hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            210126614.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|210126614|gb|EEA74300.1|
Accession:      [none]
Description:    hypothetical protein BRAFLDRAFT_118891 [Branchiostoma floridae]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
IQ              IQ calmodulin-binding motif              25.3    2.4e-06   1
Ca_chan_IQ      Voltage gated calcium channel IQ doma     7.3       0.37   1
MRP-S27         Mitochondrial 28S ribosomal protein S     3.6       0.79   1
FliX            Class II flagellar assembly regulator     3.3        0.8   1
zf-C3HC4        Zinc finger, C3HC4 type (RING finger)     2.4        1.3   1
Connexin        Connexin                                  1.5        2.8   1
DUF479          Protein of unknown function, DUF479       2.4        3.5   1
DUF1174         Repeat of unknown function (DUF1174)      4.0          5   1
Baculo_helicase Baculovirus DNA helicase                 -1.9        5.3   1
SDF             Sodium:dicarboxylate symporter family     0.2        5.9   1
TM_helix        Conserved TM helix                        2.9          6   1
Tmemb_55A       Transmembrane protein 55A                -0.3          6   1
Phage-tail_1    Baseplate structural protein, domain     -0.6        7.6   1
DUF499          Protein of unknown function (DUF499)     -2.1        8.5   1
PHD             PHD-finger                                0.6        9.4   1
NODP            NOTCH protein                             1.9        9.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
NODP              1/1      19    33 ..    52    66 .]     1.9      9.9
IQ                1/1     100   120 ..     1    21 []    25.3  2.4e-06
SDF               1/1     100   109 ..   448   457 .]     0.2      5.9
Ca_chan_IQ        1/1     106   126 ..    15    35 .]     7.3     0.37
MRP-S27           1/1     107   137 ..   455   485 .]     3.6     0.79
DUF479            1/1     161   178 ..    67    84 ..     2.4      3.5
Tmemb_55A         1/1     173   183 ..     1    18 [.    -0.3        6
DUF1174           1/1     230   255 ..     1    26 []     4.0        5
FliX              1/1     282   298 ..     1    18 [.     3.3      0.8
DUF499            1/1     294   301 ..     1     8 [.    -2.1      8.5
zf-C3HC4          1/1     335   350 ..    35    50 .]     2.4      1.3
Baculo_helicase   1/1     463   474 ..     1    12 [.    -1.9      5.3
PHD               1/1     479   486 ..    46    53 .]     0.6      9.4
Connexin          1/1     524   541 ..     1    19 [.     1.5      2.8
TM_helix          1/1     525   541 ..    37    53 .]     2.9        6
Phage-tail_1      1/1     543   551 ..   189   197 .]    -0.6      7.6

Alignments of top-scoring domains:
NODP: domain 1 of 1, from 19 to 33: score 1.9, E = 9.9
                   *->IesVtSepdepstpe<-*
                      I++VtS +++p++++
  gi|2101266    19    ISAVTSNTPKPPGNK    33

IQ: domain 1 of 1, from 100 to 120: score 25.3, E = 2.4e-06
                CS    HHHCHHHHHHHHHHHHHHHHH
                   *->rraaikIQaawRGylaRkryk<-*
                        aa++IQ+++RGy++Rk ++
  gi|2101266   100    MLAAVIIQRWFRGYKTRKDLE    120

SDF: domain 1 of 1, from 100 to 109: score 0.2, E = 5.9
                   *->alaaiivakl<-*
                      +laa+i+ ++
  gi|2101266   100    MLAAVIIQRW    109

Ca_chan_IQ: domain 1 of 1, from 106 to 126: score 7.3, E = 0.37
                   *->IQdYFRkFkkRKeeekkgkep<-*
                      IQ +FR +k RK  e +++ +
  gi|2101266   106    IQRWFRGYKTRKDLETEQRMA    126

MRP-S27: domain 1 of 1, from 107 to 137: score 3.6, E = 0.79
                   *->klwqrkkkkreqaDeEERitYyqqrhatraa<-*
                      ++w+r  k r+ +++E R+   +qr  +r+a
  gi|2101266   107    QRWFRGYKTRKDLETEQRMARVIQRQFRRRA    137

DUF479: domain 1 of 1, from 161 to 178: score 2.4, E = 3.5
                   *->rmarRlsRpnpLagavee<-*
                      rm +R++R++ La+ v+e
  gi|2101266   161    RMGQRSPRTAKLADPVGE    178

Tmemb_55A: domain 1 of 1, from 173 to 183: score -0.3, E = 6
                   *->MdadGeDHLRNqErsPLL<-*
                        ad++      ErsPLL
  gi|2101266   173    --ADPVG-----ERSPLL    183

DUF1174: domain 1 of 1, from 230 to 255: score 4.0, E = 5
                   *->ssEetttsAvtEasgEEtttsAvtEa<-*
                      ss +tt     E+++  tt    t+a
  gi|2101266   230    SSKNTTGQGSAEGASSNTTGQGLTDA    255

FliX: domain 1 of 1, from 282 to 298: score 3.3, E = 0.8
                   *->MrisGprgttaasggkak<-*
                       +is++++ ta+s++ +k
  gi|2101266   282    -KISDTNSLTAVSPRDSK    298

DUF499: domain 1 of 1, from 294 to 301: score -2.1, E = 8.5
                   *->PrALeDkE<-*
                      Pr+++DkE
  gi|2101266   294    PRDSKDKE    301

zf-C3HC4: domain 1 of 1, from 335 to 350: score 2.4, E = 1.3
                CS    HHHHHHHCTSSSTTTT
                   *->lkkwlkssgnttCplC<-*
                      l++ l+ss  t+C +C
  gi|2101266   335    LENSLQSSQRTYCTVC    350

Baculo_helicase: domain 1 of 1, from 463 to 474: score -1.9, E = 5.3
                   *->mIfedIfnsyqt<-*
                      ++fe+I+ ++q+
  gi|2101266   463    DSFEKILSAIQS    474

PHD: domain 1 of 1, from 479 to 486: score 0.6, E = 9.4
                CS    --TTTCTC
                   *->yCpeCkpk<-*
                      yCp Ck+k
  gi|2101266   479    YCPGCKAK    486

Connexin: domain 1 of 1, from 524 to 541: score 1.5, E = 2.8
                CS    -TTHHHHHHHHHHHHHTSS
                   *->dWsfLgkLLegVnkhSTai<-*
                       W++Lg++ ++    ST+i
  gi|2101266   524    -WKALGNMMSKLEPDSTVI    541

TM_helix: domain 1 of 1, from 525 to 541: score 2.9, E = 6
                   *->dlvaklLkklgldslva<-*
                      +++++++ kl++ds+v
  gi|2101266   525    KALGNMMSKLEPDSTVI    541

Phage-tail_1: domain 1 of 1, from 543 to 551: score -0.6, E = 7.6
                CS    SSEEEEEEH
                   *->idGisImDy<-*
                      i+G ++m+y
  gi|2101266   543    IMGCNVMGY    551

//