hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 26343437.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|26343437|dbj|BAC35375.1|
Accession: [none]
Description: unnamed protein product [Mus musculus]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
IQ IQ calmodulin-binding motif 15.9 0.0016 2
UPF0547 Uncharacterised protein family UPF054 11.1 0.052 1
DUF1219 Protein of unknown function (DUF1219) 2.3 1.5 1
PRD PRD domain 3.7 2.6 1
DUF551 Protein of unknown function (DUF551) 1.9 3.2 1
Agro_virD5 Agrobacterium VirD5 protein -0.8 3.6 1
TP1 Nuclear transition protein 1 2.3 4.3 1
TIR TIR domain 0.9 5.4 1
IMPDH IMP dehydrogenase / GMP reductase dom 0.6 6 1
c-SKI_SMAD_bind c-SKI Smad4 binding domain 1.6 6.1 1
NUP Purine nucleoside permease (NUP) -0.2 6.3 1
Orthopox_N1 Orthopoxvirus N1 protein 0.7 6.4 1
IFRD Interferon-related developmental regu -0.2 6.5 1
PSI Plexin repeat 1.7 7.6 1
RseA_C Anti sigma-E protein RseA, C-terminal 2.7 8.2 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
DUF1219 1/1 1 15 [. 1 15 [. 2.3 1.5
Agro_virD5 1/1 109 138 .. 740 769 .. -0.8 3.6
PSI 1/1 164 177 .. 50 63 .] 1.7 7.6
UPF0547 1/1 174 184 .. 1 11 [. 11.1 0.052
DUF551 1/1 197 203 .. 74 80 .] 1.9 3.2
IQ 1/2 236 254 .. 1 19 [. 8.1 0.34
RseA_C 1/1 248 282 .. 33 67 .] 2.7 8.2
TP1 1/1 255 273 .. 40 54 .] 2.3 4.3
IQ 2/2 259 273 .. 1 15 [. 7.8 0.4
NUP 1/1 321 329 .. 1 9 [. -0.2 6.3
c-SKI_SMAD_bind 1/1 357 373 .. 82 98 .] 1.6 6.1
IFRD 1/1 358 369 .. 354 365 .] -0.2 6.5
PRD 1/1 362 374 .. 1 13 [. 3.7 2.6
TIR 1/1 409 424 .. 131 150 .] 0.9 5.4
Orthopox_N1 1/1 478 491 .. 100 113 .] 0.7 6.4
IMPDH 1/1 499 507 .] 1 9 [. 0.6 6
Alignments of top-scoring domains:
DUF1219: domain 1 of 1, from 1 to 15: score 2.3, E = 1.5
*->mKtLPvlhvrAAsrr<-*
m+ Pv+ + AAsrr
gi|2634343 1 MRGAPVTMGAAASRR 15
Agro_virD5: domain 1 of 1, from 109 to 138: score -0.8, E = 3.6
*->YtvsRDPvLsPPsKeqapqLLHLGpRGqtE<-*
Yt+sR+P L+P s +a +L + R q E
gi|2634343 109 YTISREPALLPGSEAEAIELAVVKGRRQRE 138
PSI: domain 1 of 1, from 164 to 177: score 1.7, E = 7.6
CS ..B..TT-BCCCSS
*->dqwldwswsssqCp<-*
++w ++ + s+ Cp
gi|2634343 164 QSWAGSRQGSKECP 177
UPF0547: domain 1 of 1, from 174 to 184: score 11.1, E = 0.052
*->KtCPeCdaivp<-*
K+CP+C ++vp
gi|2634343 174 KECPGCAQLVP 184
DUF551: domain 1 of 1, from 197 to 203: score 1.9, E = 3.2
*->PLPEPPq<-*
PLPE+P
gi|2634343 197 PLPEAPG 203
IQ: domain 1 of 2, from 236 to 254: score 8.1, E = 0.34
CS HHHCHHHHHHHHHHHHHHH
*->rraaikIQaawRGylaRkr<-*
+ a +++Qa++RGy R r
gi|2634343 236 QTATTTMQAVFRGYAERNR 254
RseA_C: domain 1 of 1, from 248 to 282: score 2.7, E = 8.2
*->gyqeqqeriqaplqnyelqlrrwsesrlpqylrqh<-*
gy e ++r +++ + ++ q+ + + r +++ r+
gi|2634343 248 GYAERNRRKRENDSASVIQRNFRKHLRMVGSRRVK 282
TP1: domain 1 of 1, from 255 to 273: score 2.3, E = 4.3
*->RKRgDDAn....RnyRsHL<-*
RKR D + +Rn+R HL
gi|2634343 255 RKRENDSAsviqRNFRKHL 273
IQ: domain 2 of 2, from 259 to 273: score 7.8, E = 0.4
CS HHHCHHHHHHHHHHH
*->rraaikIQaawRGyl<-*
++a +IQ+ +R +l
gi|2634343 259 NDSASVIQRNFRKHL 273
NUP: domain 1 of 1, from 321 to 329: score -0.2, E = 6.3
*->iqpKVmvIt<-*
+pKVm+I+
gi|2634343 321 LPPKVMLIS 329
c-SKI_SMAD_bind: domain 1 of 1, from 357 to 373: score 1.6, E = 6.1
CS CHHHHHHHHHHHHCC--
*->eeakLeqvLeevkekFd<-*
e+a+ e +Lee++ k +
gi|2634343 357 EHATFEDILEEIEKKLN 373
IFRD: domain 1 of 1, from 358 to 369: score -0.2, E = 6.5
*->RstFRDVlrfvE<-*
++tF D+l+ +E
gi|2634343 358 HATFEDILEEIE 369
PRD: domain 1 of 1, from 362 to 374: score 3.7, E = 2.6
CS HHHHHHHHHHHTS
*->eelleeiekklqi<-*
e++leeiekkl+i
gi|2634343 362 EDILEEIEKKLNI 374
TIR: domain 1 of 1, from 409 to 424: score 0.9, E = 5.4
CS SG.....GGCCHHHHHHHHH
*->dktersqsdrikfWkkalya<-*
+k+e d+i+fWk++
gi|2634343 409 EKEE----DMIHFWKRLSRL 424
Orthopox_N1: domain 1 of 1, from 478 to 491: score 0.7, E = 6.4
*->rmiekyfddlmidl<-*
+mie+yfd + l
gi|2634343 478 QMIETYFDFRLYRL 491
IMPDH: domain 1 of 1, from 499 to 507: score 0.6, E = 6
CS EB-GGGGEE
RF xxxxxxxxx
*->egLTFDDVL<-*
+ L+FDDVL
gi|2634343 499 KLLDFDDVL 507
//