2906: score 15.4, E = 0.0014
*->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
t+++ + P + +++ +tG ++GtPt +
gi|1923609 2863 TFSI-----------------ANKPGWASFNTTTGELSGTPTGA-DV 2891
G.sytftvtatdgsg<-*
G++ + ++++dg+
gi|1923609 2892 GtTIGIVISVSDGAL 2906
DUF1857: domain 1 of 1, from 2886 to 2906: score 1.8, E = 3.6
*->aTgehdGgsltntiEegedgsdaL<-*
+Tg+ G+++ ++i++ +dg aL
gi|1923609 2886 PTGADVGTTIGIVISV-SDG--AL 2906
Peptidase_C25_C: domain 1 of 1, from 2923 to 2938: score 1.3, E = 8
CS -B---EE--SEEETT-
*->PtkmqvTaPAsipqnq<-*
Pt TaPA i n+
gi|1923609 2923 PTQPVLTAPADIQVNA 2938
BCDHK_Adom3: domain 1 of 1, from 2943 to 2951: score 3.6, E = 0.83
*->tplSLrqll<-*
tp+SLrqll
gi|1923609 2943 TPISLRQLL 2951
PhageMin_Tail: domain 1 of 1, from 2947 to 2977: score 2.1, E = 4.3
*->lgkaAkelgattgfsaeeaaealeelsaqaGlsak<-*
l++ l+ + g s e +a+al++l a+ G++++
gi|1923609 2947 LRQL---LSLQAGASDETVAQALAAL-ASDGVNGN 2977
FerA: domain 1 of 1, from 2951 to 2969: score 2.7, E = 9
*->lAikAklpdeelaelwlkl<-*
l+++A+++de++a+ +++l
gi|1923609 2951 LSLQAGASDETVAQALAAL 2969
Alpha_adaptin_C: domain 1 of 1, from 2957 to 2969: score 3.5, E = 2.6
*->sTneaVsqtLlkl<-*
+++e+V+q+L+ l
gi|1923609 2957 ASDETVAQALAAL 2969
DUF2271: domain 1 of 1, from 2997 to 3012: score 1.2, E = 6.6
*->pGthalsfdgkddplk<-*
pG+h+l ++ ++ ++k
gi|1923609 2997 PGRHELTWTTSNSQGK 3012
Phage_DNA_bind: domain 1 of 1, from 3032 to 3043: score 1.7, E = 9
CS -EEEE-GGGSS-E
*->lkVeIksSqvavk<-*
V I++Sqv ++
gi|1923609 3032 -QVAIRDSQVEFR 3043
Ribonuc_red_2_N: domain 1 of 1, from 3077 to 3086: score 2.4, E = 2.5
*->dGsvvFEmkd<-*
dGsvvF +k+
gi|1923609 3077 DGSVVFTQKG 3086
PGAMP: domain 1 of 1, from 3084 to 3095: score 3.1, E = 5.1
*->kkaQsqnSrrav<-*
+k+Q+q S +++
gi|1923609 3084 QKGQTQISVPVT 3095
PKD: domain 4 of 5, from 3150 to 3172: score 2.7, E = 2.7
CS EESS.....SSSEBTTEEEEEEECT.B.TT.SSECE
*->vsasaveegpsvvalgetVtFtassSydpdpGspvs<-*
v++s g +Vt+ta + +dp+ +++++
gi|1923609 3150 VTPS-----------GGPVTVTAVV-TDPN-PNDTH 3172
HATPase_c: domain 1 of 1, from 3151 to 3215: score 1.8, E = 6.3
CS HHHCSEEEEEEEEET
*->apaggeitvrlerdg................................
+p+gg +tv++ ++++++++++ + + +++ +++++++ + + +
gi|1923609 3151 TPSGGPVTVTAVVTDpnpndthsfdwsatrglpdtdgnpvdaarvfd 3197
CS TEEEEEEEESS
.......drlritVeDnG<-*
+ + ++++ +++tV+D+G
gi|1923609 3198 paglsgsHSVVVTVTDSG 3215
Lamp: domain 1 of 1, from 3157 to 3174: score 0.4, E = 7
*->YsvteltfsynlsDttlF<-*
++vt++++ n++Dt+ F
gi|1923609 3157 VTVTAVVTDPNPNDTHSF 3174
FlaE: domain 2 of 2, from 3196 to 3225: score 3.5, E = 1.6
*->fdpadpatynystsvtvYDSlGnkhtlqvyF<-*
fdpa+ ++ ++s+ vtv DS+G + + q yF
gi|1923609 3196 FDPAGLSG-SHSVVVTVTDSGGASTQAQTYF 3225
He_PIG: domain 12 of 12, from 3203 to 3216: score 4.3, E = 2
*->Gsytftvtatdgsg<-*
Gs ++ vt+td++g
gi|1923609 3203 GSHSVVVTVTDSGG 3216
PKD: domain 5 of 5, from 3203 to 3227: score 9.1, E = 0.029
CS EEEEEEEEEEETTCEEEEEEEEEEE
*->GtYtVtLtvsngvgsasattttvtV<-*
G+++V +tv+++ g++++ +t++ +
gi|1923609 3203 GSHSVVVTVTDSGGASTQAQTYFRI 3227
AIG2: domain 1 of 1, from 3207 to 3227: score 3.3, E = 1.1
CS EEEEEE----SEE.EEEEEEES
*->veveVelgdgeevveAwvYvya<-*
v v+V++ +g+++ +A++Y+
gi|1923609 3207 VVVTVTDSGGAST-QAQTYFRI 3227
DUF824: domain 1 of 1, from 3207 to 3227: score 4.1, E = 4.1
*->ltVTvKDaaGn.PvpnvpFtL<-*
++VTv+D+ G + ++ ++F +
gi|1923609 3207 VVVTVTDSGGAsTQAQTYFRI 3227
Binary_toxB: domain 1 of 1, from 3237 to 3248: score 2.5, E = 0.88
*->dlDtDnDgIPDl<-*
d+DtD+DgI Dl
gi|1923609 3237 DVDTDGDGISDL 3248
TSP_3: domain 1 of 1, from 3238 to 3252: score 3.7, E = 6.6
CS --TT-SSS-..GGGS
*->eDsDnDgvgdnDaCd<-*
D+D+Dg+ d D+
gi|1923609 3238 VDTDGDGISDLDEGA 3252
Collar: domain 1 of 1, from 3256 to 3268: score 2.2, E = 9.1
CS SB.B--B-TTXXX
*->ptfglPDLRGrFv<-*
+++g+P++ + +
gi|1923609 3256 NGNGIPNYLDNMP 3268
DUF1343: domain 1 of 1, from 3276 to 3282: score 0.1, E = 6.2
*->VGLITNq<-*
VGLITN+
gi|1923609 3276 VGLITNA 3282
Apocytochr_F_C: domain 2 of 2, from 3379 to 3386: score 1.7, E = 4.8
CS SSS--B-S
*->NNnvynAs<-*
NN+vy+A+
gi|1923609 3379 NNAVYSAP 3386
Pneumo_ncap: domain 1 of 1, from 3412 to 3422: score 0.7, E = 3.4
*->qLNikDedsed<-*
qLNi+D +++d
gi|1923609 3412 QLNIEDGGPND 3422
Alginate_lyase: domain 1 of 1, from 3474 to 3500: score 2.1, E = 1.4
CS XXXXXXXXXXXXXXXXXXXXXXSTTTT--
*->mhfrRlalpaLlalallaslqaaasaaas<-*
m r+ + +L lall+s +++ +aa++
gi|1923609 3474 M-TRKVSTKTLVVLALLVS-AMTSQAAQD 3500
CopC: domain 1 of 1, from 3474 to 3497: score 1.2, E = 6.5
CS XXXXXXXXXXXXX..XXXXXXX XXXX
*->MlsalrklaklllvLalsLvas.sAfA<-*
M ++ +k+l+vLal+ v++ +++A
gi|1923609 3474 MT--RKVSTKTLVVLALL-VSAmTSQA 3497
RepA1_leader: domain 1 of 1, from 3474 to 3496: score 3.4, E = 5.9
*->mlrKlqylfLchlLLpCivsAgrcD<-*
m rK+ L+ l L vsA +
gi|1923609 3474 MTRKVSTKTLVVLALL--VSAMTSQ 3496
DUF2501: domain 1 of 1, from 3481 to 3499: score 1.6, E = 0.86
*->aglLlaalLasallasvAh<-*
+ l++ alL+sa+++ +A+
gi|1923609 3481 KTLVVLALLVSAMTSQAAQ 3499
OprD: domain 1 of 1, from 3482 to 3501: score 1.1, E = 3.1
*->rlaalalallaglpalAlqsasaqad<-*
+l++lal+++a+++++A q++
gi|1923609 3482 TLVVLALLVSAMTSQAA------QDK 3501
CNPase: domain 1 of 1, from 3493 to 3502: score 2.1, E = 2.1
CS XXXXXXXXXX
*->MsaqaakdkP<-*
M +qaa+dkP
gi|1923609 3493 MTSQAAQDKP 3502
Transketolase_N: domain 1 of 1, from 3500 to 3511: score -0.6, E = 8.4
CS --TT--HHHHHH
*->akpFeIPqeVYd<-*
+kpF++++++Yd
gi|1923609 3500 DKPFYVRADIYD 3511
HMA: domain 1 of 1, from 3509 to 3534: score 2.3, E = 6.5
CS EESTTTSCHHH HHHHHHHTTSEEEE
*->tgdedlpklkk.lveaveiigydarl<-*
++d+ +++ k++ +a+e++gy+++l
gi|1923609 3509 IYDVNSTVTKQdFRQALEDAGYEVTL 3534
Wound_ind: domain 1 of 1, from 3509 to 3514: score 1.0, E = 9.5
*->miYDvns<-*
iYDvns
gi|1923609 3509 -IYDVNS 3514
YadA: domain 1 of 1, from 3542 to 3552: score 6.2, E = 0.23
*->vgagaGvGYqW<-*
+g+ ++vGYqW
gi|1923609 3542 TGYQISVGYQW 3552
DUF1513: domain 1 of 1, from 3549 to 3559: score 1.3, E = 4.6
*->gvaWDNHlvrl<-*
g++WD+H+ +
gi|1923609 3549 GYQWDQHWFSE 3559
MetW: domain 1 of 1, from 3613 to 3623: score 0.5, E = 9.4
*->NffGeqavFll<-*
N++Ge++++l
gi|1923609 3613 NLLGEIGIYLW 3623
Imp-YgjV: domain 1 of 1, from 3661 to 3674: score 2.1, E = 5
*->lvtiYRlyrdkkrp<-*
+v+i R+y+d++++
gi|1923609 3661 GVGIRRIYFDQQQA 3674
//