hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            56388808.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|56388808|gb|AAH87719.1|
Accession:      [none]
Description:    Nasal embryonic LHRH factor [Rattus norvegicus]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
UPF0547         Uncharacterised protein family UPF054    11.1      0.052   1
IQ              IQ calmodulin-binding motif               7.8        0.4   1
TP1             Nuclear transition protein 1              3.4          2   1
PRD             PRD domain                                3.7        2.6   1
Agro_virD5      Agrobacterium VirD5 protein              -0.8        3.6   1
AMP_N           Aminopeptidase P, N-terminal domain       1.9        4.4   1
TIR             TIR domain                                0.9        5.4   1
IMPDH           IMP dehydrogenase / GMP reductase dom     0.6          6   1
c-SKI_SMAD_bind c-SKI Smad4 binding domain                1.6        6.1   1
NUP             Purine nucleoside permease (NUP)         -0.2        6.3   1
Orthopox_N1     Orthopoxvirus N1 protein                  0.7        6.4   1
IFRD            Interferon-related developmental regu    -0.2        6.5   1
PSI             Plexin repeat                             1.7        7.6   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Agro_virD5        1/1     102   131 ..   740   769 ..    -0.8      3.6
PSI               1/1     157   170 ..    50    63 .]     1.7      7.6
UPF0547           1/1     167   177 ..     1    11 [.    11.1    0.052
TP1               1/1     248   268 ..    38    54 .]     3.4        2
IQ                1/1     254   268 ..     1    15 [.     7.8      0.4
AMP_N             1/1     276   287 ..     1    12 [.     1.9      4.4
NUP               1/1     346   354 ..     1     9 [.    -0.2      6.3
c-SKI_SMAD_bind   1/1     382   398 ..    82    98 .]     1.6      6.1
IFRD              1/1     383   394 ..   354   365 .]    -0.2      6.5
PRD               1/1     387   399 ..     1    13 [.     3.7      2.6
TIR               1/1     434   449 ..   131   150 .]     0.9      5.4
Orthopox_N1       1/1     503   516 ..   100   113 .]     0.7      6.4
IMPDH             1/1     524   532 .]     1     9 [.     0.6        6

Alignments of top-scoring domains:
Agro_virD5: domain 1 of 1, from 102 to 131: score -0.8, E = 3.6
                   *->YtvsRDPvLsPPsKeqapqLLHLGpRGqtE<-*
                      Yt+sR+P L+P s  +a +L  +  R q E
  gi|5638880   102    YTISREPALLPGSEAEAIELAVVKGRRQRE    131

PSI: domain 1 of 1, from 157 to 170: score 1.7, E = 7.6
                CS    ..B..TT-BCCCSS
                   *->dqwldwswsssqCp<-*
                      ++w ++ + s+ Cp
  gi|5638880   157    QSWAGSRQGSKECP    170

UPF0547: domain 1 of 1, from 167 to 177: score 11.1, E = 0.052
                   *->KtCPeCdaivp<-*
                      K+CP+C ++vp
  gi|5638880   167    KECPGCAQLVP    177

TP1: domain 1 of 1, from 248 to 268: score 3.4, E = 2
                   *->KsRKRgDDAn....RnyRsHL<-*
                      K RKR  D  +  +Rn+R HL
  gi|5638880   248    KRRKRENDSAsviqRNFRKHL    268

IQ: domain 1 of 1, from 254 to 268: score 7.8, E = 0.4
                CS    HHHCHHHHHHHHHHH
                   *->rraaikIQaawRGyl<-*
                       ++a +IQ+ +R +l
  gi|5638880   254    NDSASVIQRNFRKHL    268

AMP_N: domain 1 of 1, from 276 to 287: score 1.9, E = 4.4
                   *->ipadefaaRRkr<-*
                      ++a+ fa+RR+r
  gi|5638880   276    VKAQTFAERRER    287

NUP: domain 1 of 1, from 346 to 354: score -0.2, E = 6.3
                   *->iqpKVmvIt<-*
                       +pKVm+I+
  gi|5638880   346    LPPKVMLIS    354

c-SKI_SMAD_bind: domain 1 of 1, from 382 to 398: score 1.6, E = 6.1
                CS    CHHHHHHHHHHHHCC--
                   *->eeakLeqvLeevkekFd<-*
                      e+a+ e +Lee++ k +
  gi|5638880   382    EHATFEDILEEIEKKLN    398

IFRD: domain 1 of 1, from 383 to 394: score -0.2, E = 6.5
                   *->RstFRDVlrfvE<-*
                      ++tF D+l+ +E
  gi|5638880   383    HATFEDILEEIE    394

PRD: domain 1 of 1, from 387 to 399: score 3.7, E = 2.6
                CS    HHHHHHHHHHHTS
                   *->eelleeiekklqi<-*
                      e++leeiekkl+i
  gi|5638880   387    EDILEEIEKKLNI    399

TIR: domain 1 of 1, from 434 to 449: score 0.9, E = 5.4
                CS    SG.....GGCCHHHHHHHHH
                   *->dktersqsdrikfWkkalya<-*
                      +k+e    d+i+fWk++
  gi|5638880   434    EKEE----DMIHFWKRLSRL    449

Orthopox_N1: domain 1 of 1, from 503 to 516: score 0.7, E = 6.4
                   *->rmiekyfddlmidl<-*
                      +mie+yfd   + l
  gi|5638880   503    QMIETYFDFRLYRL    516

IMPDH: domain 1 of 1, from 524 to 532: score 0.6, E = 6
                CS    EB-GGGGEE
                RF    xxxxxxxxx
                   *->egLTFDDVL<-*
                      + L+FDDVL
  gi|5638880   524    KLLDFDDVL    532

//