hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            196258170.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|196258170|ref|ZP_03156705.1|
Accession:      [none]
Description:    LVIVD repeat protein [Cyanothece sp. PCC 7822]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
LVIVD           LVIVD repeat                             64.7    5.5e-18   3
SASP            Small, acid-soluble spore proteins, a     4.4          2   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
SASP              1/1     121   142 ..    40    61 .]     4.4        2
LVIVD             1/3     188   196 ..    34    42 .]     2.6      6.7
LVIVD             2/3     197   236 ..     1    40 [.    51.8    3e-14
LVIVD             3/3     237   252 ..     1    16 [.    10.2    0.041

Alignments of top-scoring domains:
SASP: domain 1 of 1, from 121 to 142: score 4.4, E = 2
                   *->aNGsVGGEiTKrLVqmaeqqlg<-*
                      a G VG E +K+L q+ e+ +
  gi|1962581   121    AAGNVGKEFVKKLHQLTEANIR    142

LVIVD: domain 1 of 3, from 188 to 196: score 2.6, E = 6.7
                   *->Pilkgsydt<-*
                      P+l+g ydt
  gi|1962581   188    PVLVGTYDT    196

LVIVD: domain 2 of 3, from 197 to 236: score 51.8, E = 3e-14
                   *->gGdaqdvsVsGNYAYVAdgdngLvIVDISNPSsPilkgsy<-*
                      +G+a++v V  N AYVAd   gL I+DI+NP+sP+lkg y
  gi|1962581   197    PGYARNVQVVNNLAYVADYRSGLQIIDITNPASPVLKGTY    236

LVIVD: domain 3 of 3, from 237 to 252: score 10.2, E = 0.041
                   *->gGdaqdvsVsGNYAYV<-*
                       G+a++v V GN AYV
  gi|1962581   237    SGNAWNVQVVGNLAYV    252

//