hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            196191954.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|196191954|gb|EDX86918.1|
Accession:      [none]
Description:    Putative Ig domain family [Synechococcus sp. PCC 7335]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
He_PIG          Putative Ig domain                      177.3    4.3e-50   4
PKD             PKD domain                               35.7    1.9e-10   4
Cadherin        Cadherin domain                          21.7    1.6e-05   5
TSP_3           Thrombospondin type 3 repeat             20.9    4.4e-05   6
Big_2           Bacterial Ig-like domain (group 2)       17.8    0.00018   4
F5_F8_type_C    F5/8 type C domain                       14.0     0.0018   1
Binary_toxB     Clostridial binary toxin B/anthrax to     6.2      0.074   2
DAG1            Dystroglycan (Dystrophin-associated g     5.5      0.088   1
Ad_cyc_g-alpha  Adenylate cyclase G-alpha binding dom     8.5       0.12   1
WDYHV           Uncharacterized conserved protein         5.6       0.24   1
Flagellin_IN    Flagellin hook IN motif                   5.8       0.91   2
Gmad1           Lipoprotein LpqB beta-propeller domai     3.8       0.95   1
DUF508          Domain of unknown function (DUF508)       2.7        1.3   1
Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar b     2.9        1.3   1
DUF543          Domain of unknown function (DUF543)       4.0        1.7   1
FlgD            Flagellar hook capping protein            2.9        1.9   1
Lectin_legB     Legume lectin domain                      2.0        2.3   1
DUF2454         Protein of unknown function (DUF2454)     2.0        2.6   2
GBS_Bsp-like    GBS Bsp-like repeat                       2.9        2.7   1
Patatin         Patatin-like phospholipase                2.3        2.9   1
DUF1901         Domain of unkown function (DUF1901)       3.1          3   1
Trehalose_PPase Trehalose-phosphatase                     1.7        3.6   1
SASP_gamma      Small, acid-soluble spore protein, ga     2.1        3.6   1
Fil_haemagg     Haemagluttinin repeat                     3.0          4   2
CoA_trans       Coenzyme A transferase                    1.7        4.1   1
Clathrin_propel Clathrin propeller repeat                 4.2        4.8   1
Peptidase_M30   Peptidase M30                             0.6        4.8   1
Big_3           Bacterial Ig-like domain (group 3)        3.4        4.9   2
Orthopox_F14    Orthopoxvirus F14 protein                 1.8        5.1   1
DUF2334         Uncharacterized protein conserved in     -0.3        6.3   1
YceI            YceI-like domain                          1.3        6.3   1
Plectin         Plectin repeat                            2.9        6.5   1
AOX             Alternative oxidase                      -0.6        6.7   1
RCC1            Regulator of chromosome condensation      2.2        6.7   1
Patched         Patched family                           -1.1        6.7   1
Ceramidase_alk  Neutral/alkaline non-lysosomal cerami    -0.4        6.8   1
Peptidase_M49   Peptidase family M49                     -0.8        6.9   1
RNase_H2-Ydr279 Ydr279p protein family (RNase H2 comp    -0.5          7   1
Talin_middle    Talin, middle domain                      0.3        7.2   1
CTV_P23         Citrus tristeza virus (CTV) P23 prote     0.3        7.3   1
Kunitz_legume   Trypsin and protease inhibitor            1.4        7.6   1
MGAT2           N-acetylglucosaminyltransferase II (M    -1.7          8   1
RhoGAP          RhoGAP domain                             0.6        8.4   1
Pox_L5          Poxvirus L5 protein family                2.0        8.4   1
PBP_dimer       Penicillin-binding Protein dimerisati     0.8        8.8   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
AOX               1/1     154   165 ..   264   275 .]    -0.6      6.7
Pox_L5            1/1     186   202 ..    67    82 .]     2.0      8.4
SASP_gamma        1/1     191   199 ..     1     9 [.     2.1      3.6
DUF543            1/1     209   220 ..    69    80 .]     4.0      1.7
Glyco_hydro_2_N   1/1     213   228 ..     1    16 [.     2.9      1.3
Lectin_legB       1/1     225   290 ..    82   159 ..     2.0      2.3
Gmad1             1/1     249   269 ..   149   173 ..     3.8     0.95
RCC1              1/1     314   321 ..    61    68 .]     2.2      6.7
TSP_3             1/6     396   408 ..     1    12 [.     1.7       25
TSP_3             2/6     409   416 ..     1     8 [.     1.0       41
Talin_middle      1/1     425   448 ..    59    85 ..     0.3      7.2
F5_F8_type_C      1/1     432   456 ..     1    44 [.    14.0   0.0018
Ceramidase_alk    1/1     485   509 ..   743   771 .]    -0.4      6.8
CoA_trans         1/1     518   537 ..     1    21 [.     1.7      4.1
MGAT2             1/1     536   557 ..    13    34 ..    -1.7        8
DUF508            1/1     544   563 ..   139   159 .]     2.7      1.3
Fil_haemagg       1/2     558   613 ..     1    75 []     1.8      8.8
Clathrin_propel   1/1     601   643 ..     1    43 []     4.2      4.8
WDYHV             1/1     612   633 ..   222   248 .]     5.6     0.24
Patched           1/1     636   667 ..     1    33 [.    -1.1      6.7
Peptidase_M49     1/1     645   664 ..   562   578 .]    -0.8      6.9
FlgD              1/1     678   709 ..   103   155 .]     2.9      1.9
DUF2334           1/1     694   701 ..     1     8 [.    -0.3      6.3
Kunitz_legume     1/1     696   706 ..     1    11 [.     1.4      7.6
PBP_dimer         1/1     742   761 ..   176   195 .]     0.8      8.8
Binary_toxB       1/2     749   757 ..     1     9 [.     1.4      1.7
TSP_3             3/6     750   762 ..     1    12 [.     4.0      5.3
Binary_toxB       2/2     762   775 ..     1    14 [.     4.8     0.19
TSP_3             4/6     763   775 ..     1    15 []     4.3      4.4
TSP_3             5/6     788   800 ..     1    15 []     5.1      2.6
TSP_3             6/6     823   835 ..     1    15 []     4.8        3
Ad_cyc_g-alpha    1/1     861   890 ..    27    56 .]     8.5     0.12
Orthopox_F14      1/1     881   909 ..    46    73 .]     1.8      5.1
Fil_haemagg       2/2     958  1004 ..     1    75 []     1.2       13
Big_3             1/2     962   979 ..    52    70 .]     0.7       26
GBS_Bsp-like      1/1     965   983 ..    46    64 ..     2.9      2.7
CTV_P23           1/1     969   997 ..     1    30 [.     0.3      7.3
PKD               1/4     987  1004 ..    75    92 .]     0.6       12
Big_3             2/2     993  1004 ..    60    70 .]     2.7      7.7
DUF2454           1/2    1011  1025 ..   307   322 .]     1.0      4.9
Cadherin          1/5    1028  1058 ..     1    28 [.     0.8       16
PKD               2/4    1028  1104 ..     1    92 []    16.6  0.00015
He_PIG            1/4    1046  1093 ..     1    61 []    44.7  6.8e-12
YceI              1/1    1059  1106 ..     1    69 [.     1.3      6.3
Flagellin_IN      1/2    1067  1090 ..     1    26 [.     1.1       18
Cadherin          2/5    1071  1087 ..    91   107 .]     2.4      5.5
Big_2             1/4    1076  1098 ..    67    90 .]     4.6      1.2
DUF2454           2/2    1110  1124 ..   307   322 .]     1.0      4.9
PKD               3/4    1137  1203 ..    27    92 .]     5.8     0.31
He_PIG            2/4    1145  1192 ..     1    61 []    42.6  2.7e-11
Flagellin_IN      2/2    1166  1190 ..     1    27 [.     4.6      1.9
Cadherin          3/5    1170  1186 ..    91   107 .]     2.7      4.6
Big_2             2/4    1174  1197 ..    66    90 .]     3.7      2.1
Trehalose_PPase   1/1    1176  1205 ..   222   251 .]     1.7      3.6
PKD               4/4    1236  1302 ..    27    92 .]    12.8   0.0021
He_PIG            3/4    1244  1291 ..     1    61 []    47.5  1.1e-12
Cadherin          4/5    1269  1285 ..    91   107 .]     8.1     0.13
Peptidase_M30     1/1    1272  1285 ..   406   419 .]     0.6      4.8
Big_2             3/4    1277  1296 ..    70    90 .]     4.6      1.2
DAG1              1/1    1314  1386 ..    32   107 ..     5.5    0.088
He_PIG            4/4    1343  1390 ..     1    61 []    42.6  2.6e-11
Cadherin          5/5    1368  1384 ..    91   107 .]     7.6     0.18
Big_2             4/4    1377  1395 ..    71    90 .]     4.8        1
RNase_H2-Ydr279   1/1    1454  1461 ..   409   416 .]    -0.5        7
DUF1901           1/1    1457  1475 ..    63    81 ..     3.1        3
RhoGAP            1/1    1532  1545 ..   142   155 .]     0.6      8.4
Plectin           1/1    1577  1590 ..     9    22 ..     2.9      6.5
Patatin           1/1    1622  1635 ..     1    15 [.     2.3      2.9

Alignments of top-scoring domains:
AOX: domain 1 of 1, from 154 to 165: score -0.6, E = 6.7
                   *->dqkekeLdpNPF<-*
                      +q+  eL+ NPF
  gi|1961919   154    HQQNVELAINPF    165

Pox_L5: domain 1 of 1, from 186 to 202: score 2.0, E = 8.4
                   *->INGrSskvSlndi.lrR<-*
                      ING +s +S+n+i+l+
  gi|1961919   186    INGNASRTSANEIrLTE    202

SASP_gamma: domain 1 of 1, from 191 to 199: score 2.1, E = 3.6
                   *->SaTnAqqVr<-*
                      S+T+A+++r
  gi|1961919   191    SRTSANEIR    199

DUF543: domain 1 of 1, from 209 to 220: score 4.0, E = 1.7
                   *->GrAYseCeadfn<-*
                      G+AYs+ + dfn
  gi|1961919   209    GSAYSNARIDFN    220

Glyco_hydro_2_N: domain 1 of 1, from 213 to 228: score 2.9, E = 1.3
                CS    -S-EEE--EEEEEEEE
                   *->srrvqsLNGgWkFkla<-*
                      s+ ++++N +W+F ++
  gi|1961919   213    SNARIDFNFDWDFTFD    228

Lectin_legB: domain 1 of 1, from 225 to 290: score 2.0, E = 2.3
                CS    EEEEEEES..TTSS-BEEEEEEEEETT--S.TTB  SSGGGTTTSST
                   *->FvFaIknlpsksgngGdGLAFflaPsdtqdppga..ssggyLGLfNs
                      F+F    +++ ++ g+dG+ F+l +++  d + a ++sgg LG+
  gi|1961919   225    FTFDL--YFGTNDGGADGIGFVLHNDP--DGDRAvgLSGGGLGIAG- 266

                CS TSTTGGGGCCEEEEEEETST.GGGTTTS.SSSE
                   snngdnpsNhiVAVEFDTvlNkefnDiDdnyNH<-*
                            ++V++EFDT++N+   Di    +H
  gi|1961919   267 -------VERSVGIEFDTFFNSGTSDISS--DH    290

Gmad1: domain 1 of 1, from 249 to 269: score 3.8, E = 0.95
                   *->RDGtRaAvvverggggqvyVagVeR<-*
                      +DG Ra+ +    +gg + +agVeR
  gi|1961919   249    PDGDRAVGL----SGGGLGIAGVER    269

RCC1: domain 1 of 1, from 314 to 321: score 2.2, E = 6.7
                CS    ESSEEEEE
                   *->GgqHtval<-*
                      G++Htv++
  gi|1961919   314    GNYHTVVV    321

TSP_3: domain 1 of 6, from 396 to 408: score 1.7, E = 25
                CS    --TT-SSS-.. G
                   *->eDsDnDgvgdn.D<-*
                      eDsD+Dg+ ++ D
  gi|1961919   396    EDSDGDGINNDvD    408

TSP_3: domain 2 of 6, from 409 to 416: score 1.0, E = 41
                CS    --TT-SSS
                   *->eDsDnDgv<-*
                       DsD+Dg+
  gi|1961919   409    LDSDSDGI    416

Talin_middle: domain 1 of 1, from 425 to 448: score 0.3, E = 7.2
                   *->vaamtAATAqVVnlTAsdPdevDyeaV<-*
                      +a  +A+TA VV  TA++++     aV
  gi|1961919   425    IASAGAGTATVVSATAGHEAS---NAV    448

F5_F8_type_C: domain 1 of 1, from 432 to 456: score 14.0, E = 0.0018
                CS    CEEESS-STTCSS.B....G-GGGGCCTSSSSS......TTSSE
                   *->qitaSSeesgsggagrarLwspasaalDGngntyghsvspstaW<-*
                      ++t+ S ++g++          as+a+DG+          +t+W
  gi|1961919   432    TATVVSATAGHE----------ASNAVDGD---------ATTYW    456

Ceramidase_alk: domain 1 of 1, from 485 to 509: score -0.4, E = 6.8
                   *->HfGeaKkilLLktgkilafeGstrsFtVv<-*
                      +fGe K       + i ++ +s+++++V
  gi|1961919   485    FFGEPKSTG----SDIAEIDASKHAMVVW    509

CoA_trans: domain 1 of 1, from 518 to 537: score 1.7, E = 4.1
                CS    CCHHHHHHCCG-TTTEEEEES
                   *->vesaaeAvareikDGmtvnvG<-*
                      ++ a++++  +++DG t++vG
  gi|1961919   518    TAEATAMLN-YVRDGGTLYVG    537

MGAT2: domain 1 of 1, from 536 to 557: score -1.7, E = 8
                   *->vsfrNedQavlNaDkfgdLpkd<-*
                      v f N++++ +N++kf++ +++
  gi|1961919   536    VGFENLNFTTQNEAKFSQIVDR    557

DUF508: domain 1 of 1, from 544 to 563: score 2.7, E = 1.3
                   *->asksvaQlalIVDvtEKNfdl<-*
                      ++++ a ++ IVD    Nf l
  gi|1961919   544    TTQNEAKFSQIVD-RVLNFNL    563

Fil_haemagg: domain 1 of 2, from 558 to 613: score 1.8, E = 8.8
                CS    EEESSEEEETTTT--EE-SEEEEEE-STT-EEEE-S-EEESSE....
                   *->vaaGaltlnaaalggldlnnggtlsagggltltaagllnnggtliag
                      v+  +l+++ + +g +++  g +++a+g +t  a g++ + ++
  gi|1961919   558    VLNFNLRIDSDSSGPSSAPEGNLVGASGSVTTAASGIFSREDS---- 600

                CS ...............EEEEESS-EEEEE
                   gdlllaagalrnggdltltaaGdLdnsg<-*
                                    ++++++L ++
  gi|1961919   601 ---------------QPISSQNQLIVND    613

Clathrin_propel: domain 1 of 1, from 601 to 643: score 4.2, E = 4.8
                CS    EECCEEEEEEEEEEEEEEEEEEEEEE.EETCECEEEEEEEETT
                   *->gaifsdidfptaimeswkgilainkqnaqdlakggkvqivdle<-*
                      ++i+s+++  +++ +s+++ +++++   qd+ +g+ ++++d++
  gi|1961919   601    QPISSQNQLIVNDSNSDIYGVVYDSSDMQDGFTGNLILVGDVN    643

WDYHV: domain 1 of 1, from 612 to 633: score 5.6, E = 0.24
                   *->peavkeavkeqgpGvVysesefqdfFg<-*
                      ++++     + ++GvVy+ s++qd F+
  gi|1961919   612    NDSN-----SDIYGVVYDSSDMQDGFT    633

Patched: domain 1 of 1, from 636 to 667: score -1.1, E = 6.7
                   *->llsldivytrtpdDirksltergarsedeplke<-*
                      l +++ v+++ ++++  +++++++++e e+ ++
  gi|1961919   636    LILVGDVNMYEEANAG-FFSSIQSFAEPELSVF    667

Peptidase_M49: domain 1 of 1, from 645 to 664: score -0.8, E = 6.9
                   *->YeetaeGl...iqSFleRyp<-*
                      Yee  +G  ++iqSF e ++
  gi|1961919   645    YEEANAGFfssIQSFAEPEL    664

FlgD: domain 1 of 1, from 678 to 709: score 2.9, E = 1.9
                   *->ntivyldgggggetGsvsggvevgLpsaAdevtvtikDaaGqvvnve
                      ++ v+l+        ++++gv+       d+ +++++Da+G +
  gi|1961919   678    SE-VTLE--------VATAGVN-------DGDVLVVYDADGAE---- 704

                   lVrtid<-*
                    V + +
  gi|1961919   705 -VNRSN    709

DUF2334: domain 1 of 1, from 694 to 701: score -0.3, E = 6.3
                   *->VLilYDsp<-*
                      VL++YD++
  gi|1961919   694    VLVVYDAD    701

Kunitz_legume: domain 1 of 1, from 696 to 706: score 1.4, E = 7.6
                CS    B-BETTSCB-B
                   *->pVLDtdGneLr<-*
                       V+D+dG e++
  gi|1961919   696    VVYDADGAEVN    706

PBP_dimer: domain 1 of 1, from 742 to 761: score 0.8, E = 8.8
                   *->kdGkrkyevDarGrviptls<-*
                      ++ k+++ vD++G  i ++
  gi|1961919   742    QVAKITFAVDSDGDGIANHL    761

Binary_toxB: domain 1 of 2, from 749 to 757: score 1.4, E = 1.7
                   *->dlDtDnDgI<-*
                      ++D+D+DgI
  gi|1961919   749    AVDSDGDGI    757

TSP_3: domain 3 of 6, from 750 to 762: score 4.0, E = 5.3
                CS    --TT-SSS-.. G
                   *->eDsDnDgvgdn.D<-*
                       DsD+Dg+ ++ D
  gi|1961919   750    VDSDGDGIANHlD    762

Binary_toxB: domain 2 of 2, from 762 to 775: score 4.8, E = 0.19
                   *->dlDtDnDgIPDlwE<-*
                      dlD+DnDg PD  E
  gi|1961919   762    DLDSDNDGLPDNIE    775

TSP_3: domain 4 of 6, from 763 to 775: score 4.3, E = 4.4
                CS    --TT-SSS-..GGGS
                   *->eDsDnDgvgdnDaCd<-*
                       DsDnDg    D  +
  gi|1961919   763    LDSDNDGLP--DNIE    775

TSP_3: domain 5 of 6, from 788 to 800: score 5.1, E = 2.6
                CS    --TT-SSS-..GGGS
                   *->eDsDnDgvgdnDaCd<-*
                       DsDnDg    Da +
  gi|1961919   788    SDSDNDGLD--DAYE    800

TSP_3: domain 6 of 6, from 823 to 835: score 4.8, E = 3
                CS    --TT-SSS-..GGGS
                   *->eDsDnDgvgdnDaCd<-*
                       DsD+Dg+   D+ +
  gi|1961919   823    IDSDGDGIS--DTEE    835

Ad_cyc_g-alpha: domain 1 of 1, from 861 to 890: score 8.5, E = 0.12
                   *->sdMEGIltkPpPltPtDnsfindgeseake<-*
                      sd+ GI+++P +l ++D+++++ g+ +  +
  gi|1961919   861    SDVNGIIDDPTTLPDADGDLEFGGDVDFRD    890

Orthopox_F14: domain 1 of 1, from 881 to 909: score 1.8, E = 5.1
                   *->ELGCDvDF.DEdFsDiaDDvLEsLiEqDv<-*
                      E G DvDF+D  F D+  Dv    i  D
  gi|1961919   881    EFGGDVDFrDSTFTDLVNDVPLFTIGADQ    909

Fil_haemagg: domain 2 of 2, from 958 to 1004: score 1.2, E = 13
                CS    EEESSEEEETTTT--EE-SEEEEEE-STT-EEEE-S-EEESSE....
                   *->vaaGaltlnaaalggldlnnggtlsagggltltaagllnnggtliag
                      +a+G+lt++aa     +++ng ++++   ++l+  g  +ngg
  gi|1961919   958    DASGNLTYTAA-----QDANGSAIVT---VSLSDDGGTANGG----- 991

                CS ...............EEEEESS-EEEEE
                   gdlllaagalrnggdltltaaGdLdnsg<-*
                                  +  +a+ +++ +
  gi|1961919   992 ---------------VDTSASQTFTITV    1004

Big_3: domain 1 of 2, from 962 to 979: score 0.7, E = 26
                   *->tVTytYkGqpvtatftVtV<-*
                      ++Tyt + + ++ ++ VtV
  gi|1961919   962    NLTYTAAQD-ANGSAIVTV    979

GBS_Bsp-like: domain 1 of 1, from 965 to 983: score 2.9, E = 2.7
                   *->YtAtkqgDGkytvtikaaN<-*
                      YtA+++++G++ vt+ +++
  gi|1961919   965    YTAAQDANGSAIVTVSLSD    983

CTV_P23: domain 1 of 1, from 969 to 997: score 0.3, E = 7.3
                   *->mdntsGqtFvsvnLsDEsntAsteveavss<-*
                       +++ G   v v LsD+  tA   v+   s
  gi|1961919   969    -QDANGSAIVTVSLSDDGGTANGGVDTSAS    997

PKD: domain 1 of 4, from 987 to 1004: score 0.6, E = 12
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      t++ gv +++++t t+tV
  gi|1961919   987    TANGGVDTSASQTFTITV    1004

Big_3: domain 2 of 2, from 993 to 1004: score 2.7, E = 7.7
                   *->q.pvtatftVtV<-*
                      ++++++tft+tV
  gi|1961919   993    DtSASQTFTITV    1004

DUF2454: domain 1 of 2, from 1011 to 1025: score 1.0, E = 4.9
                   *->pvLgqYilsnPfgtaf<-*
                      pv gq ++s+P +t++
  gi|1961919  1011    PVVGQ-TISDPTATQD    1025

Cadherin: domain 1 of 5, from 1028 to 1058: score 0.8, E = 16
                CS    --EEE-SS..  .S---EEEEE---S. .-T
                   *->ysasvpEnap..vGtevltvtAtDaDd.Plg<-*
                      +s+s+p n+ ++v   +lt+tAt aDd+Pl+
  gi|1961919  1028    FSFSIPQNSFtdVEGDPLTYTATLADDsPLP    1058

PKD: domain 2 of 4, from 1028 to 1104: score 16.6, E = 0.00015
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS.SSS
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdFGDggsp
                      +s s        ++++   +Ft+        G+p++y+ +  D+++
  gi|1961919  1028    FSFS--------IPQN---SFTDVE------GDPLTYTATLADDSPL 1057

                CS EEEECSSEEEEEESS.  ... SEEEEEEEEEEETTCEEEEEEEEEEE
                   gttstepnvtHtYskg..sVt.pGtYtVtLtvsngvgsasattttvtV<-
                   +++++   +t t+s g + ++++Gt +V++t+s+ ++++++++ ++ V
  gi|1961919  1058 PSWLSFDPATLTFS-GipAGSdVGTVNVKVTASDPASASVSSNFQLDV   1104

                CS
                   *

  gi|1961919     -   -

He_PIG: domain 1 of 4, from 1046 to 1093: score 44.7, E = 6.8e-12
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      tyt+            t+ ++++LPs+L++d++t++++G P+ +
  gi|1961919  1046    TYTA------------TLADDSPLPSWLSFDPATLTFSGIPAGS-DV 1079

                   Gsytftvtatdgsg<-*
                   G+ ++ vta+d++
  gi|1961919  1080 GTVNVKVTASDPAS    1093

YceI: domain 1 of 1, from 1059 to 1106: score 1.3, E = 6.3
                   *->tyvatlDpgahSsvsFtvrhldlggisevgrGrFd.dfstiGtldlK
                      +++ ++Dp   ++++F++      + s v  G+ + +++  +
  gi|1961919  1059    SWL-SFDP---ATLTFSGIP----AGSDV--GTVNvKVT--A----- 1088

                   EeDpeddlgassvggdvtidvaS<-*
                        +d++++sv++++ +dvaS
  gi|1961919  1089 -----SDPASASVSSNFQLDVAS    1106

Flagellin_IN: domain 1 of 2, from 1067 to 1090: score 1.1, E = 18
                   *->tltinggggkensvadgvdislsagd<-*
                      tlt++g   +++  +++v++ ++a d
  gi|1961919  1067    TLTFSGIPAGSD--VGTVNVKVTASD    1090

Cadherin: domain 2 of 5, from 1071 to 1087: score 2.4, E = 5.5
                CS    ...S---EEEE--EEE-
                   *->gggpplsstatvtitVl<-*
                      +g p+ s+++tv+++V+
  gi|1961919  1071    SGIPAGSDVGTVNVKVT    1087

Big_2: domain 1 of 4, from 1076 to 1098: score 4.6, E = 1.2
                CS    E-SSS-EEEEEEETT.TEEEEEEE
                   *->alakGtatItatsgdgnksasvtv<-*
                      +  +Gt+++++t+ d   sasv
  gi|1961919  1076    GSDVGTVNVKVTASD-PASASVSS    1098

DUF2454: domain 2 of 2, from 1110 to 1124: score 1.0, E = 4.9
                   *->pvLgqYilsnPfgtaf<-*
                      pv gq ++s+P +t++
  gi|1961919  1110    PVVGQ-TISDPTATQD    1124

PKD: domain 3 of 4, from 1137 to 1203: score 5.8, E = 0.31
                CS    B.TT.SSECEEEEE-SS.SSSEEEECSSEEEEEESS.  ... SEEE
                   *->ydpdpGspvsysWdFGDggspgttstepnvtHtYskg..sVt.pGtY
                      +d+d  +p+ y+ +  Dg++ +++++   +t t+s g +s++++Gt
  gi|1961919  1137    TDAD-SDPLIYTATLADGSPLPSWLSFDPATLTFS-GipSGSdVGTV 1181

                CS EEEEEEEETTCEEEEEEEEEEE
                   tVtLtvsngvgsasattttvtV<-*
                   +V++t++++  ++++++ ++ V
  gi|1961919  1182 NVKVTATDSSTASVSSNFQLDV    1203

He_PIG: domain 2 of 4, from 1145 to 1192: score 42.6, E = 2.7e-11
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                       yt+            t+ +g++LPs+L++d++t++++G P+ +
  gi|1961919  1145    IYTA------------TLADGSPLPSWLSFDPATLTFSGIPSGS-DV 1178

                   Gsytftvtatdgsg<-*
                   G+ ++ vtatd+s+
  gi|1961919  1179 GTVNVKVTATDSST    1192

Flagellin_IN: domain 2 of 2, from 1166 to 1190: score 4.6, E = 1.9
                   *->tltinggggkensvadgvdislsagds<-*
                      tlt++g  ++++  +++v++ ++a+ds
  gi|1961919  1166    TLTFSGIPSGSD--VGTVNVKVTATDS    1190

Cadherin: domain 3 of 5, from 1170 to 1186: score 2.7, E = 4.6
                CS    ...S---EEEE--EEE-
                   *->gggpplsstatvtitVl<-*
                      +g p+ s+++tv+++V+
  gi|1961919  1170    SGIPSGSDVGTVNVKVT    1186

Big_2: domain 2 of 4, from 1174 to 1197: score 3.7, E = 2.1
                CS    EE-SSS-EEEEEEETT.TEEEEEEE
                   *->talakGtatItatsgdgnksasvtv<-*
                      ++  +Gt+++++t+ d +++asv
  gi|1961919  1174    SGSDVGTVNVKVTATD-SSTASVSS    1197

Trehalose_PPase: domain 1 of 1, from 1176 to 1205: score 1.7, E = 3.6
                   *->ssmsglsievfatsvGskpssakyrlddps<-*
                      s+++ ++++v at+ ++  +s ++ ld++s
  gi|1961919  1176    SDVGTVNVKVTATDSSTASVSSNFQLDVAS    1205

PKD: domain 4 of 4, from 1236 to 1302: score 12.8, E = 0.0021
                CS    B.TT.SSECEEEEE-SS.SSSEEEECSSEEEEEESS.  ... SEEE
                   *->ydpdpGspvsysWdFGDggspgttstepnvtHtYskg..sVt.pGtY
                      +d+d  +p++y  +  D+++ +++++   +t t+s g +s++++Gt
  gi|1961919  1236    TDAD-SDPLTYAATLSDDSPLPSWLSFDPATRTFS-GvpSRSdVGTV 1280

                CS EEEEEEEETTCEEEEEEEEEEE
                   tVtLtvsngvgsasattttvtV<-*
                   +V++t+s+ ++++++++ ++ V
  gi|1961919  1281 NVKVTASDPASASVSSNFQLDV    1302

He_PIG: domain 3 of 4, from 1244 to 1291: score 47.5, E = 1.1e-12
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      ty++            t++++++LPs+L++d++t +++G+P+ +
  gi|1961919  1244    TYAA------------TLSDDSPLPSWLSFDPATRTFSGVPSRS-DV 1277

                   Gsytftvtatdgsg<-*
                   G+ ++ vta+d++
  gi|1961919  1278 GTVNVKVTASDPAS    1291

Cadherin: domain 4 of 5, from 1269 to 1285: score 8.1, E = 0.13
                CS    ...S---EEEE--EEE-
                   *->gggpplsstatvtitVl<-*
                      +g p++s+++tv+++V+
  gi|1961919  1269    SGVPSRSDVGTVNVKVT    1285

Peptidase_M30: domain 1 of 1, from 1272 to 1285: score 0.6, E = 4.8
                   *->PSVQTVGtlSVVVh<-*
                      PS   VGt+ V+V+
  gi|1961919  1272    PSRSDVGTVNVKVT    1285

Big_2: domain 3 of 4, from 1277 to 1296: score 4.6, E = 1.2
                CS    SS-EEEEEEETT.TEEEEEEE
                   *->kGtatItatsgdgnksasvtv<-*
                      +Gt+++++t+ d   sasv
  gi|1961919  1277    VGTVNVKVTASD-PASASVSS    1296

DAG1: domain 1 of 1, from 1314 to 1386: score 5.5, E = 0.088
                CS    XXXXXXXXXXXXXXXXXXXXXXXXXX..XXXXXXXXXXX..X..XXX
                   *->lpdssavvGraFrlhvptellassedqGiikiseadKdgheLkapsw
                      + d ++  G +F +  p + + +++    +  +++  d   L  psw
  gi|1961919  1314    ISDPTVFRGTPFSFSLPQNSFTDADS-DPLTYAATLADDSPL--PSW 1357

                CS XXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                   LhwdadsrtLqGLPLdtDKGVhyIsVSrl<-*
                   L +d   rt  G P   D G   I V ++
  gi|1961919  1358 LSFDPATRTFSGIPSRSDIGTVNIKVTAT    1386

He_PIG: domain 4 of 4, from 1343 to 1390: score 42.6, E = 2.6e-11
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      ty++            t+ ++++LPs+L++d++t +++G P+ +
  gi|1961919  1343    TYAA------------TLADDSPLPSWLSFDPATRTFSGIPSRS-DI 1376

                   Gsytftvtatdgsg<-*
                   G+ ++ vtatd+s+
  gi|1961919  1377 GTVNIKVTATDSST    1390

Cadherin: domain 5 of 5, from 1368 to 1384: score 7.6, E = 0.18
                CS    ...S---EEEE--EEE-
                   *->gggpplsstatvtitVl<-*
                      +g p++s+ +tv+i+V+
  gi|1961919  1368    SGIPSRSDIGTVNIKVT    1384

Big_2: domain 4 of 4, from 1377 to 1395: score 4.8, E = 1
                CS    S-EEEEEEETT.TEEEEEEE
                   *->GtatItatsgdgnksasvtv<-*
                      Gt++I++t+ d +++asv
  gi|1961919  1377    GTVNIKVTATD-SSTASVSS    1395

RNase_H2-Ydr279: domain 1 of 1, from 1454 to 1461: score -0.5, E = 7
                   *->mkkIssFF<-*
                      +++I+sFF
  gi|1961919  1454    RTRIDSFF    1461

DUF1901: domain 1 of 1, from 1457 to 1475: score 3.1, E = 3
                CS    S----B--GGGS-SHHHHH
                   *->IqSFFqIDikKLESrerak<-*
                      I SFF +D k+L+S  ra+
  gi|1961919  1457    IDSFFSLDGKRLSSDYRAD    1475

RhoGAP: domain 1 of 1, from 1532 to 1545: score 0.6, E = 8.4
                CS    HHHH---SS..HHH
                   *->gPtLlrppdddsad<-*
                      +P+Llr++++++++
  gi|1961919  1532    APNLLRNDATTLDL    1545

Plectin: domain 1 of 1, from 1577 to 1590: score 2.9, E = 6.5
                CS    CTTSEEECCCTCEE
                   *->aTGGliDPvtgerL<-*
                      a+G +iDP tge L
  gi|1961919  1577    ADGSIIDPLTGETL    1590

Patatin: domain 1 of 1, from 1622 to 1635: score 2.3, E = 2.9
                   *->LvLdGGGarGiaWhi<-*
                        L+GGG+ Gi+  i
  gi|1961919  1622    TTLEGGGFLGIY-LI    1635

//