hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            192360952.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|192360952|ref|YP_001981111.1|
Accession:      [none]
Description:    Putative Ig domain family [Cellvibrio japonicus Ueda107]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
He_PIG          Putative Ig domain                      129.5    5.5e-36  12
Chlam_PMP       Chlamydia polymorphic membrane protei    36.4    1.2e-08   6
PKD             PKD domain                               21.3    5.4e-06   5
HYR             HYR domain                               13.4     0.0023   1
FG-GAP          FG-GAP repeat                            14.8     0.0024   1
A2M_N_2         Alpha-2-macroglobulin family N-termin    11.2      0.017   1
Cna_B           Cna protein B-type domain                 7.4      0.096   2
FSA_C           Fragile site-associated protein C-ter     3.6       0.16   1
YadA            YadA-like C-terminal region               6.2       0.23   1
FlaE            Flagellar basal body protein FlaE         6.0       0.27   2
HET             Heterokaryon incompatibility protein      3.3       0.31   1
Big_2           Bacterial Ig-like domain (group 2)        6.4       0.36   1
GBP_C           Guanylate-binding protein, C-terminal     4.4       0.43   2
SUN             Beta-glucosidase (SUN family)             3.9       0.48   1
Alpha-L-AF_C    Alpha-L-arabinofuranosidase C-terminu     5.5       0.55   2
LEA_6           Late embryogenesis abundant protein 1     6.2       0.61   4
DUF1254         Protein of unknown function (DUF1254)     4.4       0.83   1
BCDHK_Adom3     Mitochondrial branched-chain alpha-ke     3.6       0.83   1
DUF2501         Protein of unknown function (DUF2501)     1.6       0.86   1
Binary_toxB     Clostridial binary toxin B/anthrax to     2.5       0.88   1
META            META domain                               5.9       0.91   1
AIG2            AIG2-like family                          3.3        1.1   1
Ribosomal_L3    Ribosomal protein L3                      3.0        1.1   1
Apocytochr_F_C  Apocytochrome F, C-terminal               3.6        1.4   2
Alginate_lyase  Alginate lyase                            2.1        1.4   1
DUF461          Protein of unknown function (DUF461)      4.1        1.5   1
CD34_antigen    CD34/Podocalyxin family                   2.8        1.7   1
Tn916-Xis       Excisionase from transposon Tn916         3.5        1.8   6
CNPase          2',3'-cyclic nucleotide 3'-phosphodie     2.1        2.1   1
Ribonuc_red_2_N Class II vitamin B12-dependent ribonu     2.4        2.5   1
Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain      3.5        2.6   1
DUF802          Domain of unknown function (DUF802)       4.3          3   1
OprD            outer membrane porin, OprD family         1.1        3.1   1
Pneumo_ncap     Pneumovirus nucleocapsid protein          0.7        3.4   1
DUF1857         Domain of unknown function (DUF1857)      1.8        3.6   1
Herpes_U47      Herpesvirus glycoprotein U47             -0.5        3.8   1
Y_Y_Y           Y_Y_Y domain                              2.9        3.9   1
Ydc2-catalyt    Mitochondrial resolvase Ydc2, catalyt     0.1          4   1
DUF824          Salmonella repeat of unknown function     4.1        4.1   1
Cecropin        Cecropin family                           4.1        4.2   2
Secretin_N_2    Secretin N-terminal domain                2.2        4.2   1
PhageMin_Tail   Phage-related minor tail protein          2.1        4.3   1
CBM_6           Carbohydrate binding module (family 6     1.6        4.3   1
PGI             Phosphoglucose isomerase                  0.8        4.4   1
Pneumo_NS1      Pneumovirus NS1 protein                   1.6        4.6   1
DUF1513         Protein of unknown function (DUF1513)     1.3        4.6   1
E1_DerP2_DerF2  ML domain                                 1.7        4.7   1
I-set           Immunoglobulin I-set domain               2.7        4.8   2
Imp-YgjV        Bacterial inner membrane protein          2.1          5   1
Ephrin_lbd      Ephrin receptor ligand binding domain     1.3          5   1
PGAMP           Planctomycete PGAMP                       3.1        5.1   1
L27_N           L27_N                                     2.9        5.3   1
CDK2AP          Cyclin-dependent kinase 2-associated      1.2        5.4   1
SurA_N          SurA N-terminal domain                    1.4        5.6   1
RepA1_leader    Tap RepA1 leader peptide                  3.4        5.9   1
FliX            Class II flagellar assembly regulator     0.3        6.1   1
DUF1343         Protein of unknown function (DUF1343)     0.1        6.2   1
HATPase_c       Histidine kinase-, DNA gyrase B-, and     1.8        6.3   1
MIF             Macrophage migration inhibitory facto     1.3        6.4   1
ATP-synt_ab     ATP synthase alpha/beta family, nucle     0.7        6.4   3
GreA_GreB       Prokaryotic transcription elongation      2.5        6.5   1
CopC            Copper resistance protein CopC            1.2        6.5   1
HMA             Heavy-metal-associated domain             2.3        6.5   1
DUF2271         Predicted periplasmic protein (DUF227     1.2        6.6   1
DUF1110         Protein of unknown function (DUF1110)     0.4        6.6   1
TSP_3           Thrombospondin type 3 repeat              3.7        6.6   1
FTP             Fungalysin/Thermolysin Propeptide Mot     2.7        6.7   3
DUF2134         Predicted membrane protein (DUF2134)      1.6        6.8   2
Lamp            Lysosome-associated membrane glycopro     0.4          7   1
NEAT            Iron Transport-associated domain          1.8          7   1
Snf7            Snf7                                      1.1        7.1   1
Peptidase_S13   D-Ala-D-Ala carboxypeptidase 3 (S13)     -0.1        7.2   1
DUF1927         Domain of unknown function (DUF1927)      2.3        7.5   1
Peptidase_C25_C Peptidase family C25, C terminal ig-l     1.3          8   1
TetR_C_4        YsiA-like protein, C-terminal region      1.4        8.1   1
RIP             Ribosome inactivating protein             0.2        8.2   1
Poty_coat       Potyvirus coat protein                    0.0        8.2   1
DUF1521         Domain of Unknown Function (DUF1521)     -0.4        8.2   1
Pyr_redox_2     Pyridine nucleotide-disulphide oxidor     0.1        8.3   1
Transketolase_N Transketolase, thiamine diphosphate b    -0.6        8.4   1
eIF-6           eIF-6 family                              0.1          9   1
Phage_DNA_bind  Helix-destabilising protein               1.7          9   1
FerA            FerA (NUC095) domain                      2.7          9   1
Collar          Phage Tail Collar Domain                  2.2        9.1   1
Big_1           Bacterial Ig-like domain (group 1)        0.6        9.2   1
MetW            Methionine biosynthesis protein MetW      0.5        9.4   1
CfAFP           Choristoneura fumiferana antifreeze p     0.2        9.5   1
Wound_ind       Wound-inducible basic protein family      1.0        9.5   1
SLAP            Bacterial surface layer protein          -1.6        9.5   1
DUF1509         Protein of unknown function (DUF1509)    -1.3        9.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
DUF802            1/1     152   169 ..    41    58 .]     4.3        3
SurA_N            1/1     154   162 ..   129   137 .]     1.4      5.6
HET               1/1     250   260 ..     1    11 [.     3.3     0.31
Secretin_N_2      1/1     277   291 ..    92   107 .]     2.2      4.2
FlaE              1/2     291   361 ..    47   102 .]     2.5        3
Ephrin_lbd        1/1     388   400 ..   165   177 .]     1.3        5
SUN               1/1     425   455 ..     1    31 [.     3.9     0.48
FTP               1/3     440   461 ..     1    20 [.     0.6       29
Chlam_PMP         1/6     466   483 ..     5    19 .]     0.3       87
Tn916-Xis         1/6     484   497 ..    12    25 ..     0.6       13
FTP               2/3     540   561 ..     1    20 [.     0.7       25
Tn916-Xis         2/6     584   597 ..    12    25 ..     0.6       13
FTP               3/3     640   661 ..     1    20 [.     1.4       16
Tn916-Xis         3/6     684   697 ..    12    25 ..     0.6       13
Tn916-Xis         4/6     784   797 ..    12    25 ..     0.6       13
Tn916-Xis         5/6     884   897 ..    12    25 ..     0.6       13
Tn916-Xis         6/6     984   997 ..    12    25 ..     0.6       13
PKD               1/5     997  1016 ..    72    92 .]     1.4      6.6
L27_N             1/1    1009  1020 ..    38    49 .]     2.9      5.3
CBM_6             1/1    1052  1075 ..    46    68 ..     1.6      4.3
CfAFP             1/1    1075  1083 ..   130   138 .]     0.2      9.5
NEAT              1/1    1084  1095 ..     1    12 [.     1.8        7
Y_Y_Y             1/1    1088  1116 ..    38    69 .]     2.9      3.9
He_PIG            1/12   1089  1104 ..    46    61 .]     0.6       23
Big_2             1/1    1119  1143 ..     1    27 [.     6.4     0.36
I-set             1/2    1121  1141 ..     1    21 [.     1.3       12
A2M_N_2           1/1    1123  1143 ..     1    21 [.    11.2    0.017
DUF461            1/1    1129  1149 ..    87   109 ..     4.1      1.5
DUF1927           1/1    1130  1142 ..    10    22 ..     2.3      7.5
E1_DerP2_DerF2    1/1    1132  1159 ..    94   120 ..     1.7      4.7
Pyr_redox_2       1/1    1151  1161 ..   275   285 .]     0.1      8.3
GBP_C             1/2    1154  1166 ..     1    13 [.     0.5      5.5
Snf7              1/1    1217  1226 ..   188   197 .]     1.1      7.1
DUF2134           1/2    1242  1255 ..   103   115 .]     0.8       12
PKD               2/5    1247  1314 ..     1    92 []     0.9      9.9
Cna_B             1/2    1255  1291 ..     2    36 ..     6.7     0.16
GreA_GreB         1/1    1256  1268 ..    10    22 ..     2.5      6.5
HYR               1/1    1284  1316 ..    54    86 .]    13.4   0.0023
Cecropin          1/2    1322  1332 ..    21    31 .]     4.1      4.2
DUF1110           1/1    1351  1372 ..   180   203 .]     0.4      6.6
CDK2AP            1/1    1363  1382 ..   180   199 .]     1.2      5.4
TetR_C_4          1/1    1388  1403 ..   118   133 .]     1.4      8.1
He_PIG            2/12   1447  1469 ..     1    23 [.     0.5       24
FliX              1/1    1463  1487 ..     1    30 [.     0.3      6.1
GBP_C             2/2    1468  1477 ..     1    10 [.     3.8     0.61
PKD               3/5    1496  1521 ..    67    92 .]     7.2     0.12
eIF-6             1/1    1540  1552 ..     1    14 [.     0.1        9
Big_1             1/1    1563  1590 ..     1    30 [.     0.6      9.2
DUF2134           2/2    1577  1593 ..    94   115 .]     0.8       12
DUF1521           1/1    1592  1609 ..   158   175 .]    -0.4      8.2
RIP               1/1    1680  1692 ..     1    17 [.     0.2      8.2
MIF               1/1    1685  1700 ..   100   115 .]     1.3      6.4
FG-GAP            1/1    1717  1738 ..     8    36 .]    14.8   0.0024
Ydc2-catalyt      1/1    1737  1746 ..     1    10 [.     0.1        4
Chlam_PMP         2/6    1777  1796 ..     1    19 []    11.0      0.1
Chlam_PMP         3/6    1804  1822 ..     1    19 []     8.5     0.52
Cna_B             2/2    1822  1843 ..     1    21 [.     0.7       11
Chlam_PMP         4/6    1831  1849 ..     1    19 []     6.0      2.4
Cecropin          2/2    1844  1859 ..    16    31 .]     0.0       60
Chlam_PMP         5/6    1857  1878 ..     1    19 []     6.7      1.6
Herpes_U47        1/1    1876  1896 ..   658   678 .]    -0.5      3.8
Chlam_PMP         6/6    1886  1904 ..     1    19 []     3.9      8.8
CD34_antigen      1/1    2070  2080 ..   209   219 .]     2.8      1.7
PGI               1/1    2125  2142 ..   496   513 .]     0.8      4.4
Apocytochr_F_C    1/2    2130  2153 ..     1    24 [.     1.9      4.3
I-set             2/2    2190  2201 ..    85    96 .]     1.4       11
META              1/1    2223  2252 ..    82   105 .]     5.9     0.91
Pneumo_NS1        1/1    2249  2264 ..   121   136 .]     1.6      4.6
SLAP              1/1    2281  2295 ..     1    15 [.    -1.6      9.5
Ribosomal_L3      1/1    2325  2335 ..   288   298 .]     3.0      1.1
He_PIG            3/12   2399  2442 ..     1    61 []    15.9    0.001
LEA_6             1/4    2458  2465 ..    56    63 ..     1.6       11
He_PIG            4/12   2461  2487 ..    36    61 .]     5.0      1.2
ATP-synt_ab       1/3    2485  2492 ..   204   211 .]     0.2      8.9
He_PIG            5/12   2492  2535 ..     1    61 []    19.8  7.7e-05
Alpha-L-AF_C      1/2    2522  2543 ..   200   225 .]     2.8        3
LEA_6             2/4    2551  2558 ..    56    63 ..     1.6       11
He_PIG            6/12   2554  2580 ..    36    61 .]     5.0      1.2
ATP-synt_ab       2/3    2578  2585 ..   204   211 .]     0.2      8.9
He_PIG            7/12   2585  2628 ..     1    61 []    19.8  7.7e-05
Alpha-L-AF_C      2/2    2615  2636 ..   200   225 .]     2.8        3
LEA_6             3/4    2644  2651 ..    56    63 ..     1.6       11
He_PIG            8/12   2647  2673 ..    36    61 .]     5.0      1.2
ATP-synt_ab       3/3    2671  2678 ..   204   211 .]     0.2      8.9
FSA_C             1/1    2676  2730 ..   603   662 ..     3.6     0.16
He_PIG            9/12   2678  2721 ..     1    61 []    16.9  0.00053
Peptidase_S13     1/1    2763  2776 ..   386   399 .]    -0.1      7.2
He_PIG           10/12   2770  2813 ..     1    61 []    21.4  2.7e-05
DUF1254           1/1    2823  2850 ..    34    61 ..     4.4     0.83
LEA_6             4/4    2829  2836 ..    56    63 ..     1.6       11
DUF1509           1/1    2839  2855 ..   404   420 .]    -1.3      9.9
Poty_coat         1/1    2852  2866 ..     1    15 [.     0.0      8.2
He_PIG           11/12   2863  2906 ..     1    61 []    15.4   0.0014
DUF1857           1/1    2886  2906 ..    96   119 ..     1.8      3.6
Peptidase_C25_C   1/1    2923  2938 ..     1    16 [.     1.3        8
BCDHK_Adom3       1/1    2943  2951 ..     1     9 [.     3.6     0.83
PhageMin_Tail     1/1    2947  2977 ..     1    35 [.     2.1      4.3
FerA              1/1    2951  2969 ..     1    19 [.     2.7        9
Alpha_adaptin_C   1/1    2957  2969 ..   102   114 .]     3.5      2.6
DUF2271           1/1    2997  3012 ..    86   101 ..     1.2      6.6
Phage_DNA_bind    1/1    3032  3043 ..     1    13 [.     1.7        9
Ribonuc_red_2_N   1/1    3077  3086 ..     1    10 [.     2.4      2.5
PGAMP             1/1    3084  3095 ..    24    35 .]     3.1      5.1
PKD               4/5    3150  3172 ..     1    36 [.     2.7      2.7
HATPase_c         1/1    3151  3215 ..    21    46 ..     1.8      6.3
Lamp              1/1    3157  3174 ..     1    18 [.     0.4        7
FlaE              2/2    3196  3225 ..     1    31 [.     3.5      1.6
He_PIG           12/12   3203  3216 ..    48    61 .]     4.3        2
PKD               5/5    3203  3227 ..    68    92 .]     9.1    0.029
AIG2              1/1    3207  3227 ..    98   119 .]     3.3      1.1
DUF824            1/1    3207  3227 ..    17    36 ..     4.1      4.1
Binary_toxB       1/1    3237  3248 ..     1    12 [.     2.5     0.88
TSP_3             1/1    3238  3252 ..     1    15 []     3.7      6.6
Collar            1/1    3256  3268 ..    45    57 .]     2.2      9.1
DUF1343           1/1    3276  3282 ..     1     7 [.     0.1      6.2
Apocytochr_F_C    2/2    3379  3386 ..     1     8 [.     1.7      4.8
Pneumo_ncap       1/1    3412  3422 ..   382   392 .]     0.7      3.4
Alginate_lyase    1/1    3474  3500 ..     1    29 [.     2.1      1.4
CopC              1/1    3474  3497 ..     1    26 [.     1.2      6.5
RepA1_leader      1/1    3474  3496 ..     1    25 []     3.4      5.9
DUF2501           1/1    3481  3499 ..     1    19 [.     1.6     0.86
OprD              1/1    3482  3501 ..     1    26 [.     1.1      3.1
CNPase            1/1    3493  3502 ..     1    10 [.     2.1      2.1
Transketolase_N   1/1    3500  3511 ..   284   295 ..    -0.6      8.4
HMA               1/1    3509  3534 ..    40    64 .]     2.3      6.5
Wound_ind         1/1    3509  3514 ..     1     7 [.     1.0      9.5
YadA              1/1    3542  3552 ..    70    80 .]     6.2     0.23
DUF1513           1/1    3549  3559 ..   306   316 .]     1.3      4.6
MetW              1/1    3613  3623 ..   185   195 .]     0.5      9.4
Imp-YgjV          1/1    3661  3674 ..   154   167 .]     2.1        5

Alignments of top-scoring domains:
DUF802: domain 1 of 1, from 152 to 169: score 4.3, E = 3
                   *->aaLeqfAqtFeqrsaaLl<-*
                      a+L q  +tF ++++aL+
  gi|1923609   152    AMLKQEVETFAALQGALV    169

SurA_N: domain 1 of 1, from 154 to 162: score 1.4, E = 5.6
                   *->sdqEVdnfL<-*
                      ++qEV++f+
  gi|1923609   154    LKQEVETFA    162

HET: domain 1 of 1, from 250 to 260: score 3.3, E = 0.31
                   *->YitLSYvWGdp<-*
                      Y  LS +WG++
  gi|1923609   250    YNSLSFCWGPA    260

Secretin_N_2: domain 1 of 1, from 277 to 291: score 2.2, E = 4.2
                   *->LtaPgdGryslStsta<-*
                      Lt ++dGr +l++s a
  gi|1923609   277    LT-SQDGRIVLTASPA    291

FlaE: domain 1 of 2, from 291 to 361: score 2.5, E = 3
                   *->vtvydtdd........LtFD.snG..ttitsanvggaapvsitLdl.
                      + v++++++ + + + +t + s+G ++ ++++  +ga+  ++tL+
  gi|1923609   291    AAVLSSGPnwgagyslITQNaSAGqnSGWIEFSADGANLSAFTLSSv 337

                   ...lTqfag.stfstvsavsa.Q.DGy<-*
                   +++ T + +  +   v+++  +Q+DG
  gi|1923609   338 trgYTMYEScTS---VTVTGTrQsDGT    361

Ephrin_lbd: domain 1 of 1, from 388 to 400: score 1.3, E = 5
                   *->iALvSVRVFYKKC<-*
                      iAL SVRV +  C
  gi|1923609   388    IALTSVRVSFNSC    400

SUN: domain 1 of 1, from 425 to 455: score 3.9, E = 0.48
                   *->tsvlsStaasattssAAssatsSssedsase<-*
                       +vl S +++at+  A s++t+   + + ++
  gi|1923609   425    NTVLPSISGTATVGNALSTTTGTWTDADGDS    455

FTP: domain 1 of 3, from 440 to 461: score 0.6, E = 29
                   *->dlkvv.ktttdpnGk.thvRfq<-*
                       l+ +++t+td++G++  +++q
  gi|1923609   440    ALSTTtGTWTDADGDsLTYTYQ    461

Chlam_PMP: domain 1 of 6, from 466 to 483: score 0.3, E = 87
                   *->sgNsa...aggGGAiyas<-*
                      ++Ns+++ a+ GGA++as
  gi|1923609   466    DNNSGtnlAAIGGATSAS    483

Tn916-Xis: domain 1 of 6, from 484 to 497: score 0.6, E = 13
                CS    SEEEHHHHHHHT--
                   *->YtLtiEEAsKYFRi<-*
                      YtLt  +A KY R+
  gi|1923609   484    YTLTTSDAHKYLRV    497

FTP: domain 2 of 3, from 540 to 561: score 0.7, E = 25
                   *->dlkvv.ktttdpnGk.thvRfq<-*
                       l+ +++t+td++G++  +++q
  gi|1923609   540    ALSTTnGTWTDADGDsLTYTYQ    561

Tn916-Xis: domain 2 of 6, from 584 to 597: score 0.6, E = 13
                CS    SEEEHHHHHHHT--
                   *->YtLtiEEAsKYFRi<-*
                      YtLt  +A KY R+
  gi|1923609   584    YTLTTSDAHKYLRV    597

FTP: domain 3 of 3, from 640 to 661: score 1.4, E = 16
                   *->dlkvv.ktttdpnGk.thvRfq<-*
                       l+ +++++td++G+++ +++q
  gi|1923609   640    ALSTTdGSWTDADGDsRTYTYQ    661

Tn916-Xis: domain 3 of 6, from 684 to 697: score 0.6, E = 13
                CS    SEEEHHHHHHHT--
                   *->YtLtiEEAsKYFRi<-*
                      YtLt  +A KY R+
  gi|1923609   684    YTLTTSDAHKYLRV    697

Tn916-Xis: domain 4 of 6, from 784 to 797: score 0.6, E = 13
                CS    SEEEHHHHHHHT--
                   *->YtLtiEEAsKYFRi<-*
                      YtLt  +A KY R+
  gi|1923609   784    YTLTTSDAHKYLRV    797

Tn916-Xis: domain 5 of 6, from 884 to 897: score 0.6, E = 13
                CS    SEEEHHHHHHHT--
                   *->YtLtiEEAsKYFRi<-*
                      YtLt  +A KY R+
  gi|1923609   884    YTLTTSDAHKYLRV    897

Tn916-Xis: domain 6 of 6, from 984 to 997: score 0.6, E = 13
                CS    SEEEHHHHHHHT--
                   *->YtLtiEEAsKYFRi<-*
                      YtLt  +A KY R+
  gi|1923609   984    YTLTTSDAHKYLRV    997

PKD: domain 1 of 5, from 997 to 1016: score 1.4, E = 6.6
                CS    EEEEEEETTCEEEEEEEEEEE
                   *->VtLtvsngvgsasattttvtV<-*
                      V +t+++g+g + +  t+++
  gi|1923609   997    VEVTANDGNGGTQTA-TSIYT    1016

L27_N: domain 1 of 1, from 1009 to 1020: score 2.9, E = 5.3
                   *->qaAfsihnAVAq<-*
                      q A si+ AVA
  gi|1923609  1009    QTATSIYTAVAN    1020

CBM_6: domain 1 of 1, from 1052 to 1075: score 1.6, E = 4.3
                CS    SEEEEEEEEEEESSSE. .EEEEE
                   *->ggaysftarvAnggggg.ggsiei<-*
                      +++ +ft+++A+g+g +++gs++i
  gi|1923609  1052    DADTTFTYSFATGAGDTdNGSFNI    1075

CfAFP: domain 1 of 1, from 1075 to 1083: score 0.2, E = 9.5
                CS    EES-EEEE-
                   *->isGCtlrAn<-*
                      isG +lrAn
  gi|1923609  1075    ISGSSLRAN    1083

NEAT: domain 1 of 1, from 1084 to 1095: score 1.8, E = 7
                   *->asnnLadGtYtI<-*
                      +s++La GtY++
  gi|1923609  1084    DSSTLAAGTYSV    1095

Y_Y_Y: domain 1 of 1, from 1088 to 1116: score 2.9, E = 3.9
                   *->LppGkYtikvkakdkdgnwsyddiasltftvl<-*
                      L +G+Y ++++++d ++   +d  + +t+t+
  gi|1923609  1088    LAAGTYSVLIRTTD-SFAGVFD--KAFTITIV    1116

He_PIG: domain 1 of 12, from 1089 to 1104: score 0.6, E = 23
                   *->qpGsytftvtatdgsg<-*
                      ++G+y++ +  td++
  gi|1923609  1089    AAGTYSVLIRTTDSFA    1104

Big_2: domain 1 of 1, from 1119 to 1143: score 6.4, E = 0.36
                CS    EEEEEEETTT.TEEES--SEEETTSEE
                   *->avtsvtvsptgntaslakGatlqlkat<-*
                         ++t+ ++  +asl++G+t +l+ t
  gi|1923609  1119    ISPTITIGSD--KASLKAGETATLTLT    1143

I-set: domain 1 of 2, from 1121 to 1141: score 1.3, E = 12
                CS    -EEEE--EEEEEETTCEEEEE
                   *->PkFtqkpkdveVqeGesarFe<-*
                      P++t+    +  + Ge+a+++
  gi|1923609  1121    PTITIGSDKASLKAGETATLT    1141

A2M_N_2: domain 1 of 1, from 1123 to 1143: score 11.2, E = 0.017
                   *->LklsldkkeykvGetakvtvt<-*
                      + +  dk+++k+Geta++t+t
  gi|1923609  1123    ITIGSDKASLKAGETATLTLT    1143

DUF461: domain 1 of 1, from 1129 to 1149: score 4.1, E = 1.5
                CS    -S---TTCEEEEEE--TTT..--
                   *->kqpLkeGdtVplTLtFedgGrgt<-*
                      k+ Lk+G+t +lTLt + +  ++
  gi|1923609  1129    KASLKAGETATLTLTLSEA--SS    1149

DUF1927: domain 1 of 1, from 1130 to 1142: score 2.3, E = 7.5
                CS    SEEETTCEEEEEE
                   *->afLkaGeeteltL<-*
                      a+LkaGe+++ltL
  gi|1923609  1130    ASLKAGETATLTL    1142

E1_DerP2_DerF2: domain 1 of 1, from 1132 to 1159: score 1.7, E = 4.7
                CS    B-TTSEEEEEEEE E-STTS-TTEEEEE
                   *->lkkGetvtytlsl.pipkeyPpgkytVe<-*
                      lk+Get t+tl+l++  + +  g++tV+
  gi|1923609  1132    LKAGETATLTLTLsEASSDFAAGDVTVT    1159

Pyr_redox_2: domain 1 of 1, from 1151 to 1161: score 0.1, E = 8.3
                CS    EECGGGGCESS
                RF    xxxxxxxxxxx
                   *->yAaGDvaeggp<-*
                      +AaGDv+  g
  gi|1923609  1151    FAAGDVTVTGG    1161

GBP_C: domain 1 of 2, from 1154 to 1166: score 0.5, E = 5.5
                   *->GGiiVTGprLatL<-*
                      G+++VTG  L ++
  gi|1923609  1154    GDVTVTGGTLSGF    1166

Snf7: domain 1 of 1, from 1217 to 1226: score 1.1, E = 7.1
                   *->eLPsvPsgel<-*
                      eLP++Ps+++
  gi|1923609  1217    ELPDAPSTPV    1226

DUF2134: domain 1 of 2, from 1242 to 1255: score 0.8, E = 12
                   *->l.ppsrtlsAtAtA<-*
                      ++++++t++ tA A
  gi|1923609  1242    TnNTTPTITGTAEA    1255

PKD: domain 2 of 5, from 1247 to 1314: score 0.9, E = 9.9
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS.SSS
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdFGDggsp
                      ++ +      +++++g tVt+ +++      Gs        G    +
  gi|1923609  1247    PTIT------GTAEAGSTVTLYDTD------GST-----VLGT---T 1273

                CS EEEECSSEEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
                   gttstepnvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-*
                   + t+++ ++t + ++    +G++++t t+++++g++s+ ++ +t+
  gi|1923609  1274 TATGGNWSITTSALS----EGDHDLTATATDAAGNVSVASAALTI    1314

Cna_B: domain 1 of 2, from 1255 to 1291: score 6.7, E = 0.16
                CS    TT-EEEEEETTEEE      E--TTSEEEEEEE....-SEE
                   *->eGAeftLldkdgnv......tTdenGkytftnLPKykppGd<-*
                      +G ++tL+d dg++  ++++ T+ n+++t   L    ++Gd
  gi|1923609  1255    AGSTVTLYDTDGSTvlgtttATGGNWSITTSAL----SEGD    1291

GreA_GreB: domain 1 of 1, from 1256 to 1268: score 2.5, E = 6.5
                   *->GatVeiyNdDsde<-*
                      G+tV++y++D+++
  gi|1923609  1256    GSTVTLYDTDGST    1268

HYR: domain 1 of 1, from 1284 to 1316: score 13.4, E = 0.0023
                   *->GdfFpvGEettVtYtatDnaGN..eAdsCtFtVtV<-*
                      ++ +++G +++ t+tatD+aGN + A s  +t+t+
  gi|1923609  1284    TSALSEG-DHDLTATATDAAGNvsVA-SAALTITI    1316

Cecropin: domain 1 of 2, from 1322 to 1332: score 4.1, E = 4.2
                   *->AkPAvkviaqa<-*
                      AkPA++v+a+a
  gi|1923609  1322    AKPAAPVLATA    1332

DUF1110: domain 1 of 1, from 1351 to 1372: score 0.4, E = 6.6
                   *->LeAAIGnaelGtelAvdARqDVSg<-*
                      L++A+G +e  +   v AR DV g
  gi|1923609  1351    LQGAVGSVE--ANAIVHARSDVEG    1372

CDK2AP: domain 1 of 1, from 1363 to 1382: score 1.2, E = 5.4
                   *->IiHARllVReCLaeteRnar<-*
                      I+HAR+ V  +L  t  na
  gi|1923609  1363    IVHARSDVEGGLTNTTANAD    1382

TetR_C_4: domain 1 of 1, from 1388 to 1403: score 1.4, E = 8.1
                CS    -CGGGHHHHHHHHHH-
                   *->DLvaLaepvyeLLihG<-*
                      D+  Lae++++L i +
  gi|1923609  1388    DISGLAENTHQLQINA    1403

He_PIG: domain 2 of 12, from 1447 to 1469: score 0.5, E = 24
                   *->tytlTk.psdgslasysttpgggg<-*
                      +++l ++ + g+ asys t++ggg
  gi|1923609  1447    SFSL-SgAETGTKASYSITSSGGG    1469

FliX: domain 1 of 1, from 1463 to 1487: score 0.3, E = 6.1
                   *->MrisGprgttaasggkakksrasGgksaFa<-*
                        i++++g+ta++g++    ++++  ++F+
  gi|1923609  1463    --ITSSGGGTAVTGSGLD--VSTAT-QQFT    1487

GBP_C: domain 2 of 2, from 1468 to 1477: score 3.8, E = 0.61
                   *->GGiiVTGprL<-*
                      GG++VTG++L
  gi|1923609  1468    GGTAVTGSGL    1477

PKD: domain 3 of 5, from 1496 to 1521: score 7.2, E = 0.12
                CS    SEEEEEEEEEEETTCEEEEEEEEEEE
                   *->pGtYtVtLtvsngvgsasattttvtV<-*
                      +Gt tV+Lt ++ +g+++++t t+
  gi|1923609  1496    DGTLTVSLTLNDLAGNSATQTNTIAK    1521

eIF-6: domain 1 of 1, from 1540 to 1552: score 0.1, E = 9
                CS    EEE-BTTB-.-HHH
                   *->tRlqfeGnpcnIGV<-*
                      + + feG++ +IGV
  gi|1923609  1540    EPIVFEGSN-YIGV    1552

Big_1: domain 1 of 1, from 1563 to 1590: score 0.6, E = 9.2
                CS    XGG  EEEEECCEEEES-SEEESSSS--EEEE
                   *->ivd..qltAsitsiiadkttavAngndaiTlT<-*
                       vd+++ltA  t       ++++ng+++iTlT
  gi|1923609  1563    SVDngTLTAITTGGA----GILGNGTASITLT    1590

DUF2134: domain 2 of 2, from 1577 to 1593: score 0.8, E = 12
                   *->agilGilfGlppsrtlsAtAtA<-*
                      agilG      ++  ++ t+tA
  gi|1923609  1577    AGILGN-----GTASITLTGTA    1593

DUF1521: domain 1 of 1, from 1592 to 1609: score -0.4, E = 8.2
                   *->tqadldltengaiygdgk<-*
                      t++d++   ng iy +g
  gi|1923609  1592    TASDINTALNGLIYQPGN    1609

RIP: domain 1 of 1, from 1680 to 1692: score 0.2, E = 8.2
                CS    -EEE....EEESTT--H
                   *->kptvKFTEtFtlegats<-*
                      ++t+    tF+l+ at+
  gi|1923609  1680    EDTI----TFDLDSATA    1692

MIF: domain 1 of 1, from 1685 to 1700: score 1.3, E = 6.4
                CS    EE-GGGEEETTEEGGG
                   *->fDleaaqvGfnGstla<-*
                      fDl++a+ G  G t +
  gi|1923609  1685    FDLDSATAGNQGGTIT    1700

FG-GAP: domain 1 of 1, from 1717 to 1738: score 14.8, E = 0.0024
                CS    C-TTSSSSSEEEEEETCCCSCC TSEEEEE
                   *->gDlnGDGrpDlvvgaPgadggt.dgsvyll<-*
                      gDl+GDGrpD+ +       ++++ + +++
  gi|1923609  1717    GDLDGDGRPDVTL-------SAnN-ASRVM    1738

Ydc2-catalyt: domain 1 of 1, from 1737 to 1746: score 0.1, E = 4
                CS    EEEEEE-STT
                   *->ILSIDmGIrN<-*
                      ++S+D G++N
  gi|1923609  1737    VMSVDTGLSN    1746

Chlam_PMP: domain 2 of 6, from 1777 to 1796: score 11.0, E = 0.1
                   *->ditFsgNsa.aggGGAiyas<-*
                      d+++++N  ++ gGG+iy+s
  gi|1923609  1777    DSVITNNNEpGIGGGGIYGS    1796

Chlam_PMP: domain 3 of 6, from 1804 to 1822: score 8.5, E = 0.52
                   *->ditFsgNsaaggGGAiyas<-*
                      ++t+s+N+++++GG+i
  gi|1923609  1804    NSTISNNTSGSFGGGIRIV    1822

Cna_B: domain 2 of 2, from 1822 to 1843: score 0.7, E = 11
                CS    -TT-EEEEEETTEEE E--TTS
                   *->LeGAeftLldkdgnv.tTdenG<-*
                      + G +  L++++ + +t+d+nG
  gi|1923609  1822    VGGSTLNLINSTVSGnTSDDNG    1843

Chlam_PMP: domain 4 of 6, from 1831 to 1849: score 6.0, E = 2.4
                   *->ditFsgNsaaggGGAiyas<-*
                      ++t sgN++  +GG+i
  gi|1923609  1831    NSTVSGNTSDDNGGGIQYA    1849

Cecropin: domain 2 of 2, from 1844 to 1859: score 0.0, E = 60
                   *->AvIkiAkPAvkviaqa<-*
                      ++I+ A+P + ++ +
  gi|1923609  1844    GGIQYAGPGLTMVNTT    1859

Chlam_PMP: domain 5 of 6, from 1857 to 1878: score 6.7, E = 1.6
                   *->ditFsgNsa...aggGGAiyas<-*
                      ++t sgN+a++++++GG++  s
  gi|1923609  1857    NTTVSGNTArgtNSDGGGLQVS    1878

Herpes_U47: domain 1 of 1, from 1876 to 1896: score -0.5, E = 3.8
                   *->nvssqttniYPqtiteRstev<-*
                      +vss t n+Y  ti + +
  gi|1923609  1876    QVSSGTANVYNSTIAGNAAGH    1896

Chlam_PMP: domain 6 of 6, from 1886 to 1904: score 3.9, E = 8.8
                   *->ditFsgNsaaggGGAiyas<-*
                      ++t+ gN+a+  GG+++a+
  gi|1923609  1886    NSTIAGNAAGHAGGGVSAN    1904

CD34_antigen: domain 1 of 1, from 2070 to 2080: score 2.8, E = 1.7
                   *->dsDvFeeDThL<-*
                      dsD+ ++DT+L
  gi|1923609  2070    DSDITVSDTEL    2080

PGI: domain 1 of 1, from 2125 to 2142: score 0.8, E = 4.4
                CS    TSTT...SSTHHHHHHHH
                   *->LegsrkvsgfdssTngLi<-*
                      L++++ +++fd sT+g +
  gi|1923609  2125    LKNGQNIASFDTSTAGQL    2142

Apocytochr_F_C: domain 1 of 2, from 2130 to 2153: score 1.9, E = 4.3
                CS    SSS--B-SS-EEEEEEEE-TTS-E
                   *->NNnvynAsaaGrIskItklEkGGy<-*
                      N++++  s aG+ + I ++ +G++
  gi|1923609  2130    NIASFDTSTAGQLTIIFTNANGET    2153

I-set: domain 2 of 2, from 2190 to 2201: score 1.4, E = 11
                CS    TEEEEEEEEEEE
                   *->aGeaeasaeLtV<-*
                      +G+++ +a+Lt+
  gi|1923609  2190    GGSVTETASLTI    2201

META: domain 1 of 1, from 2223 to 2252: score 5.9, E = 0.91
                   *->qaflsaLsavtsysvegg......tLtLtn<-*
                      +a  s++s++t ++ve+g++  + tLtLtn
  gi|1923609  2223    GAAVSLFSGATATTVEAGqsliglTLTLTN    2252

Pneumo_NS1: domain 1 of 1, from 2249 to 2264: score 1.6, E = 4.6
                   *->elakYsnqLseLLGld<-*
                      +l++ sn  +e+LGld
  gi|1923609  2249    TLTNLSNGSAEILGLD    2264

SLAP: domain 1 of 1, from 2281 to 2295: score -1.6, E = 9.5
                   *->ndVdVTPsislnaav<-*
                      n V+VT s+++++a+
  gi|1923609  2281    NAVNVTVSVTGTTAS    2295

Ribosomal_L3: domain 1 of 1, from 2325 to 2335: score 3.0, E = 1.1
                   *->PGpkkrlVtir<-*
                      PG+ +r+Vti+
  gi|1923609  2325    PGTQNRVVTIT    2335

He_PIG: domain 3 of 12, from 2399 to 2442: score 15.9, E = 0.001
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      t+++                  + Ps+  +d +tG++tGtPt +
  gi|1923609  2399    TFSI-----------------ANQPSWAAFDTATGALTGTPTNA-DV 2427

                   G.sytftvtatdgsg<-*
                   G++  + ++++dg
  gi|1923609  2428 GtTNGIVISVSDGLA    2442

LEA_6: domain 1 of 4, from 2458 to 2465: score 1.6, E = 11
                   *->DAPTlSGa<-*
                      DAPT+SG+
  gi|1923609  2458    DAPTISGT    2465

He_PIG: domain 4 of 12, from 2461 to 2487: score 5.0, E = 1.2
                   *->ritGtPtptvqpG.sytftvtatdgsg<-*
                      +i+GtP+++v +G +y+ft ta+d  +
  gi|1923609  2461    TISGTPATSVNQGaAYSFTPTASDIDV    2487

ATP-synt_ab: domain 1 of 3, from 2485 to 2492: score 0.2, E = 8.9
                CS    B-TTT-B-
                RF    xxxxxxxx
                   *->IDvllSvS<-*
                      IDv++S+S
  gi|1923609  2485    IDVGDSLS    2492

He_PIG: domain 5 of 12, from 2492 to 2535: score 19.8, E = 7.7e-05
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      ++++                  + Ps+ +++ +tG ++GtP
  gi|1923609  2492    SFSI-----------------ANMPSWASFNTATGELSGTPGND-DV 2520

                   G.sytftvtatdgsg<-*
                   G+++ + ++++dgs
  gi|1923609  2521 GtTSGIVISVSDGSA    2535

Alpha-L-AF_C: domain 1 of 2, from 2522 to 2543: score 2.8, E = 3
                CS    .SB---EEE.TT...EEEEEE-SSEE
                   *->vksfggakvaedvsggtltvtLPplS<-*
                      ++s++ ++v +d   g  +++LP++S
  gi|1923609  2522    TTSGIVISV-SD---GSASASLPAFS    2543

LEA_6: domain 2 of 4, from 2551 to 2558: score 1.6, E = 11
                   *->DAPTlSGa<-*
                      DAPT+SG+
  gi|1923609  2551    DAPTISGT    2558

He_PIG: domain 6 of 12, from 2554 to 2580: score 5.0, E = 1.2
                   *->ritGtPtptvqpG.sytftvtatdgsg<-*
                      +i+GtP+++v +G +y+ft ta+d  +
  gi|1923609  2554    TISGTPATSVNQGaAYSFTPTASDIDV    2580

ATP-synt_ab: domain 2 of 3, from 2578 to 2585: score 0.2, E = 8.9
                CS    B-TTT-B-
                RF    xxxxxxxx
                   *->IDvllSvS<-*
                      IDv++S+S
  gi|1923609  2578    IDVGDSLS    2585

He_PIG: domain 7 of 12, from 2585 to 2628: score 19.8, E = 7.7e-05
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      ++++                  + Ps+ +++ +tG ++GtP
  gi|1923609  2585    SFSI-----------------ANMPSWASFNTATGELSGTPGND-DV 2613

                   G.sytftvtatdgsg<-*
                   G+++ + ++++dgs
  gi|1923609  2614 GtTSGIVISVSDGSA    2628

Alpha-L-AF_C: domain 2 of 2, from 2615 to 2636: score 2.8, E = 3
                CS    .SB---EEE.TT...EEEEEE-SSEE
                   *->vksfggakvaedvsggtltvtLPplS<-*
                      ++s++ ++v +d   g  +++LP++S
  gi|1923609  2615    TTSGIVISV-SD---GSASASLPAFS    2636

LEA_6: domain 3 of 4, from 2644 to 2651: score 1.6, E = 11
                   *->DAPTlSGa<-*
                      DAPT+SG+
  gi|1923609  2644    DAPTISGT    2651

He_PIG: domain 8 of 12, from 2647 to 2673: score 5.0, E = 1.2
                   *->ritGtPtptvqpG.sytftvtatdgsg<-*
                      +i+GtP+++v +G +y+ft ta+d  +
  gi|1923609  2647    TISGTPATSVNQGaAYSFTPTASDIDV    2673

ATP-synt_ab: domain 3 of 3, from 2671 to 2678: score 0.2, E = 8.9
                CS    B-TTT-B-
                RF    xxxxxxxx
                   *->IDvllSvS<-*
                      IDv++S+S
  gi|1923609  2671    IDVGDSLS    2678

FSA_C: domain 1 of 1, from 2676 to 2730: score 3.6, E = 0.16
                   *->slanaiANgssAieiNesssekiaslskesvlsGtkssvtivvvdsd
                      sl+ +iAN+ s +  N+++ e   s+ ++    Gt s + i v d+d
  gi|1923609  2676    SLSFSIANMPSWASFNTATGEL--SGTPGNDDVGTTSGIVISVSDGD 2720

                   lesqeGsPPtfDL<-*
                         s P+f+L
  gi|1923609  2721 DSA---SLPAFNL    2730

He_PIG: domain 9 of 12, from 2678 to 2721: score 16.9, E = 0.00053
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      ++++                  + Ps+ +++ +tG ++GtP
  gi|1923609  2678    SFSI-----------------ANMPSWASFNTATGELSGTPGND-DV 2706

                   G.sytftvtatdgsg<-*
                   G+++ + ++++dg
  gi|1923609  2707 GtTSGIVISVSDGDD    2721

Peptidase_S13: domain 1 of 1, from 2763 to 2776: score -0.1, E = 7.2
                CS    CTTC-EEEEEEEEE
                   *->tdsGrklaFsfisN<-*
                      +++G++l+Fs+++
  gi|1923609  2763    DADGDTLTFSIVNK    2776

He_PIG: domain 10 of 12, from 2770 to 2813: score 21.4, E = 2.7e-05
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      t+++                  + Ps+ +++++tG ++GtPt +
  gi|1923609  2770    TFSI-----------------VNKPSWASFNNATGELSGTPTNA-DV 2798

                   G.sytftvtatdgsg<-*
                   G++  + ++++dg
  gi|1923609  2799 GtTNGIVISVSDGDE    2813

DUF1254: domain 1 of 1, from 2823 to 2850: score 4.4, E = 0.83
                   *->qflhfsrlpdpddtgvvtPNnDTlYSsa<-*
                      +++++++ p+ ++t+ ++ N+DT+YS++
  gi|1923609  2823    TVVNVNDAPTISGTPGTSVNQDTVYSFS    2850

LEA_6: domain 4 of 4, from 2829 to 2836: score 1.6, E = 11
                   *->DAPTlSGa<-*
                      DAPT+SG+
  gi|1923609  2829    DAPTISGT    2836

DUF1509: domain 1 of 1, from 2839 to 2855: score -1.3, E = 9.9
                   *->ttiRdltVLvsSseeed<-*
                      t + ++tV   S+ ++d
  gi|1923609  2839    TSVNQDTVYSFSPTASD    2855

Poty_coat: domain 1 of 1, from 2852 to 2866: score 0.0, E = 8.2
                   *->kDrDVnagtsGtfsv<-*
                         D+++g++ tfs+
  gi|1923609  2852    TASDIDVGDTLTFSI    2866

He_PIG: domain 11 of 12, from 2863 to 2906: score 15.4, E = 0.0014
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      t+++                  + P + +++ +tG ++GtPt +
  gi|1923609  2863    TFSI-----------------ANKPGWASFNTTTGELSGTPTGA-DV 2891

                   G.sytftvtatdgsg<-*
                   G++  + ++++dg+
  gi|1923609  2892 GtTIGIVISVSDGAL    2906

DUF1857: domain 1 of 1, from 2886 to 2906: score 1.8, E = 3.6
                   *->aTgehdGgsltntiEegedgsdaL<-*
                      +Tg+  G+++ ++i++ +dg  aL
  gi|1923609  2886    PTGADVGTTIGIVISV-SDG--AL    2906

Peptidase_C25_C: domain 1 of 1, from 2923 to 2938: score 1.3, E = 8
                CS    -B---EE--SEEETT-
                   *->PtkmqvTaPAsipqnq<-*
                      Pt    TaPA i  n+
  gi|1923609  2923    PTQPVLTAPADIQVNA    2938

BCDHK_Adom3: domain 1 of 1, from 2943 to 2951: score 3.6, E = 0.83
                   *->tplSLrqll<-*
                      tp+SLrqll
  gi|1923609  2943    TPISLRQLL    2951

PhageMin_Tail: domain 1 of 1, from 2947 to 2977: score 2.1, E = 4.3
                   *->lgkaAkelgattgfsaeeaaealeelsaqaGlsak<-*
                      l++    l+ + g s e +a+al++l a+ G++++
  gi|1923609  2947    LRQL---LSLQAGASDETVAQALAAL-ASDGVNGN    2977

FerA: domain 1 of 1, from 2951 to 2969: score 2.7, E = 9
                   *->lAikAklpdeelaelwlkl<-*
                      l+++A+++de++a+ +++l
  gi|1923609  2951    LSLQAGASDETVAQALAAL    2969

Alpha_adaptin_C: domain 1 of 1, from 2957 to 2969: score 3.5, E = 2.6
                   *->sTneaVsqtLlkl<-*
                      +++e+V+q+L+ l
  gi|1923609  2957    ASDETVAQALAAL    2969

DUF2271: domain 1 of 1, from 2997 to 3012: score 1.2, E = 6.6
                   *->pGthalsfdgkddplk<-*
                      pG+h+l ++ ++ ++k
  gi|1923609  2997    PGRHELTWTTSNSQGK    3012

Phage_DNA_bind: domain 1 of 1, from 3032 to 3043: score 1.7, E = 9
                CS    -EEEE-GGGSS-E
                   *->lkVeIksSqvavk<-*
                        V I++Sqv ++
  gi|1923609  3032    -QVAIRDSQVEFR    3043

Ribonuc_red_2_N: domain 1 of 1, from 3077 to 3086: score 2.4, E = 2.5
                   *->dGsvvFEmkd<-*
                      dGsvvF +k+
  gi|1923609  3077    DGSVVFTQKG    3086

PGAMP: domain 1 of 1, from 3084 to 3095: score 3.1, E = 5.1
                   *->kkaQsqnSrrav<-*
                      +k+Q+q S +++
  gi|1923609  3084    QKGQTQISVPVT    3095

PKD: domain 4 of 5, from 3150 to 3172: score 2.7, E = 2.7
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECE
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvs<-*
                      v++s           g +Vt+ta + +dp+ +++++
  gi|1923609  3150    VTPS-----------GGPVTVTAVV-TDPN-PNDTH    3172

HATPase_c: domain 1 of 1, from 3151 to 3215: score 1.8, E = 6.3
                CS    HHHCSEEEEEEEEET
                   *->apaggeitvrlerdg................................
                      +p+gg +tv++  ++++++++++ + + +++ +++++++ +  +  +
  gi|1923609  3151    TPSGGPVTVTAVVTDpnpndthsfdwsatrglpdtdgnpvdaarvfd 3197

                CS        TEEEEEEEESS
                   .......drlritVeDnG<-*
                   + + ++++ +++tV+D+G
  gi|1923609  3198 paglsgsHSVVVTVTDSG    3215

Lamp: domain 1 of 1, from 3157 to 3174: score 0.4, E = 7
                   *->YsvteltfsynlsDttlF<-*
                      ++vt++++  n++Dt+ F
  gi|1923609  3157    VTVTAVVTDPNPNDTHSF    3174

FlaE: domain 2 of 2, from 3196 to 3225: score 3.5, E = 1.6
                   *->fdpadpatynystsvtvYDSlGnkhtlqvyF<-*
                      fdpa+ ++ ++s+ vtv DS+G + + q yF
  gi|1923609  3196    FDPAGLSG-SHSVVVTVTDSGGASTQAQTYF    3225

He_PIG: domain 12 of 12, from 3203 to 3216: score 4.3, E = 2
                   *->Gsytftvtatdgsg<-*
                      Gs ++ vt+td++g
  gi|1923609  3203    GSHSVVVTVTDSGG    3216

PKD: domain 5 of 5, from 3203 to 3227: score 9.1, E = 0.029
                CS    EEEEEEEEEEETTCEEEEEEEEEEE
                   *->GtYtVtLtvsngvgsasattttvtV<-*
                      G+++V +tv+++ g++++ +t++ +
  gi|1923609  3203    GSHSVVVTVTDSGGASTQAQTYFRI    3227

AIG2: domain 1 of 1, from 3207 to 3227: score 3.3, E = 1.1
                CS    EEEEEE----SEE.EEEEEEES
                   *->veveVelgdgeevveAwvYvya<-*
                      v v+V++ +g+++ +A++Y+
  gi|1923609  3207    VVVTVTDSGGAST-QAQTYFRI    3227

DUF824: domain 1 of 1, from 3207 to 3227: score 4.1, E = 4.1
                   *->ltVTvKDaaGn.PvpnvpFtL<-*
                      ++VTv+D+ G + ++ ++F +
  gi|1923609  3207    VVVTVTDSGGAsTQAQTYFRI    3227

Binary_toxB: domain 1 of 1, from 3237 to 3248: score 2.5, E = 0.88
                   *->dlDtDnDgIPDl<-*
                      d+DtD+DgI Dl
  gi|1923609  3237    DVDTDGDGISDL    3248

TSP_3: domain 1 of 1, from 3238 to 3252: score 3.7, E = 6.6
                CS    --TT-SSS-..GGGS
                   *->eDsDnDgvgdnDaCd<-*
                       D+D+Dg+ d D+
  gi|1923609  3238    VDTDGDGISDLDEGA    3252

Collar: domain 1 of 1, from 3256 to 3268: score 2.2, E = 9.1
                CS    SB.B--B-TTXXX
                   *->ptfglPDLRGrFv<-*
                      +++g+P++ +  +
  gi|1923609  3256    NGNGIPNYLDNMP    3268

DUF1343: domain 1 of 1, from 3276 to 3282: score 0.1, E = 6.2
                   *->VGLITNq<-*
                      VGLITN+
  gi|1923609  3276    VGLITNA    3282

Apocytochr_F_C: domain 2 of 2, from 3379 to 3386: score 1.7, E = 4.8
                CS    SSS--B-S
                   *->NNnvynAs<-*
                      NN+vy+A+
  gi|1923609  3379    NNAVYSAP    3386

Pneumo_ncap: domain 1 of 1, from 3412 to 3422: score 0.7, E = 3.4
                   *->qLNikDedsed<-*
                      qLNi+D +++d
  gi|1923609  3412    QLNIEDGGPND    3422

Alginate_lyase: domain 1 of 1, from 3474 to 3500: score 2.1, E = 1.4
                CS    XXXXXXXXXXXXXXXXXXXXXXSTTTT--
                   *->mhfrRlalpaLlalallaslqaaasaaas<-*
                      m  r+ +  +L  lall+s +++ +aa++
  gi|1923609  3474    M-TRKVSTKTLVVLALLVS-AMTSQAAQD    3500

CopC: domain 1 of 1, from 3474 to 3497: score 1.2, E = 6.5
                CS    XXXXXXXXXXXXX..XXXXXXX XXXX
                   *->MlsalrklaklllvLalsLvas.sAfA<-*
                      M   ++  +k+l+vLal+ v++ +++A
  gi|1923609  3474    MT--RKVSTKTLVVLALL-VSAmTSQA    3497

RepA1_leader: domain 1 of 1, from 3474 to 3496: score 3.4, E = 5.9
                   *->mlrKlqylfLchlLLpCivsAgrcD<-*
                      m rK+    L+ l L   vsA  +
  gi|1923609  3474    MTRKVSTKTLVVLALL--VSAMTSQ    3496

DUF2501: domain 1 of 1, from 3481 to 3499: score 1.6, E = 0.86
                   *->aglLlaalLasallasvAh<-*
                      + l++ alL+sa+++ +A+
  gi|1923609  3481    KTLVVLALLVSAMTSQAAQ    3499

OprD: domain 1 of 1, from 3482 to 3501: score 1.1, E = 3.1
                   *->rlaalalallaglpalAlqsasaqad<-*
                      +l++lal+++a+++++A      q++
  gi|1923609  3482    TLVVLALLVSAMTSQAA------QDK    3501

CNPase: domain 1 of 1, from 3493 to 3502: score 2.1, E = 2.1
                CS    XXXXXXXXXX
                   *->MsaqaakdkP<-*
                      M +qaa+dkP
  gi|1923609  3493    MTSQAAQDKP    3502

Transketolase_N: domain 1 of 1, from 3500 to 3511: score -0.6, E = 8.4
                CS    --TT--HHHHHH
                   *->akpFeIPqeVYd<-*
                      +kpF++++++Yd
  gi|1923609  3500    DKPFYVRADIYD    3511

HMA: domain 1 of 1, from 3509 to 3534: score 2.3, E = 6.5
                CS    EESTTTSCHHH HHHHHHHTTSEEEE
                   *->tgdedlpklkk.lveaveiigydarl<-*
                      ++d+ +++ k++  +a+e++gy+++l
  gi|1923609  3509    IYDVNSTVTKQdFRQALEDAGYEVTL    3534

Wound_ind: domain 1 of 1, from 3509 to 3514: score 1.0, E = 9.5
                   *->miYDvns<-*
                       iYDvns
  gi|1923609  3509    -IYDVNS    3514

YadA: domain 1 of 1, from 3542 to 3552: score 6.2, E = 0.23
                   *->vgagaGvGYqW<-*
                      +g+ ++vGYqW
  gi|1923609  3542    TGYQISVGYQW    3552

DUF1513: domain 1 of 1, from 3549 to 3559: score 1.3, E = 4.6
                   *->gvaWDNHlvrl<-*
                      g++WD+H+ +
  gi|1923609  3549    GYQWDQHWFSE    3559

MetW: domain 1 of 1, from 3613 to 3623: score 0.5, E = 9.4
                   *->NffGeqavFll<-*
                      N++Ge++++l
  gi|1923609  3613    NLLGEIGIYLW    3623

Imp-YgjV: domain 1 of 1, from 3661 to 3674: score 2.1, E = 5
                   *->lvtiYRlyrdkkrp<-*
                      +v+i R+y+d++++
  gi|1923609  3661    GVGIRRIYFDQQQA    3674

//