hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 210126614.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|210126614|gb|EEA74300.1|
Accession: [none]
Description: hypothetical protein BRAFLDRAFT_118891 [Branchiostoma floridae]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
IQ IQ calmodulin-binding motif 25.3 2.4e-06 1
Ca_chan_IQ Voltage gated calcium channel IQ doma 7.3 0.37 1
MRP-S27 Mitochondrial 28S ribosomal protein S 3.6 0.79 1
FliX Class II flagellar assembly regulator 3.3 0.8 1
zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.4 1.3 1
Connexin Connexin 1.5 2.8 1
DUF479 Protein of unknown function, DUF479 2.4 3.5 1
DUF1174 Repeat of unknown function (DUF1174) 4.0 5 1
Baculo_helicase Baculovirus DNA helicase -1.9 5.3 1
SDF Sodium:dicarboxylate symporter family 0.2 5.9 1
TM_helix Conserved TM helix 2.9 6 1
Tmemb_55A Transmembrane protein 55A -0.3 6 1
Phage-tail_1 Baseplate structural protein, domain -0.6 7.6 1
DUF499 Protein of unknown function (DUF499) -2.1 8.5 1
PHD PHD-finger 0.6 9.4 1
NODP NOTCH protein 1.9 9.9 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
NODP 1/1 19 33 .. 52 66 .] 1.9 9.9
IQ 1/1 100 120 .. 1 21 [] 25.3 2.4e-06
SDF 1/1 100 109 .. 448 457 .] 0.2 5.9
Ca_chan_IQ 1/1 106 126 .. 15 35 .] 7.3 0.37
MRP-S27 1/1 107 137 .. 455 485 .] 3.6 0.79
DUF479 1/1 161 178 .. 67 84 .. 2.4 3.5
Tmemb_55A 1/1 173 183 .. 1 18 [. -0.3 6
DUF1174 1/1 230 255 .. 1 26 [] 4.0 5
FliX 1/1 282 298 .. 1 18 [. 3.3 0.8
DUF499 1/1 294 301 .. 1 8 [. -2.1 8.5
zf-C3HC4 1/1 335 350 .. 35 50 .] 2.4 1.3
Baculo_helicase 1/1 463 474 .. 1 12 [. -1.9 5.3
PHD 1/1 479 486 .. 46 53 .] 0.6 9.4
Connexin 1/1 524 541 .. 1 19 [. 1.5 2.8
TM_helix 1/1 525 541 .. 37 53 .] 2.9 6
Phage-tail_1 1/1 543 551 .. 189 197 .] -0.6 7.6
Alignments of top-scoring domains:
NODP: domain 1 of 1, from 19 to 33: score 1.9, E = 9.9
*->IesVtSepdepstpe<-*
I++VtS +++p++++
gi|2101266 19 ISAVTSNTPKPPGNK 33
IQ: domain 1 of 1, from 100 to 120: score 25.3, E = 2.4e-06
CS HHHCHHHHHHHHHHHHHHHHH
*->rraaikIQaawRGylaRkryk<-*
aa++IQ+++RGy++Rk ++
gi|2101266 100 MLAAVIIQRWFRGYKTRKDLE 120
SDF: domain 1 of 1, from 100 to 109: score 0.2, E = 5.9
*->alaaiivakl<-*
+laa+i+ ++
gi|2101266 100 MLAAVIIQRW 109
Ca_chan_IQ: domain 1 of 1, from 106 to 126: score 7.3, E = 0.37
*->IQdYFRkFkkRKeeekkgkep<-*
IQ +FR +k RK e +++ +
gi|2101266 106 IQRWFRGYKTRKDLETEQRMA 126
MRP-S27: domain 1 of 1, from 107 to 137: score 3.6, E = 0.79
*->klwqrkkkkreqaDeEERitYyqqrhatraa<-*
++w+r k r+ +++E R+ +qr +r+a
gi|2101266 107 QRWFRGYKTRKDLETEQRMARVIQRQFRRRA 137
DUF479: domain 1 of 1, from 161 to 178: score 2.4, E = 3.5
*->rmarRlsRpnpLagavee<-*
rm +R++R++ La+ v+e
gi|2101266 161 RMGQRSPRTAKLADPVGE 178
Tmemb_55A: domain 1 of 1, from 173 to 183: score -0.3, E = 6
*->MdadGeDHLRNqErsPLL<-*
ad++ ErsPLL
gi|2101266 173 --ADPVG-----ERSPLL 183
DUF1174: domain 1 of 1, from 230 to 255: score 4.0, E = 5
*->ssEetttsAvtEasgEEtttsAvtEa<-*
ss +tt E+++ tt t+a
gi|2101266 230 SSKNTTGQGSAEGASSNTTGQGLTDA 255
FliX: domain 1 of 1, from 282 to 298: score 3.3, E = 0.8
*->MrisGprgttaasggkak<-*
+is++++ ta+s++ +k
gi|2101266 282 -KISDTNSLTAVSPRDSK 298
DUF499: domain 1 of 1, from 294 to 301: score -2.1, E = 8.5
*->PrALeDkE<-*
Pr+++DkE
gi|2101266 294 PRDSKDKE 301
zf-C3HC4: domain 1 of 1, from 335 to 350: score 2.4, E = 1.3
CS HHHHHHHCTSSSTTTT
*->lkkwlkssgnttCplC<-*
l++ l+ss t+C +C
gi|2101266 335 LENSLQSSQRTYCTVC 350
Baculo_helicase: domain 1 of 1, from 463 to 474: score -1.9, E = 5.3
*->mIfedIfnsyqt<-*
++fe+I+ ++q+
gi|2101266 463 DSFEKILSAIQS 474
PHD: domain 1 of 1, from 479 to 486: score 0.6, E = 9.4
CS --TTTCTC
*->yCpeCkpk<-*
yCp Ck+k
gi|2101266 479 YCPGCKAK 486
Connexin: domain 1 of 1, from 524 to 541: score 1.5, E = 2.8
CS -TTHHHHHHHHHHHHHTSS
*->dWsfLgkLLegVnkhSTai<-*
W++Lg++ ++ ST+i
gi|2101266 524 -WKALGNMMSKLEPDSTVI 541
TM_helix: domain 1 of 1, from 525 to 541: score 2.9, E = 6
*->dlvaklLkklgldslva<-*
+++++++ kl++ds+v
gi|2101266 525 KALGNMMSKLEPDSTVI 541
Phage-tail_1: domain 1 of 1, from 543 to 551: score -0.6, E = 7.6
CS SSEEEEEEH
*->idGisImDy<-*
i+G ++m+y
gi|2101266 543 IMGCNVMGY 551
//