hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            196192665.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|196192665|gb|EDX87629.1|
Accession:      [none]
Description:    PKD domain protein [Synechococcus sp. PCC 7335]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
PKD             PKD domain                               57.9      3e-17   2
SoxZ            Sulphur oxidation protein SoxZ           11.5     0.0058   3
Cadherin        Cadherin domain                          11.1      0.018   3
efhand_Ca_insen Ca2+ insensitive EF hand                  6.5       0.26   1
Me-amine-dh_H   Methylamine dehydrogenase heavy chain     4.2       0.36   2
DUF1999         Protein of unknown function (DUF1999)     4.6       0.52   2
DUF1072         Protein of unknown function (DUF1072)     4.6        0.8   1
vATP-synt_E     ATP synthase (E/31 kDa) subunit           3.0          1   1
SdiA-regulated  SdiA-regulated                            4.1        1.1   1
Chlam_PMP       Chlamydia polymorphic membrane protei     7.2        1.1   2
DUF2025         Protein of unknown function (DUF2025)     4.0        1.2   1
Nitro_FeMo-Co   Dinitrogenase iron-molybdenum cofacto     4.2        1.2   2
Glyco_hydro_49  Glycosyl hydrolase family 49              0.3        1.9   1
Pox_N2L         Poxvirus N2L protein                      2.3        2.1   1
Reg_prop        Two component regulator propeller         6.9        2.2   1
He_PIG          Putative Ig domain                        4.0        2.4   1
Pro_Al_protease Alpha-lytic protease prodomain            4.0        2.8   1
TFIID-18kDa     Transcription initiation factor IID,      2.7        2.8   1
DUF823          Salmonella repeat of unknown function     1.2        2.9   1
HAT             HAT (Half-A-TPR) repeat                   3.7        3.2   1
F420_oxidored   NADP oxidoreductase coenzyme F420-dep     2.0        3.2   1
DUF266          Domain of unknown function, DUF266        1.3        3.4   1
PA26            PA26 p53-induced protein (sestrin)        0.3        3.5   1
MIR             MIR domain                                1.3        4.2   1
Cas_GSU0053     CRISPR-associated protein GSU0053 (Ca     1.8        4.9   1
SCPU            Spore Coat Protein U domain               2.8        5.2   1
Peptidase_S11   D-alanyl-D-alanine carboxypeptidase       1.3        5.2   1
DJ-1_PfpI       DJ-1/PfpI family                          1.5        5.5   1
DUF811          Domain of unknown function (DUF811)       0.8        5.9   1
Dehyd-heme_bind Quinohemoprotein amine dehydrogenase      3.3        5.9   1
DUF2345         Uncharacterized protein conserved in      1.7        6.2   1
RE_MjaII        MjaII restriction endonuclease            0.4        6.2   1
VirC1           VirC1 protein                             0.6        6.3   1
DUF834          Domain of unknown function (DUF834)       2.6        6.5   1
Lin0512_fam     Conserved hypothetical protein (Lin05     1.5        6.6   1
DUF2134         Predicted membrane protein (DUF2134)      1.5        6.9   1
Orbi_VP4        Orbivirus VP4 core protein               -0.6        7.1   1
gp12-short_mid  Phage short tail fibre protein gp12,      1.3        7.4   1
Staphylokinase  Staphylokinase/Streptokinase family       1.7        7.6   1
DUF1222         Protein of unknown function (DUF1222)    -0.9        7.7   1
PG_binding_1    Putative peptidoglycan binding domain     3.1        7.7   2
PSCyt1          Planctomycete cytochrome C                1.2        7.8   1
DUF721          Protein of unknown function (DUF721)      1.4        7.8   1
NPCBM_assoc     NPCBM-associated, NEW3 domain of alph     2.0        8.1   1
MTHFR           Methylenetetrahydrofolate reductase      -0.2        8.7   1
DUF1556         Protein of unknown function (DUF1556)     1.3        8.8   1
DUF2402         Putative GPI-anchored glycine-serine      1.9        9.2   1
MIP             Major intrinsic protein                  -0.4        9.3   1
DUF490          Family of unknown function (DUF490)      -0.2        9.4   1
HipA_N          HipA-like N-terminal domain              -0.4        9.5   1
Flexi_CP        Viral coat protein                        0.9        9.6   1
Dymeclin        Dyggve-Melchior-Clausen syndrome prot    -1.3        9.6   1
DUF738          Protein of unknown function (DUF738)      1.0        9.7   1
TNV_CP          Satellite tobacco necrosis virus coat    -0.2        9.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Pro_Al_protease   1/1     143   162 ..    49    68 .]     4.0      2.8
DUF721            1/1     196   221 ..    39    73 ..     1.4      7.8
MIR               1/1     253   263 ..     1    11 [.     1.3      4.2
RE_MjaII          1/1     274   281 ..     1     8 [.     0.4      6.2
F420_oxidored     1/1     333   357 ..   229   253 .]     2.0      3.2
TFIID-18kDa       1/1     371   381 ..     1    11 [.     2.7      2.8
Dehyd-heme_bind   1/1     411   426 ..    53    68 .]     3.3      5.9
DUF738            1/1     415   426 ..    95   106 ..     1.0      9.7
Reg_prop          1/1     561   585 ..     1    23 []     6.9      2.2
DUF811            1/1     569   585 ..   263   279 .]     0.8      5.9
MTHFR             1/1     641   654 ..    95   108 ..    -0.2      8.7
Cas_GSU0053       1/1     646   659 ..   182   199 .]     1.8      4.9
DUF1072           1/1     685   690 ..     1     6 [.     4.6      0.8
Chlam_PMP         1/2     690   737 ..     1    19 []     1.6       38
gp12-short_mid    1/1     730   746 ..    65    81 .]     1.3      7.4
MIP               1/1     732   740 ..   255   263 .]    -0.4      9.3
Orbi_VP4          1/1     758   767 ..   642   651 .]    -0.6      7.1
HAT               1/1     759   771 ..    21    33 .]     3.7      3.2
SCPU              1/1     818   857 ..    11    52 ..     2.8      5.2
DUF834            1/1     823   843 ..     1    21 [.     2.6      6.5
Glyco_hydro_49    1/1     825   846 ..     1    22 [.     0.3      1.9
PKD               1/2     835   918 ..     1    92 []    55.9  1.2e-16
PSCyt1            1/1     845   867 ..    20    47 ..     1.2      7.8
He_PIG            1/1     894   907 ..    48    61 .]     4.0      2.4
Peptidase_S11     1/1     906   930 ..     1    25 [.     1.3      5.2
TNV_CP            1/1     926   936 ..    81    91 ..    -0.2      9.9
PKD               2/2     929   962 ..     1    41 [.     2.0      4.4
DUF2134           1/1     931   947 ..    94   115 .]     1.5      6.9
NPCBM_assoc       1/1     935   952 ..     1    18 [.     2.0      8.1
Chlam_PMP         2/2    1025  1040 ..     1    19 []     5.6      3.1
efhand_Ca_insen   1/1    1085  1093 ..     1     9 [.     6.5     0.26
Flexi_CP          1/1    1105  1120 ..   119   134 ..     0.9      9.6
SdiA-regulated    1/1    1167  1179 ..    94   106 .]     4.1      1.1
PG_binding_1      1/2    1317  1351 ..     1    33 [.     2.4       11
Me-amine-dh_H     1/2    1361  1379 ..   325   343 .]     1.9      1.6
DUF2402           1/1    1467  1497 ..    27    63 ..     1.9      9.2
VirC1             1/1    1504  1519 ..    42    57 ..     0.6      6.3
SoxZ              1/3    1510  1527 ..    87   104 .]     5.1     0.52
Cadherin          1/3    1513  1528 ..    83   107 .]     0.9       15
HipA_N            1/1    1600  1608 ..    99   107 .]    -0.4      9.5
Dymeclin          1/1    1610  1626 ..   775   791 .]    -1.3      9.6
Nitro_FeMo-Co     1/2    1630  1639 ..     1    10 [.     1.0       11
DUF1999           1/2    1662  1680 ..   150   168 .]     2.3      2.3
Lin0512_fam       1/1    1770  1785 ..   101   116 .]     1.5      6.6
Staphylokinase    1/1    1794  1829 ..     1    44 [.     1.7      7.6
Me-amine-dh_H     2/2    1818  1831 ..   330   343 .]     2.3      1.2
vATP-synt_E       1/1    1825  1847 ..   146   182 ..     3.0        1
DJ-1_PfpI         1/1    1829  1866 ..     1    55 [.     1.5      5.5
SoxZ              2/3    1860  1882 ..    82   104 .]     3.6      1.5
Cadherin          2/3    1865  1883 ..    80   107 .]     5.0        1
DUF266            1/1    1955  1970 ..   244   259 ..     1.3      3.4
PG_binding_1      2/2    2092  2114 ..     1    26 [.     0.6       35
Pox_N2L           1/1    2095  2108 ..   213   226 .]     2.3      2.1
PA26              1/1    2173  2198 ..     1    26 [.     0.3      3.5
SoxZ              3/3    2194  2211 ..    87   104 .]     2.8      2.8
Cadherin          3/3    2196  2212 ..    82   107 .]     5.3     0.86
DUF2345           1/1    2243  2260 ..     1    18 [.     1.7      6.2
DUF2025           1/1    2288  2299 ..    95   106 .]     4.0      1.2
DUF490            1/1    2320  2353 ..     1    38 [.    -0.2      9.4
DUF823            1/1    2325  2333 ..     1     9 [.     1.2      2.9
DUF1556           1/1    2442  2451 ..    89    98 .]     1.3      8.8
Nitro_FeMo-Co     2/2    2569  2588 ..     1    20 [.     3.2      2.4
DUF1222           1/1    2574  2585 ..   473   484 .]    -0.9      7.7
DUF1999           2/2    2601  2619 ..   150   168 .]     2.3      2.3

Alignments of top-scoring domains:
Pro_Al_protease: domain 1 of 1, from 143 to 162: score 4.0, E = 2.8
                CS    .HCCCHCCHCCCTEECCCEC
                   *->gtvaaaafaklagvaaglvr<-*
                      gt++++ +a+la++++++v+
  gi|1961926   143    GTEGGELIATLAELTGADVA    162

DUF721: domain 1 of 1, from 196 to 221: score 1.4, E = 7.8
                   *->alAahtrPvkl.rfprrkekgepgdG.tLvvrvesga<-*
                      a+A++t ++ l++           +G +L+++++sg+
  gi|1961926   196    AIANYTSVLALpQ-----------NGvVLHLEADSGV    221

MIR: domain 1 of 1, from 253 to 263: score 1.3, E = 4.2
                   *->GyLhsgdvlrl<-*
                      G L+++dv+r+
  gi|1961926   253    GELNGHDVVRF    263

RE_MjaII: domain 1 of 1, from 274 to 281: score 0.4, E = 6.2
                   *->MnlSpLPG<-*
                      Mnl++LPG
  gi|1961926   274    MNLNDLPG    281

F420_oxidored: domain 1 of 1, from 333 to 357: score 2.0, E = 3.2
                CS    .CSTTEEEEEEESGGGHHHHHTHHH
                   *->ddvtGfggvdiGgLralerleprta<-*
                      d++tG +g+  G L+++  le++t+
  gi|1961926   333    DQFTGSAGTGQGWLSQAAILESGTL    357

TFIID-18kDa: domain 1 of 1, from 371 to 381: score 2.7, E = 2.8
                CS    X--CCCCHHHH
                   *->hlFrkeLqsMM<-*
                      h F+++Lq+++
  gi|1961926   371    HDFNTDLQQLV    381

Dehyd-heme_bind: domain 1 of 1, from 411 to 426: score 3.3, E = 5.9
                CS    HHTHHHHHHHHSBS--
                   *->ldevvpaLAkrYPLds<-*
                      +++v  +LA++Y+L++
  gi|1961926   411    QNDVQDFLAQKYGLET    426

DUF738: domain 1 of 1, from 415 to 426: score 1.0, E = 9.7
                   *->LkFLsKhYgLkr<-*
                      + FL+++YgL++
  gi|1961926   415    QDFLAQKYGLET    426

Reg_prop: domain 1 of 1, from 561 to 585: score 6.9, E = 2.2
                   *->slpgg.vtfalledsdGrlWigt.n<-*
                       + ++++ +++  ++dG+l+i+t++
  gi|1961926   561    IIDSNhYGGSFGFGPDGYLYIATgD    585

DUF811: domain 1 of 1, from 569 to 585: score 0.8, E = 5.9
                   *->GyvrmdeDGtLdvdlps<-*
                      G++ +++DG L+++ +
  gi|1961926   569    GSFGFGPDGYLYIATGD    585

MTHFR: domain 1 of 1, from 641 to 654: score -0.2, E = 8.7
                   *->ddaLedakelGIRN<-*
                      dd+L+ ++++G+RN
  gi|1961926   641    DDILDEIWAYGLRN    654

Cas_GSU0053: domain 1 of 1, from 646 to 659: score 1.8, E = 4.9
                   *->tIrAYgVkpvvGDRqsga<-*
                      +I+AYg++ +     +g+
  gi|1961926   646    EIWAYGLRNA----FRGG    659

DUF1072: domain 1 of 1, from 685 to 690: score 4.6, E = 0.8
                   *->MdDLHV<-*
                      M+DLHV
  gi|1961926   685    MEDLHV    690

Chlam_PMP: domain 1 of 2, from 690 to 737: score 1.6, E = 38
                   *->ditFsgNsa.............................aggGGAiya
                        t  +N+a+ + +++ ++ ++++  +++  + ++ + +++GGAi++
  gi|1961926   690    VATVADNGAnfgwdgsvegftgnpafsdplysynhagaSPNGGAIVG 736

                   s<-*

  gi|1961926   737 G    737

gp12-short_mid: domain 1 of 1, from 730 to 746: score 1.3, E = 7.4
                CS    SS-EEEEEEEEEEEEEE
                   *->NGiasitGtvkntdqyv<-*
                      NG+a  +Gtv  +d y
  gi|1961926   730    NGGAIVGGTVYRGDLYP    746

MIP: domain 1 of 1, from 732 to 740: score -0.4, E = 9.3
                CS    HHHHHHHHH
                   *->GAalaaLvY<-*
                      GA++++ vY
  gi|1961926   732    GAIVGGTVY    740

Orbi_VP4: domain 1 of 1, from 758 to 767: score -0.6, E = 7.1
                   *->rVesWldyLR<-*
                      +V++W+ yL
  gi|1961926   758    YVQGWIRYLQ    767

HAT: domain 1 of 1, from 759 to 771: score 3.7, E = 3.2
                   *->vknWikyArFEEe<-*
                      v+ Wi+y +F+++
  gi|1961926   759    VQGWIRYLQFDDN    771

SCPU: domain 1 of 1, from 818 to 857: score 2.8, E = 5.2
                   *->rtevwg.sGq..kdvgsatlldtlglgtaqtnttqlpiYgrivlp<-
                      r++++++sG+  + +++a +++t g ++       +++ g++++p
  gi|1961926   818    RRIAYNgSGNlaPTITTARANTTSGAPDLA-----VTFTGAAIDP   857

                   *

  gi|1961926     -   -

DUF834: domain 1 of 1, from 823 to 843: score 2.6, E = 6.5
                   *->rarnaavptttadtartaaat<-*
                      ++ ++++pt+t+++a+t+ ++
  gi|1961926   823    NGSGNLAPTITTARANTTSGA    843

Glyco_hydro_49: domain 1 of 1, from 825 to 846: score 0.3, E = 1.9
                CS    XXXXXXXXXXXXX----BSSSE
                   *->pgtsspAlkveqaavTangadL<-*
                       g+++p + +++a++T   +dL
  gi|1961926   825    SGNLAPTITTARANTTSGAPDL    846

PKD: domain 1 of 2, from 835 to 918: score 55.9, E = 1.2e-16
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-SS   .
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdFGD...g
                      + a+      +++a+ + VtFt+ +  dp   + +sy+WdFG +++
  gi|1961926   835    ARAN-----TTSGAPDLAVTFTGAA-IDPE-DDELSYLWDFGFdgdA 874

                CS SSSEEEECSSEEEEEESS....SEEEEEEEEEEETTCEEEEEEEEEEE
                   gspgttstepnvtHtYskgsVtpGtYtVtLtvsngvgsasattttvtV<-
                   ++   tst  n+t+tY+      G Yt++Ltvs+g +++++  +++ V
  gi|1961926   875 DGMNDTSTDANPTYTYTD----NGAYTARLTVSDGINTTNSEPIQIAV   918

                CS
                   *

  gi|1961926     -   -

PSCyt1: domain 1 of 1, from 845 to 867: score 1.2, E = 7.8
                   *->srdaalrgGdSGEaaivPGdpdaSelwe<-*
                      +++  + g     aai+P+d + S+lw+
  gi|1961926   845    DLAVTFTG-----AAIDPEDDELSYLWD    867

He_PIG: domain 1 of 1, from 894 to 907: score 4.0, E = 2.4
                   *->Gsytftvtatdgsg<-*
                      G+yt+++t++dg +
  gi|1961926   894    GAYTARLTVSDGIN    907

Peptidase_S11: domain 1 of 1, from 906 to 930: score 1.3, E = 5.2
                CS    XXXX----.--SSSEEEEEETTT--
                   *->aatavsapleIaAksAilvDynTGk<-*
                      + t+ s+p++Ia +sA +v+ +T++
  gi|1961926   906    INTTNSEPIQIAVGSAPVVNITTNQ    930

TNV_CP: domain 1 of 1, from 926 to 936: score -0.2, E = 9.9
                CS    -SS-EE...EE
                   *->iTtSqnSGFfR<-*
                      iTt q+SGFfR
  gi|1961926   926    ITTNQSSGFFR    936

PKD: domain 2 of 2, from 929 to 962: score 2.0, E = 4.4
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE-
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWdF<-*
                       ++s      +++ +get t ta+++ d++  +  sy+Wd+
  gi|1961926   929    NQSS------GFFRAGETLTATATATDDGP-LDESSYEWDV    962

DUF2134: domain 1 of 1, from 931 to 947: score 1.5, E = 6.9
                   *->agilGilfGlppsrtlsAtAtA<-*
                      ++++++     ++ tl+AtAtA
  gi|1961926   931    SSGFFR-----AGETLTATATA    947

NPCBM_assoc: domain 1 of 1, from 935 to 952: score 2.0, E = 8.1
                   *->vvaGrtvtvtatftndgt<-*
                        aG+t t tat+t+dg+
  gi|1961926   935    FRAGETLTATATATDDGP    952

Chlam_PMP: domain 2 of 2, from 1025 to 1040: score 5.6, E = 3.1
                   *->ditFsgNsaaggGGAiyas<-*
                      d+tF++N+    GG+i  +
  gi|1961926  1025    DLTFNSNL---PGGGIDLT    1040

efhand_Ca_insen: domain 1 of 1, from 1085 to 1093: score 6.5, E = 0.26
                   *->DtdTaEQVi<-*
                      Dtd+aEQVi
  gi|1961926  1085    DTDSAEQVI    1093

Flexi_CP: domain 1 of 1, from 1105 to 1120: score 0.9, E = 9.6
                   *->DgVlnpAAlqPpeGLi<-*
                      ++ +n+AA+ P++GL+
  gi|1961926  1105    NYINNGAAPLPSDGLV    1120

SdiA-regulated: domain 1 of 1, from 1167 to 1179: score 4.1, E = 1.1
                   *->llEldleGevvsf<-*
                      ++Eld +G+++s+
  gi|1961926  1167    VIELDGDGDQLSR    1179

PG_binding_1: domain 1 of 2, from 1317 to 1351: score 2.4, E = 11
                CS    BSHHHHHHHHHT..TT-S   -..--SSB--H HHHH
                   *->sgedVkelQqyLkrlGyy...gsppvDGyfGp.TeeA<-*
                      s+++ +++Q yL+  ++ +++g  ++    ++ T+ A
  gi|1961926  1317    SETEQQQVQSYLQDKYFGstdG--QPVAALDNaTTTA    1351

Me-amine-dh_H: domain 1 of 2, from 1361 to 1379: score 1.9, E = 1.6
                CS    EEEEE----SS--EEEE--
                   *->elssVdqLGrgPqviltaD<-*
                      el s d+LG  P+ i+  D
  gi|1961926  1361    ELLSNDELGDTPTTITDVD    1379

DUF2402: domain 1 of 1, from 1467 to 1497: score 1.9, E = 9.2
                   *->dgpVtLvLlkGpstntldpvsTIassipnsGsYtWtv<-*
                      d+p+t++ ++  st     +++I+ +++  GsYt t+
  gi|1961926  1467    DEPTTITAVDTTSTE----GGVIVDNAD--GSYTYTP    1497

VirC1: domain 1 of 1, from 1504 to 1519: score 0.6, E = 6.3
                   *->LeeFDYALADtrGGss<-*
                      ++ FDY +ADt G ss
  gi|1961926  1504    IDSFDYTIADTDGDSS    1519

SoxZ: domain 1 of 3, from 1510 to 1527: score 5.1, E = 0.52
                CS    EEEETTS-EEEEEEEE--
                   *->sWtDnkGssetaeakItv<-*
                      ++ D +G+s ta+++++v
  gi|1961926  1510    TIADTDGDSSTATVSVEV    1527

Cadherin: domain 1 of 3, from 1513 to 1528: score 0.9, E = 15
                CS    --.........S---EEEE--EEE-
                   *->DadpllasgggpplsstatvtitVl<-*
                      D d         + sstatv ++V
  gi|1961926  1513    DTD---------GDSSTATVSVEVV    1528

HipA_N: domain 1 of 1, from 1600 to 1608: score -0.4, E = 9.5
                   *->AlvvkRFDR<-*
                      A+  +RFD+
  gi|1961926  1600    AFSFERFDY    1608

Dymeclin: domain 1 of 1, from 1610 to 1626: score -1.3, E = 9.6
                   *->sGvhFnpssIklfpvds<-*
                      sG+hFn ++ ++f+v +
  gi|1961926  1610    SGLHFNGDVNAGFTVTG    1626

Nitro_FeMo-Co: domain 1 of 2, from 1630 to 1639: score 1.0, E = 11
                CS    TTSBB-SBTT
                   *->dgsrVnqHFG<-*
                      dg+ ++q FG
  gi|1961926  1630    DGGEISQRFG    1639

DUF1999: domain 1 of 2, from 1662 to 1680: score 2.3, E = 2.3
                   *->AVihLGtRaarapgkkllr<-*
                      AV+ LG R a+ ++  + +
  gi|1961926  1662    AVRFLGDRIATSETDTITQ    1680

Lin0512_fam: domain 1 of 1, from 1770 to 1785: score 1.5, E = 6.6
                   *->dkgDtivIAnAaVeVg<-*
                      d++++i +A++ VeV
  gi|1961926  1770    DANGDISVATVTVEVK    1785

Staphylokinase: domain 1 of 1, from 1794 to 1829: score 1.7, E = 7.6
                CS    CSESCCCSSEEEEEEEEEEETTS-CCEEEEEEEEEEXTTSEEEH
                   *->npaesvnteykvsfnvkgvDldfnellvdqYhlgtllsgktltk<-*
                      + a+s++te++v ++ + vDl +n  l+d         ++t+t+
  gi|1961926  1794    AVADSATTEQDVAVVLNAVDLLSNDDLGD--------APTTITA    1829

Me-amine-dh_H: domain 2 of 2, from 1818 to 1831: score 2.3, E = 1.2
                CS    ----SS--EEEE--
                   *->dqLGrgPqviltaD<-*
                      d+LG +P+ i+  D
  gi|1961926  1818    DDLGDAPTTITAVD    1831

vATP-synt_E: domain 1 of 1, from 1825 to 1847: score 3.0, E = 1
                   *->tvetigdnedfLppGPksdkhGidciGGVvlegedGk<-*
                      t++t++d+               +++GG ++ ++dG+
  gi|1961926  1825    TTITAVDT--------------ASVSGGAIVDNADGT    1847

DJ-1_PfpI: domain 1 of 1, from 1829 to 1866: score 1.5, E = 5.5
                CS    EEEEEESSTTC-..-EEE-TTS......TSCHEEECSEEGGGHTGGG
                   *->evtvvspnkgkgdcvevkgkrgggaqyekggvkvtadkslddvnadd
                      +v+++s++ g+    +v + +g         ++ t+++ + + ++
  gi|1961926  1829    AVDTASVSGGA----IVDNADG--------TYTYTPANGFIGQDT-- 1861

                CS ...ESEEE
                   aAayDalv<-*
                      +D ++
  gi|1961926  1862 ---FDYVI    1866

SoxZ: domain 2 of 3, from 1860 to 1882: score 3.6, E = 1.5
                CS    E.EEEEEEETTS-EEEEEEEE--
                   *->delkfsWtDnkGssetaeakItv<-*
                      d++  ++tD +G+s ta+++++v
  gi|1961926  1860    DTFDYVITDADGDSSTATVSVNV    1882

Cadherin: domain 2 of 3, from 1865 to 1883: score 5.0, E = 1
                CS    E----.........S---EEEE--EEE-
                   *->eAtDadpllasgggpplsstatvtitVl<-*
                      + tDad         + sstatv ++V
  gi|1961926  1865    VITDAD---------GDSSTATVSVNVV    1883

DUF266: domain 1 of 1, from 1955 to 1970: score 1.3, E = 3.4
                   *->LLnmldlpsgnaNRTv<-*
                      LLn+ +lp++naNR++
  gi|1961926  1955    LLNLNGLPTENANRSL    1970

PG_binding_1: domain 2 of 2, from 2092 to 2114: score 0.6, E = 35
                CS    BSHHHHHHHHHT..TT-S-..--SSB
                   *->sgedVkelQqyLkrlGyygsppvDGy<-*
                      s++++++++ yL+  ++ g  +v+G+
  gi|1961926  2092    SDTERQQVEGYLQDKYF-G--SVNGQ    2114

Pox_N2L: domain 1 of 1, from 2095 to 2108: score 2.3, E = 2.1
                   *->krkeFkdYvedkYp<-*
                      +r+  + Y+ dkY+
  gi|1961926  2095    ERQQVEGYLQDKYF    2108

PA26: domain 1 of 1, from 2173 to 2198: score 0.3, E = 3.5
                   *->srgpsaFipekevlsqdcfaatqtga<-*
                           +++p+++ + qd fa t t a
  gi|1961926  2173    VDDTIDYVPDEGFVGQDSFAYTITDA    2198

SoxZ: domain 3 of 3, from 2194 to 2211: score 2.8, E = 2.8
                CS    EEEETTS-EEEEEEEE--
                   *->sWtDnkGssetaeakItv<-*
                      ++tD +G++ ta ++++v
  gi|1961926  2194    TITDADGDTSTANVTVEV    2211

Cadherin: domain 3 of 3, from 2196 to 2212: score 5.3, E = 0.86
                CS    ---.........S---EEEE--EEE-
                   *->tDadpllasgggpplsstatvtitVl<-*
                      tDad         + +sta vt++V+
  gi|1961926  2196    TDAD---------GDTSTANVTVEVT    2212

DUF2345: domain 1 of 1, from 2243 to 2260: score 1.7, E = 6.2
                   *->gggtgganpfpefaqPll<-*
                      + + g++n+  +f++P+l
  gi|1961926  2243    ADQSGSGNDLIGFGDPML    2260

DUF2025: domain 1 of 1, from 2288 to 2299: score 4.0, E = 1.2
                   *->DLPEIeAqRsll<-*
                      DLPE +A+Rsl
  gi|1961926  2288    DLPEGNAERSLF    2299

DUF490: domain 1 of 1, from 2320 to 2353: score -0.2, E = 9.4
                   *->ldglsatglgggGtltasGtldlaadlpadLtikgvad<-*
                       ++++a  ++++Gtl ++G  ++ +d++ ++t +g  d
  gi|1961926  2320    NRAFGAV-TDSDGTLMVQGWGGM-NDFDSNVTGTG--D    2353

DUF823: domain 1 of 1, from 2325 to 2333: score 1.2, E = 2.9
                   *->GvTgAdGta<-*
                      +vT++dGt+
  gi|1961926  2325    AVTDSDGTL    2333

DUF1556: domain 1 of 1, from 2442 to 2451: score 1.3, E = 8.8
                   *->rstSslplan<-*
                      +st+++++an
  gi|1961926  2442    QSTAITDGAN    2451

Nitro_FeMo-Co: domain 2 of 2, from 2569 to 2588: score 3.2, E = 2.4
                CS    TTSBB-SBTTT-SEEEEEEE
                   *->dgsrVnqHFGrAprFaIYev<-*
                      dg+ ++q FG A+    +e+
  gi|1961926  2569    DGGEISQRFGPATSLDTFET    2588

DUF1222: domain 1 of 1, from 2574 to 2585: score -0.9, E = 7.7
                   *->veeYfPavsldd<-*
                      + +++Pa+sld+
  gi|1961926  2574    SQRFGPATSLDT    2585

DUF1999: domain 2 of 2, from 2601 to 2619: score 2.3, E = 2.3
                   *->AVihLGtRaarapgkkllr<-*
                      AV+ LG R a+ ++  + +
  gi|1961926  2601    AVRFLGDRIATSETDTITQ    2619

//