hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            26343437.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|26343437|dbj|BAC35375.1|
Accession:      [none]
Description:    unnamed protein product [Mus musculus]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
IQ              IQ calmodulin-binding motif              15.9     0.0016   2
UPF0547         Uncharacterised protein family UPF054    11.1      0.052   1
DUF1219         Protein of unknown function (DUF1219)     2.3        1.5   1
PRD             PRD domain                                3.7        2.6   1
DUF551          Protein of unknown function (DUF551)      1.9        3.2   1
Agro_virD5      Agrobacterium VirD5 protein              -0.8        3.6   1
TP1             Nuclear transition protein 1              2.3        4.3   1
TIR             TIR domain                                0.9        5.4   1
IMPDH           IMP dehydrogenase / GMP reductase dom     0.6          6   1
c-SKI_SMAD_bind c-SKI Smad4 binding domain                1.6        6.1   1
NUP             Purine nucleoside permease (NUP)         -0.2        6.3   1
Orthopox_N1     Orthopoxvirus N1 protein                  0.7        6.4   1
IFRD            Interferon-related developmental regu    -0.2        6.5   1
PSI             Plexin repeat                             1.7        7.6   1
RseA_C          Anti sigma-E protein RseA, C-terminal     2.7        8.2   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
DUF1219           1/1       1    15 [.     1    15 [.     2.3      1.5
Agro_virD5        1/1     109   138 ..   740   769 ..    -0.8      3.6
PSI               1/1     164   177 ..    50    63 .]     1.7      7.6
UPF0547           1/1     174   184 ..     1    11 [.    11.1    0.052
DUF551            1/1     197   203 ..    74    80 .]     1.9      3.2
IQ                1/2     236   254 ..     1    19 [.     8.1     0.34
RseA_C            1/1     248   282 ..    33    67 .]     2.7      8.2
TP1               1/1     255   273 ..    40    54 .]     2.3      4.3
IQ                2/2     259   273 ..     1    15 [.     7.8      0.4
NUP               1/1     321   329 ..     1     9 [.    -0.2      6.3
c-SKI_SMAD_bind   1/1     357   373 ..    82    98 .]     1.6      6.1
IFRD              1/1     358   369 ..   354   365 .]    -0.2      6.5
PRD               1/1     362   374 ..     1    13 [.     3.7      2.6
TIR               1/1     409   424 ..   131   150 .]     0.9      5.4
Orthopox_N1       1/1     478   491 ..   100   113 .]     0.7      6.4
IMPDH             1/1     499   507 .]     1     9 [.     0.6        6

Alignments of top-scoring domains:
DUF1219: domain 1 of 1, from 1 to 15: score 2.3, E = 1.5
                   *->mKtLPvlhvrAAsrr<-*
                      m+  Pv+ + AAsrr
  gi|2634343     1    MRGAPVTMGAAASRR    15

Agro_virD5: domain 1 of 1, from 109 to 138: score -0.8, E = 3.6
                   *->YtvsRDPvLsPPsKeqapqLLHLGpRGqtE<-*
                      Yt+sR+P L+P s  +a +L  +  R q E
  gi|2634343   109    YTISREPALLPGSEAEAIELAVVKGRRQRE    138

PSI: domain 1 of 1, from 164 to 177: score 1.7, E = 7.6
                CS    ..B..TT-BCCCSS
                   *->dqwldwswsssqCp<-*
                      ++w ++ + s+ Cp
  gi|2634343   164    QSWAGSRQGSKECP    177

UPF0547: domain 1 of 1, from 174 to 184: score 11.1, E = 0.052
                   *->KtCPeCdaivp<-*
                      K+CP+C ++vp
  gi|2634343   174    KECPGCAQLVP    184

DUF551: domain 1 of 1, from 197 to 203: score 1.9, E = 3.2
                   *->PLPEPPq<-*
                      PLPE+P
  gi|2634343   197    PLPEAPG    203

IQ: domain 1 of 2, from 236 to 254: score 8.1, E = 0.34
                CS    HHHCHHHHHHHHHHHHHHH
                   *->rraaikIQaawRGylaRkr<-*
                      + a +++Qa++RGy  R r
  gi|2634343   236    QTATTTMQAVFRGYAERNR    254

RseA_C: domain 1 of 1, from 248 to 282: score 2.7, E = 8.2
                   *->gyqeqqeriqaplqnyelqlrrwsesrlpqylrqh<-*
                      gy e ++r +++ + ++ q+  + + r +++ r+
  gi|2634343   248    GYAERNRRKRENDSASVIQRNFRKHLRMVGSRRVK    282

TP1: domain 1 of 1, from 255 to 273: score 2.3, E = 4.3
                   *->RKRgDDAn....RnyRsHL<-*
                      RKR  D  +  +Rn+R HL
  gi|2634343   255    RKRENDSAsviqRNFRKHL    273

IQ: domain 2 of 2, from 259 to 273: score 7.8, E = 0.4
                CS    HHHCHHHHHHHHHHH
                   *->rraaikIQaawRGyl<-*
                       ++a +IQ+ +R +l
  gi|2634343   259    NDSASVIQRNFRKHL    273

NUP: domain 1 of 1, from 321 to 329: score -0.2, E = 6.3
                   *->iqpKVmvIt<-*
                       +pKVm+I+
  gi|2634343   321    LPPKVMLIS    329

c-SKI_SMAD_bind: domain 1 of 1, from 357 to 373: score 1.6, E = 6.1
                CS    CHHHHHHHHHHHHCC--
                   *->eeakLeqvLeevkekFd<-*
                      e+a+ e +Lee++ k +
  gi|2634343   357    EHATFEDILEEIEKKLN    373

IFRD: domain 1 of 1, from 358 to 369: score -0.2, E = 6.5
                   *->RstFRDVlrfvE<-*
                      ++tF D+l+ +E
  gi|2634343   358    HATFEDILEEIE    369

PRD: domain 1 of 1, from 362 to 374: score 3.7, E = 2.6
                CS    HHHHHHHHHHHTS
                   *->eelleeiekklqi<-*
                      e++leeiekkl+i
  gi|2634343   362    EDILEEIEKKLNI    374

TIR: domain 1 of 1, from 409 to 424: score 0.9, E = 5.4
                CS    SG.....GGCCHHHHHHHHH
                   *->dktersqsdrikfWkkalya<-*
                      +k+e    d+i+fWk++
  gi|2634343   409    EKEE----DMIHFWKRLSRL    424

Orthopox_N1: domain 1 of 1, from 478 to 491: score 0.7, E = 6.4
                   *->rmiekyfddlmidl<-*
                      +mie+yfd   + l
  gi|2634343   478    QMIETYFDFRLYRL    491

IMPDH: domain 1 of 1, from 499 to 507: score 0.6, E = 6
                CS    EB-GGGGEE
                RF    xxxxxxxxx
                   *->egLTFDDVL<-*
                      + L+FDDVL
  gi|2634343   499    KLLDFDDVL    507

//