hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            71083628.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|71083628|ref|YP_266348.1|
Accession:      [none]
Description:    hypothetical protein SAR11_0932 [Candidatus Pelagibacter ubique HTCC1062]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
PKD             PKD domain                               74.2    2.9e-22  23
Dockerin_1      Dockerin type I repeat                   60.9    1.2e-17  12
Gp5_C           Gp5 C-terminal repeat (3 copies)         29.6      5e-08  11
HYR             HYR domain                               28.8    6.4e-08   5
HIM             Haemagglutinin                           23.7    3.7e-06   7
Flagellin_IN    Flagellin hook IN motif                  23.6    8.6e-06   7
Xol-1_GHMP-like Switch protein XOL-1, GHMP-like          14.3    0.00017   2
I-set           Immunoglobulin I-set domain              17.4    0.00027   5
Big_1           Bacterial Ig-like domain (group 1)       13.4    0.00073   5
PDEase_I        3'5'-cyclic nucleotide phosphodiester    10.8     0.0011   4
DUF1521         Domain of Unknown Function (DUF1521)     10.4     0.0027   4
Whi5            Whi5 like                                13.2      0.015   5
Attacin_N       Attacin, N-terminal region               11.2      0.029   5
Cadherin        Cadherin domain                           9.6      0.049  10
EI24            Etoposide-induced protein 2.4 (EI24)      7.2      0.078   1
APC_crr         APC cysteine-rich region                  9.9      0.093   4
Haemagg_act     haemagglutination activity domain         7.0       0.16   5
SAF             SAF domain                                8.6        0.2   4
SRR             Seven Residue Repeat                     10.5       0.23   5
B_lectin        D-mannose binding lectin                  6.9       0.28   1
Phage-tail_1    Baseplate structural protein, domain      2.8       0.54   1
LRR_adjacent    LRR adjacent                              6.4       0.66   3
DUF2057         Uncharacterized protein conserved in      4.0       0.68   2
Thy1            Thymidylate synthase complementing pr     4.7       0.69   3
He_PIG          Putative Ig domain                        5.8       0.72   4
Mid2            Mid2 like cell wall stress sensor         4.4       0.95   3
Fimbrial        Fimbrial protein                          4.0       0.96   1
Fmp27_GFWDK     RNA pol II promoter Fmp27 protein dom     1.5        1.2   1
IKI3            IKI3 family                               0.8        1.3   1
Tissue_fac      Tissue factor                             4.2        1.5   2
Big_3           Bacterial Ig-like domain (group 3)        5.1        1.6   4
Cu2_monoox_C    Copper type II ascorbate-dependent mo     2.8        1.7   1
Fil_haemagg     Haemagluttinin repeat                     4.2        1.7   4
DUF1869         Domain of unknown function (DUF1869)      0.7        2.1   1
Stathmin        Stathmin family                           2.5        2.1   1
NOPS            NOPS (NUC059) domain                      2.2        2.2   1
Peptidase_C25_C Peptidase family C25, C terminal ig-l     3.1        2.2   1
CHL4            Kinetochore protein CHL4 like             1.5        2.3   1
SGL             SMP-30/Gluconolaconase/LRE-like regio     2.0        2.4   1
PD40            WD40-like Beta Propeller Repeat           3.4        2.4   1
3Beta_HSD       3-beta hydroxysteroid dehydrogenase/i     1.1        2.7   1
DUF646          Bacteriophage protein of unknown func     2.4        2.9   1
FB_lectin       Fungal fruit body lectin                  2.8          3   1
NAF             NAF domain                                2.8        3.1   1
DUF48           Protein of unknown function DUF48         1.7        3.1   1
Syntaxin-18_N   SNARE-complex protein Syntaxin-18 N-t     2.6        3.1   1
Pentapeptide_2  Pentapeptide repeats (8 copies)           3.8        3.3   1
Bse634I         Cfr10I/Bse634I restriction endonuclea     1.3        3.4   1
PolyG_pol       Sigma NS protein                          0.4        3.4   1
DUF2190         Uncharacterized conserved protein (DU     2.6        3.5   1
FAINT           Domain of unknown function, DUF529        2.6        3.5   1
ClpS            ATP-dependent Clp protease adaptor pr     4.2        3.6   1
PhoPQ_related   PhoPQ-activated pathogenicity-related    -1.6        3.8   1
Copper-bind     Copper binding proteins, plastocyanin     2.3          4   3
S-methyl_trans  Homocysteine S-methyltransferase          0.7          4   1
Peptidase_S9_N  Prolyl oligopeptidase, N-terminal bet     0.5          4   1
YycH            YycH protein                              0.6        4.1   1
Glyco_transf_36 Glycosyltransferase family 36             2.2        4.1   4
Flocculin       Flocculin repeat                          4.2        4.3   5
Baculo_ODV-E27  Baculovirus occlusion-derived virus e     0.3        4.5   1
Y_Y_Y           Y_Y_Y domain                              2.7        4.6   1
PCNA_N          Proliferating cell nuclear antigen, N     1.8        4.6   1
Glyco_transf_34 galactosyl transferase GMA12/MNN10 fa     1.2        4.7   1
CBM_5_12        Carbohydrate binding domain               4.1        4.7   1
CoatB           Bacteriophage coat protein B              3.0        4.9   1
DUF2458         Protein of unknown function (DUF2458)     1.2          5   1
YukD            YukD                                      2.1        5.4   1
Pmp24           Peroxisomal membrane protein 24           1.1        5.5   1
Endotoxin_mid   Bacillus thuringiensis delta-Endotoxi     0.6        5.5   1
DUF1357         Protein of unknown function (DUF1357)     0.6        5.6   1
MORN_2          MORN repeat variant                       4.2        5.7   2
C2-set          Immunoglobulin C2-set domain              2.4        5.8   3
DNA_pol_B_2     DNA polymerase type B, organellar and     0.2        5.8   1
DUF1306         Protein of unknown function (DUF1306)     1.3        5.9   1
ER_lumen_recept ER lumen protein retaining receptor       1.0        5.9   1
SUN             Beta-glucosidase (SUN family)             0.1        5.9   1
Big_2           Bacterial Ig-like domain (group 2)        2.2          6   4
Bromo_MP        Bromovirus movement protein               1.1          6   1
Complex1_24kDa  Respiratory-chain NADH dehydrogenase      1.4        6.1   1
A2M_N_2         Alpha-2-macroglobulin family N-termin     1.9        6.1   1
Corona_nucleoca Coronavirus nucleocapsid protein          0.2        6.4   1
P35             Apoptosis preventing protein             -1.2        6.6   1
DNA_ligase_A_M  ATP dependent DNA ligase domain           0.7        6.6   1
DUF2472         Protein of unknown function (DUF2742)     1.8        6.8   1
Herpes_ICP4_C   Herpesvirus ICP4-like protein C-termi    -1.1        7.1   1
DUF2216         Uncharacterized conserved proteins (D     0.5        7.2   2
DUF2140         Uncharacterized protein conserved in      1.2        7.2   1
DUF2416         Protein of unknown function (DUF2416)     0.3        7.4   1
PPC             Bacterial pre-peptidase C-terminal do     2.0        7.4   1
Stig1           Stigma-specific protein, Stig1           -0.3        7.4   1
P2              P2 response regulator binding domain      1.9        7.5   1
GLE1            GLE1-like protein                         0.1        7.5   1
SWIRM           SWIRM domain                              1.9        7.6   1
IRK_N           Inward rectifier potassium channel N-     1.7        7.8   1
HP_OMP          Helicobacter outer membrane protein      -0.1        7.8   1
DUF2377         Putative phage tail protein (DUF2377)     1.3        7.8   2
PQQ             PQQ enzyme repeat                         2.4          8   2
Orthopox_F6     Orthopoxvirus F6 protein                  1.4        8.2   1
GSPII_G         Bacterial type II secretion system pr     1.2        8.3   1
SEA             SEA domain                                1.6        8.3   1
Pescadillo_N    Pescadillo N-terminus                    -0.2        8.3   1
DUF257          Pyrococcus protein of unknown functio     0.4        8.3   1
RE_BstXI        BstXI restriction endonuclease           -1.3        8.4   1
L1R_F9L         Lipid membrane protein of large eukar     0.2        8.5   1
DUF520          Protein of unknown function (DUF520)     -0.7        8.7   1
TMP_2           Prophage tail length tape measure pro     0.5        8.7   1
CLAG            Cytoadherence-linked asexual protein     -2.9        8.7   1
DUF167          Uncharacterised ACR, YggU family COG1     1.3        8.7   2
Peptidase_M42   M42 glutamyl aminopeptidase              -0.1        8.8   1
EspB            Enterobacterial EspB protein             -1.9        8.8   1
SoxZ            Sulphur oxidation protein SoxZ            1.1        8.8   1
Mis14           Kinetochore protein Mis14 like            1.2        8.9   1
AstA            Arginine N-succinyltransferase beta s    -0.1        9.2   1
XFP_N           XFP N-terminal domain                    -0.5        9.4   1
Nucleoporin     Non-repetitive/WGA-negative nucleopor    -2.1        9.4   1
SRX             SRX                                       0.3        9.7   1
GbpC            Glucan-binding protein C                 -0.7        9.8   1
FlgN            FlgN protein                              0.9        9.8   1
Mt_ATP-synt_D   ATP synthase D chain, mitochondrial (     0.3        9.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
DUF2472           1/1      43    74 ..    97   130 .]     1.8      6.8
SRX               1/1      44    61 ..   129   149 ..     0.3      9.7
Bse634I           1/1      74    94 ..   298   318 .]     1.3      3.4
Phage-tail_1      1/1      97   106 ..   188   197 .]     2.8     0.54
HP_OMP            1/1     112   148 ..    25    57 ..    -0.1      7.8
Glyco_transf_34   1/1     146   159 ..   299   312 .]     1.2      4.7
P2                1/1     160   176 ..    71    93 .]     1.9      7.5
IKI3              1/1     202   215 ..  1080  1093 .]     0.8      1.3
Pmp24             1/1     277   288 ..   199   210 .]     1.1      5.5
Pescadillo_N      1/1     281   303 ..   276   298 .]    -0.2      8.3
Stathmin          1/1     311   328 ..     1    20 [.     2.5      2.1
DNA_ligase_A_M    1/1     312   336 ..    69    93 ..     0.7      6.6
Fimbrial          1/1     325   334 ..     1    10 [.     4.0     0.96
A2M_N_2           1/1     428   458 ..     1    33 [.     1.9      6.1
AstA              1/1     436   448 ..   334   346 .]    -0.1      9.2
Fil_haemagg       1/4     451   486 ..     1    38 [.     0.7       18
Tissue_fac        1/2     498   507 ..   128   137 .]     2.3      5.1
SGL               1/1     550   564 ..   164   178 ..     2.0      2.4
DNA_pol_B_2       1/1     596   689 ..   429   531 .]     0.2      5.8
Tissue_fac        2/2     613   622 ..   128   137 .]     2.0      6.2
Nucleoporin       1/1     635   659 ..   502   527 ..    -2.1      9.4
PD40              1/1     653   676 ..     1    24 [.     3.4      2.4
MORN_2            1/2     659   680 ..     1    22 []     3.6      8.5
DUF1357           1/1     749   766 ..   161   179 ..     0.6      5.6
Pentapeptide_2    1/1     765   781 ..     1    17 [.     3.8      3.3
Mt_ATP-synt_D     1/1     834   844 ..   170   180 .]     0.3      9.9
He_PIG            1/4     854   862 ..    53    61 .]     0.2       29
Attacin_N         1/5     903   914 ..     1    12 [.     1.9       11
HYR               1/5     930   948 ..    67    86 .]     2.3      4.6
PKD               1/23    931   948 ..    75    92 .]     3.3      1.7
SEA               1/1     984  1019 ..    86   121 .]     1.6      8.3
Dockerin_1        1/12   1025  1038 ..     1    14 [.     1.6       24
LRR_adjacent      1/3    1029  1040 ..     1    12 [.     0.2       35
CHL4              1/1    1096  1105 ..   553   562 .]     1.5      2.3
PKD               2/23   1143  1170 ..     1    36 [.     0.1       17
Y_Y_Y             1/1    1187  1204 ..    51    69 .]     2.7      4.6
Peptidase_M42     1/1    1241  1251 ..    27    37 ..    -0.1      8.8
Big_3             1/4    1309  1322 ..    55    70 .]     5.1      1.7
DUF1521           1/4    1376  1414 ..   139   175 .]     2.2      1.2
SAF               1/4    1383  1399 ..    51    67 .]     1.8       14
PDEase_I          1/4    1384  1402 ..   237   257 .]     2.5     0.64
Dockerin_1        2/12   1386  1398 ..     1    13 [.     5.8      1.2
Copper-bind       1/3    1392  1409 ..     1    19 [.     0.8       11
Flagellin_IN      1/7    1418  1446 ..     1    28 [.     5.1      1.4
Glyco_transf_36   1/4    1426  1444 ..    94   112 .]     0.6       13
Haemagg_act       1/5    1428  1446 ..     1    19 [.     0.3       14
Fil_haemagg       2/4    1431  1487 ..     1    75 []     0.4       22
Gp5_C             1/11   1450  1468 ..     1    18 [.     2.7       10
HIM               1/7    1476  1488 ..    12    24 .]     5.0      2.1
Big_2             1/4    1484  1503 ..     1    22 [.     0.4       20
Attacin_N         2/5    1498  1510 ..     1    13 [.     2.0       10
FlgN              1/1    1499  1512 ..   137   150 .]     0.9      9.8
PKD               3/23   1551  1567 ..    75    92 .]     5.9     0.28
Cadherin          1/10   1552  1568 ..    81   107 .]     0.8       16
Big_3             2/4    1560  1567 ..    63    70 .]     0.0       41
Mid2              1/3    1592  1618 ..   133   162 .]     2.3      3.7
DUF1521           2/4    1621  1659 ..   139   175 .]     2.2      1.2
SAF               2/4    1628  1644 ..    51    67 .]     1.8       14
PDEase_I          2/4    1629  1647 ..   237   257 .]     2.5     0.64
Dockerin_1        3/12   1631  1643 ..     1    13 [.     5.8      1.2
Copper-bind       2/3    1637  1654 ..     1    19 [.     0.8       11
Flagellin_IN      2/7    1663  1691 ..     1    28 [.     5.1      1.4
Glyco_transf_36   2/4    1671  1689 ..    94   112 .]     0.6       13
Haemagg_act       2/5    1673  1700 ..     1    28 [.     1.6      5.9
Big_2             2/4    1696  1731 ..    34    63 ..     0.8       15
He_PIG            2/4    1704  1714 ..    51    61 .]     0.6       22
PKD               4/23   1704  1726 ..    71    92 .]     0.4       14
SUN               1/1    1705  1747 ..     1    42 [.     0.1      5.9
MORN_2            2/2    1735  1757 ..     1    22 []     0.6       59
Baculo_ODV-E27    1/1    1782  1799 ..   285   305 .]     0.3      4.5
FAINT             1/1    1783  1845 ..     1   116 []     2.6      3.5
DUF646            1/1    1800  1814 ..   117   133 ..     2.4      2.9
PQQ               1/2    1802  1820 ..     1    19 [.     1.9       12
PQQ               2/2    1849  1866 ..     1    17 [.     0.6       28
EI24              1/1    1863  1888 ..   367   399 .]     7.2    0.078
DUF1306           1/1    1882  1897 ..     1    16 [.     1.3      5.9
IRK_N             1/1    1883  1898 ..     1    16 [.     1.7      7.8
Cu2_monoox_C      1/1    1896  1924 ..   145   173 .]     2.8      1.7
NAF               1/1    1926  1938 ..    12    25 ..     2.8      3.1
TMP_2             1/1    2012  2024 ..   237   249 .]     0.5      8.7
DUF2216           1/2    2033  2046 ..   200   213 .]     0.5      7.3
Bromo_MP          1/1    2062  2101 ..   243   294 .]     1.1        6
SoxZ              1/1    2083  2101 ..    86   104 .]     1.1      8.8
HYR               2/5    2084  2103 ..    66    86 .]     2.3      4.8
PKD               5/23   2086  2103 ..    75    92 .]     4.4     0.83
Xol-1_GHMP-like   1/2    2116  2140 ..     1    25 [.     6.9    0.041
Endotoxin_mid     1/1    2125  2138 ..     1    14 [.     0.6      5.5
DUF2190           1/1    2251  2270 ..     4    24 ..     2.6      3.5
Haemagg_act       3/5    2263  2304 ..     1    42 [.     3.6      1.5
Attacin_N         3/5    2314  2323 ..     1    12 [.     0.8       22
DUF48             1/1    2315  2332 ..     1    18 [.     1.7      3.1
PKD               6/23   2371  2388 ..    74    92 .]     6.3     0.22
Gp5_C             2/11   2374  2398 ..     1    24 []     6.1     0.91
ER_lumen_recept   1/1    2441  2455 ..     1    15 [.     1.0      5.9
DUF2216           2/2    2461  2471 ..   203   213 .]     0.0       10
ClpS              1/1    2533  2547 ..     1    15 [.     4.2      3.6
DUF520            1/1    2535  2540 ..   158   163 .]    -0.7      8.7
DUF2416           1/1    2602  2614 ..    35    47 ..     0.3      7.4
PhoPQ_related     1/1    2645  2656 ..   118   129 ..    -1.6      3.8
Fmp27_GFWDK       1/1    2650  2671 ..   140   161 .]     1.5      1.2
DUF2458           1/1    2667  2674 ..     1     8 [.     1.2        5
Peptidase_S9_N    1/1    2702  2717 ..   449   464 .]     0.5        4
YycH              1/1    2749  2762 ..   473   488 .]     0.6      4.1
CoatB             1/1    2757  2768 ..     1    13 [.     3.0      4.9
Big_1             1/5    2781  2803 ..    23    45 ..     1.2      5.7
Herpes_ICP4_C     1/1    2813  2852 ..   412   451 .]    -1.1      7.1
CBM_5_12          1/1    2849  2861 ..     1    13 [.     4.1      4.7
PKD               7/23   2896  2912 ..    75    92 .]     0.4       14
I-set             1/5    2900  2910 ..    86    96 .]     2.3      6.3
PPC               1/1    3016  3126 ..     1    85 []     2.0      7.4
HYR               3/5    3021  3040 ..    66    86 .]     7.5     0.14
PKD               8/23   3023  3040 ..    75    92 .]     2.3      3.5
Cadherin          2/10   3031  3041 ..    97   107 .]     0.5       20
I-set             2/5    3049  3064 ..    81    96 .]     8.1     0.13
PKD               9/23   3049  3064 ..    76    92 .]     4.6      0.7
Gp5_C             3/11   3050  3064 ..     1    15 [.     0.6       47
DUF1869           1/1    3057  3079 ..     1    25 [.     0.7      2.1
B_lectin          1/1    3100  3128 ..     1    27 [.     6.9     0.28
HYR               4/5    3153  3172 ..    66    86 .]     5.8     0.42
PKD              10/23   3155  3172 ..    75    92 .]     5.8      0.3
Flagellin_IN      3/7    3167  3190 ..     1    30 [.     1.2       18
DUF2057           1/2    3192  3220 ..     1    36 [.     2.0      2.7
SRR               1/5    3239  3252 ..     1    14 []     1.7       50
PKD              11/23   3284  3300 ..    75    92 .]     3.6      1.4
Cadherin          3/10   3285  3301 ..    81   107 .]     2.1      6.7
Flocculin         1/5    3287  3307 ..    13    34 ..     1.7       20
I-set             3/5    3288  3298 ..    86    96 .]     1.6      9.6
DUF2057           2/2    3320  3348 ..     1    36 [.     2.0      2.7
SRR               2/5    3367  3380 ..     1    14 []     1.7       50
Cadherin          4/10   3413  3429 ..    81   107 .]     1.6      9.6
APC_crr           1/4    3438  3453 ..     1    17 [.     2.0       19
Thy1              1/3    3446  3470 ..     1    27 [.     0.5      9.8
DUF1521           3/4    3482  3520 ..   139   175 .]     2.2      1.2
SAF               3/4    3489  3505 ..    51    67 .]     1.8       14
PDEase_I          3/4    3490  3508 ..   237   257 .]     2.5     0.64
Dockerin_1        4/12   3492  3504 ..     1    13 [.     5.8      1.2
Copper-bind       3/3    3498  3515 ..     1    19 [.     0.8       11
Flagellin_IN      4/7    3524  3552 ..     1    28 [.     5.1      1.4
Glyco_transf_36   3/4    3532  3550 ..    94   112 .]     0.6       13
Haemagg_act       4/5    3534  3568 ..     1    35 [.     1.2      7.8
Fil_haemagg       3/4    3537  3593 ..     1    67 [.     0.8       16
I-set             4/5    3554  3570 ..    80    96 .]     0.6       18
Gp5_C             4/11   3556  3574 ..     1    18 [.     2.7       10
PKD              12/23   3662  3678 ..    75    92 .]     3.7      1.4
Big_2             3/4    3663  3689 ..    64    90 .]     0.1       24
Cadherin          5/10   3669  3679 ..    97   107 .]     1.0       15
Big_3             3/4    3671  3678 ..    63    70 .]     0.0       41
DUF1521           4/4    3861  3899 ..   139   175 .]     3.6     0.41
SAF               4/4    3868  3884 ..    51    67 .]     3.1      6.3
PDEase_I          4/4    3869  3887 ..   237   257 .]     3.2     0.36
Dockerin_1        5/12   3871  3885 ..     1    15 [.     7.9     0.27
Flagellin_IN      5/7    3903  3931 ..     1    28 [.     5.1      1.4
Glyco_transf_36   4/4    3911  3929 ..    94   112 .]     0.6       13
Haemagg_act       5/5    3913  3931 ..     1    19 [.     0.3       14
Fil_haemagg       4/4    3916  3973 ..     1    75 []     2.3      6.4
Gp5_C             5/11   3935  3949 ..     1    15 [.     2.8      9.4
He_PIG            3/4    3944  3954 ..    51    61 .]     1.5       12
PKD              13/23   4042  4058 ..    75    92 .]     3.7      1.4
Big_2             4/4    4043  4069 ..    64    90 .]     0.9       14
Big_1             2/5    4045  4067 ..    17    42 ..     1.6      4.3
Cadherin          6/10   4049  4059 ..    97   107 .]     1.0       15
Big_3             4/4    4051  4058 ..    63    70 .]     0.0       41
HIM               2/7    4221  4235 ..     7    24 .]     3.3      7.1
Flocculin         2/5    4302  4322 ..    13    34 ..     0.1       51
Mid2              2/3    4340  4366 ..   133   162 .]     1.0      8.2
P35               1/1    4348  4359 ..   315   326 .]    -1.2      6.6
DUF167            1/2    4350  4361 ..     1    12 [.     0.6       14
Whi5              1/5    4377  4385 ..    17    25 .]     2.5       15
Dockerin_1        6/12   4379  4399 ..     1    21 []     7.2     0.46
DUF2377           1/2    4408  4416 ..     1     9 [.     0.7       12
Big_1             3/5    4418  4445 ..    15    45 ..     0.0       14
Gp5_C             6/11   4443  4461 ..     1    18 [.     3.0      8.4
C2-set            1/3    4455  4468 ..     1    14 [.     0.8       16
SRR               3/5    4500  4513 ..     1    14 []     1.7       49
PKD              14/23   4545  4561 ..    75    92 .]     2.2      3.9
CLAG              1/1    4646  4671 ..  1293  1318 .]    -2.9      8.7
Xol-1_GHMP-like   2/2    4703  4727 ..     1    25 [.     7.4    0.028
I-set             5/5    4842  4858 ..    80    96 .]     4.8      1.2
PKD              15/23   4842  4858 ..    75    92 .]     2.7      2.8
Gp5_C             7/11   4844  4858 ..     1    15 [.     2.7       10
Attacin_N         4/5    4848  4869 ..    33    55 ..     0.1       34
Dockerin_1        7/12   4872  4882 ..     1    11 [.     4.0      4.3
HIM               3/7    5127  5141 ..     7    24 .]     3.3      7.1
SRR               4/5    5159  5172 ..     1    14 []     3.7       15
PKD              16/23   5204  5220 ..    75    92 .]     2.2      3.9
Flocculin         3/5    5207  5242 ..    13    46 .]     1.5       22
APC_crr           2/4    5236  5245 ..     8    17 ..     3.8      5.6
Thy1              2/3    5238  5262 ..     1    27 [.     2.1      3.6
Whi5              2/5    5282  5290 ..    17    25 .]     2.5       15
Dockerin_1        8/12   5284  5304 ..     1    21 []     7.2     0.46
Gp5_C             8/11   5348  5366 ..     1    18 [.     3.0      8.4
C2-set            2/3    5360  5373 ..     1    14 [.     0.8       16
PKD              17/23   5450  5466 ..    75    92 .]     2.2      3.9
Stig1             1/1    5460  5497 ..     1    38 [.    -0.3      7.4
PKD              18/23   5578  5594 ..    75    92 .]     2.2      3.9
HIM               4/7    5629  5643 ..     7    24 .]     3.3      7.1
Gp5_C             9/11   5694  5717 ..     2    24 .]     1.4       27
APC_crr           3/4    5740  5750 ..    10    20 ..     2.4       14
Whi5              3/5    5784  5792 ..    17    25 .]     2.5       15
Dockerin_1        9/12   5786  5806 ..     1    21 []     7.2     0.46
DUF2377           2/2    5815  5823 ..     1     9 [.     0.7       12
Flagellin_IN      6/7    5818  5846 ..     1    28 [.     2.0       10
Flagellin_IN      7/7    5853  5868 ..    45    63 .]     0.1       36
PKD              19/23   5952  5968 ..    75    92 .]     2.0      4.5
Cadherin          7/10   5959  5969 ..    97   107 .]     0.2       24
HIM               5/7    5968  5985 ..     3    20 ..     2.8       10
PKD              20/23   6080  6096 ..    75    92 .]     2.2      3.9
Gp5_C            10/11   6106  6124 ..     1    18 [.     2.7       10
GSPII_G           1/1    6148  6162 ..    99   114 .]     1.2      8.3
PKD              21/23   6203  6219 ..    75    92 .]     4.6      0.7
Cadherin          8/10   6204  6220 ..    81   107 .]     0.1       26
EspB              1/1    6213  6252 ..     1    41 [.    -1.9      8.8
HIM               6/7    6219  6236 ..     3    20 ..     2.8       10
HIM               7/7    6254  6268 ..     7    24 .]     3.3      7.1
Flocculin         4/5    6335  6355 ..    13    34 ..     0.1       51
Mid2              3/3    6373  6399 ..   133   162 .]     1.0      8.2
DUF167            2/2    6383  6394 ..     1    12 [.     0.6       14
Whi5              4/5    6410  6418 ..    17    25 .]     2.5       15
Dockerin_1       10/12   6412  6425 ..     1    14 [.     4.1      3.9
LRR_adjacent      2/3    6416  6427 ..     1    12 [.     4.8      1.9
Big_1             4/5    6451  6480 ..    15    47 ..     5.3     0.29
FB_lectin         1/1    6459  6470 ..     1    13 [.     2.8        3
Gp5_C            11/11   6476  6494 ..     1    18 [.     1.8       20
C2-set            3/3    6488  6501 ..     1    14 [.     0.8       16
SRR               5/5    6532  6545 ..     1    14 []     1.7       49
PKD              22/23   6577  6593 ..    75    92 .]     3.0      2.2
Cadherin          9/10   6578  6594 ..    81   107 .]     1.1       14
Flocculin         5/5    6584  6601 ..    17    35 ..     0.8       33
APC_crr           4/4    6609  6618 ..     8    17 ..     1.7       22
Thy1              3/3    6611  6635 ..     1    27 [.     2.1      3.6
Whi5              5/5    6654  6663 ..    16    25 .]     3.1       11
Dockerin_1       11/12   6657  6670 ..     1    14 [.     4.1      3.9
LRR_adjacent      3/3    6661  6672 ..     1    12 [.     1.5       15
Big_1             5/5    6696  6723 ..    15    45 ..     5.3     0.29
Attacin_N         5/5    6780  6791 ..     1    12 [.     6.3     0.64
HYR               5/5    6811  6830 ..    66    86 .]    10.9    0.013
PKD              23/23   6813  6830 ..    75    92 .]     6.4      0.2
Cadherin         10/10   6821  6831 ..    97   107 .]     1.3       11
Peptidase_C25_C   1/1    6821  6838 ..    59    76 ..     3.1      2.2
3Beta_HSD         1/1    6934  6957 ..   273   298 .]     1.1      2.7
PolyG_pol         1/1    6942  6960 ..   333   352 ..     0.4      3.4
L1R_F9L           1/1    6982  7005 ..     1    31 [.     0.2      8.5
PCNA_N            1/1    7006  7030 ..   103   127 .]     1.8      4.6
GLE1              1/1    7018  7030 ..   282   294 .]     0.1      7.5
YukD              1/1    7022  7048 ..    31    57 ..     2.1      5.4
He_PIG            4/4    7073  7090 ..    18    35 ..     3.6      3.2
DUF2140           1/1    7079  7088 ..   145   154 ..     1.2      7.2
RE_BstXI          1/1    7084  7105 ..     1    19 [.    -1.3      8.4
Corona_nucleoca   1/1    7087  7124 ..   436   481 .]     0.2      6.4
Mis14             1/1    7111  7145 ..   120   161 .]     1.2      8.9
Syntaxin-18_N     1/1    7126  7146 ..    40    60 ..     2.6      3.1
Dockerin_1       12/12   7147  7154 ..     2     9 ..     0.2       66
GbpC              1/1    7154  7176 ..     1    26 [.    -0.7      9.8
NOPS              1/1    7160  7175 ..    13    29 ..     2.2      2.2
SWIRM             1/1    7163  7185 ..     1    23 [.     1.9      7.6
Complex1_24kDa    1/1    7177  7188 ..   150   161 .]     1.4      6.1
S-methyl_trans    1/1    7177  7189 ..   332   344 .]     0.7        4
DUF257            1/1    7180  7192 ..     1    14 [.     0.4      8.3
Orthopox_F6       1/1    7180  7194 ..    58    72 .]     1.4      8.2
XFP_N             1/1    7305  7312 ..   389   396 .]    -0.5      9.4

Alignments of top-scoring domains:
DUF2472: domain 1 of 1, from 43 to 74: score 1.8, E = 6.8
                   *->tSeseggvSityedgyndfeeypaqLnkyrklrv<-*
                      t++ +   +++++d  +  ++y+ ++n+++   +
  gi|7108362    43    TARDQNKKNVVFID--SAVSDYETIINSFKENTE    74

SRX: domain 1 of 1, from 44 to 61: score 0.3, E = 9.7
                CS    TSSSTT--TTS---TTTTTHH
                   *->akGkgKKNvhNyvdIlegisd<-*
                      a+ ++KKNv   v+I  ++sd
  gi|7108362    44    ARDQNKKNV---VFIDSAVSD    61

Bse634I: domain 1 of 1, from 74 to 94: score 1.3, E = 3.4
                CS    EEEE-SCCHHHHHHHHHHH--
                   *->eiyvlssvaDldklldailkk<-*
                      e y+++s +D  k++++il+
  gi|7108362    74    EFYLINSNEDGFKRISEILND    94

Phage-tail_1: domain 1 of 1, from 97 to 106: score 2.8, E = 0.54
                CS    -SSEEEEEEH
                   *->DidGisImDy<-*
                      DidG++I ++
  gi|7108362    97    DIDGLHIIGH    106

HP_OMP: domain 1 of 1, from 112 to 148: score -0.1, E = 7.8
                   *->fDYghanfgsqkgasaansvassqqqv....nmfTYG<-*
                      + +g+a++++++++++ +  as++q+ ++++++++YG
  gi|7108362   112    ILFGNAFLNNDTITNYQSTLASIGQSLttsgDILFYG    148

Glyco_transf_34: domain 1 of 1, from 146 to 159: score 1.2, E = 4.7
                   *->FaGCnvcgtCaeei<-*
                      F+GCnv++t + ei
  gi|7108362   146    FYGCNVASTEQGEI    159

P2: domain 1 of 1, from 160 to 176: score 1.9, E = 7.5
                CS    HHHTSS......S-SEEEEEEEX
                   *->vikkisDVtlsfEvEevevkelv<-*
                      +ikkis      E+ ++++   +
  gi|7108362   160    LIKKIS------EITKADIAASD    176

IKI3: domain 1 of 1, from 202 to 215: score 0.8, E = 1.3
                   *->kRYekALshLsecg<-*
                      k+Y  AL++Ls+ g
  gi|7108362   202    KNYKHALGSLSSSG    215

Pmp24: domain 1 of 1, from 277 to 288: score 1.1, E = 5.5
                   *->tYLYhvDsesws<-*
                      tY++++D+++++
  gi|7108362   277    TYIFDDDNDTGD    288

Pescadillo_N: domain 1 of 1, from 281 to 303: score -0.2, E = 8.3
                   *->daevssslaaldvganqeqakvv<-*
                      d ++++ +aal +ganq++++++
  gi|7108362   281    DDDNDTGDAALQNGANQNASSNI    303

Stathmin: domain 1 of 1, from 311 to 328: score 2.5, E = 2.1
                CS    X----B-----SSEEEEE--
                   *->sDievkeleKrasGqaFEli<-*
                          v +++KrasG a E++
  gi|7108362   311    --FLVEDINKRASGSAGEVV    328

DNA_ligase_A_M: domain 1 of 1, from 312 to 336: score 0.7, E = 6.6
                CS    HHHHSCCHCSTTCE-EEEEEEEEEC
                   *->lveflkeaffpdvkdfILDGEivav<-*
                      lve + +++  ++ +++ DGEiv++
  gi|7108362   312    LVEDINKRASGSAGEVVFDGEIVGI    336

Fimbrial: domain 1 of 1, from 325 to 334: score 4.0, E = 0.96
                   *->GtvtFkGeVV<-*
                      G+v F+Ge+V
  gi|7108362   325    GEVVFDGEIV    334

A2M_N_2: domain 1 of 1, from 428 to 458: score 1.9, E = 6.1
                   *->LklsldkkeykvGetakvtvtgspfpagkfayl<-*
                      L+  + ++ + +G+ ++++v  + + +g  a +
  gi|7108362   428    LQFGAQNANVSAGDYIRILVV-PNSSDGS-ATV    458

AstA: domain 1 of 1, from 436 to 448: score -0.1, E = 9.2
                CS    T--TT-EEEEEE-
                   *->gVsaGDpVRivpL<-*
                      +VsaGD +Ri+
  gi|7108362   436    NVSAGDYIRILVV    448

Fil_haemagg: domain 1 of 4, from 451 to 486: score 0.7, E = 18
                CS    EEESSEEEETTTT--EE-SEEEEEE-STT-EEEE-S-E
                   *->vaaGaltlnaaalggldlnnggtlsagggltltaagll<-*
                       + G+ t++ +  g+ +  ngg+ s+   +t++++++l
  gi|7108362   451    SSDGSATVEED--GSVSVSNGGSASSPDPITVDSGSTL    486

Tissue_fac: domain 1 of 2, from 498 to 507: score 2.3, E = 5.1
                CS    EEEETTEEEE
                   *->feqdgTKltV<-*
                      f+ dgTKl V
  gi|7108362   498    FSDDGTKLFV    507

SGL: domain 1 of 1, from 550 to 564: score 2.0, E = 2.4
                   *->GlawSpDgktlYfaD<-*
                      G+a+S Dg++++ +D
  gi|7108362   550    GIAFSNDGTKMFTSD    564

DNA_pol_B_2: domain 1 of 1, from 596 to 689: score 0.2, E = 5.8
                   *->sLYGrFatkpesdkkkivfsedikslllltgeeeelkeisngkvlik
                      sLYG  a +   ++ +i fsed++ +l++ g+++++ +is g+++
  gi|7108362   596    SLYGVTASNS-LYNRDITFSEDGT-KLFILGSDKTVHQISLGTAWDL 640

                   skiklettlsnddnlsdifipnstatislarsglaqlsaalydpieelyy
                   s++  +        ++++ +++ t+t+++++s+ ++  ++ ++++++ +
  gi|7108362   641 SSYQTPD-------VEKDLSSILTDTYANSISFSPNGKKMFINEYNNTIH 683

                   idtdsi<-*
                    ++  +
  gi|7108362   684 EFSIAT    689

Tissue_fac: domain 2 of 2, from 613 to 622: score 2.0, E = 6.2
                CS    EEEETTEEEE
                   *->feqdgTKltV<-*
                      f++dgTKl +
  gi|7108362   613    FSEDGTKLFI    622

Nucleoporin: domain 1 of 1, from 635 to 659: score -2.1, E = 9.4
                   *->gvsvalsavdelkvdKkEnssvigit<-*
                      g+++ ls+ +++ v+K + ss+ + t
  gi|7108362   635    GTAWDLSSYQTPDVEK-DLSSILTDT    659

PD40: domain 1 of 1, from 653 to 676: score 3.4, E = 2.4
                   *->grltntsgeggPtwSPDGktivFs<-*
                      + +++++ +++ ++SP+Gk+++++
  gi|7108362   653    SSILTDTYANSISFSPNGKKMFIN    676

MORN_2: domain 1 of 2, from 659 to 680: score 3.6, E = 8.5
                   *->keGeekfyyenGklkeeieykn<-*
                      +     ++ +nGk   + ey+n
  gi|7108362   659    TYANSISFSPNGKKMFINEYNN    680

DUF1357: domain 1 of 1, from 749 to 766: score 0.6, E = 5.6
                   *->nIkqrknaennykvinflr<-*
                      n++q k ae ++++++++r
  gi|7108362   749    NVDQTKSAE-SISTVSSIR    766

Pentapeptide_2: domain 1 of 1, from 765 to 781: score 3.8, E = 3.3
                   *->gNtGslNiGSGNlGsgN<-*
                      + tG++ +GSG +Gs N
  gi|7108362   765    IRTGTVAAGSGTSGSTN    781

Mt_ATP-synt_D: domain 1 of 1, from 834 to 844: score 0.3, E = 9.9
                   *->iGLnHtPeEql<-*
                      iG+n tP+  +
  gi|7108362   834    IGINDTPIADN    844

He_PIG: domain 1 of 4, from 854 to 862: score 0.2, E = 29
                   *->tvtatdgsg<-*
                      t+t+tdgs
  gi|7108362   854    TLTVTDGSS    862

Attacin_N: domain 1 of 5, from 903 to 914: score 1.9, E = 11
                   *->qhGsvtvNsdGg<-*
                        G++t NsdG+
  gi|7108362   903    SYGALTMNSDGT    914

HYR: domain 1 of 5, from 930 to 948: score 2.3, E = 4.6
                   *->YtatDnaGNeAdsCtFtVtV<-*
                      Yt+tD+ G ++   t+t+tV
  gi|7108362   930    YTVTDEFGATD-IATLTITV    948

PKD: domain 1 of 23, from 931 to 948: score 3.3, E = 1.7
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tv+++ g+++  t+t+tV
  gi|7108362   931    TVTDEFGATDIATLTITV    948

SEA: domain 1 of 1, from 984 to 1019: score 1.6, E = 8.3
                   *->iFr.ptteesavdkteiseeleaalrsqsgnlkidss<-*
                      iF+ ++++ s+ d++ +s++  + l s  g l++ s+
  gi|7108362   984    IFAaSDFNYSDGDSDSLSKIKITTLESA-GVLEYSSN    1019

Dockerin_1: domain 1 of 12, from 1025 to 1038: score 1.6, E = 24
                CS    -TT-SS--SHHHHH
                   *->DvNgDGkVnalDla<-*
                      Dv  +  ++a D++
  gi|7108362  1025    DVTLNQEITASDIS    1038

LRR_adjacent: domain 1 of 3, from 1029 to 1040: score 0.2, E = 35
                CS    S-B--ECEECCC
                   *->GalitPktISdN<-*
                       + it ++IS+N
  gi|7108362  1029    NQEITASDISNN    1040

CHL4: domain 1 of 1, from 1096 to 1105: score 1.5, E = 2.3
                   *->GvssgvvrdG<-*
                      G+ssg+v+dG
  gi|7108362  1096    GTSSGDVHDG    1105

PKD: domain 2 of 23, from 1143 to 1170: score 0.1, E = 17
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECE
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvs<-*
                      vs++    g+ ++a++ t+t tass    + +++++
  gi|7108362  1143    VSGT---YGSLNIAANGTYTYTASS----T-NNIAY    1170

Y_Y_Y: domain 1 of 1, from 1187 to 1204: score 2.7, E = 4.6
                   *->dkdgnwsyddiasltftvl<-*
                      +++g+++yd   s+tftv+
  gi|7108362  1187    SNSGSNAYDV-GSITFTVA    1204

Peptidase_M42: domain 1 of 1, from 1241 to 1251: score -0.1, E = 8.8
                CS    EEEEEEEETTS
                   *->GfMVteIddnG<-*
                      G++Vt+I+++G
  gi|7108362  1241    GLVVTHIKKDG    1251

Big_3: domain 1 of 4, from 1309 to 1322: score 5.1, E = 1.7
                   *->ytYkGqpvtatftVtV<-*
                      yt +G  +ta++t+tV
  gi|7108362  1309    YTADG--ATANLTITV    1322

DUF1521: domain 1 of 4, from 1376 to 1414: score 2.2, E = 1.2
                   *->lvanqnGkGWvDeqtGhavtqadldlte...ngaiygdgk<-*
                      l++n nG+ WvD    ++ t+ d+  ++ + n+a+  +g+
  gi|7108362  1376    LQYN-NGSAWVDVTENQVITATDIGNNKlrfNPAANENGS    1414

SAF: domain 1 of 4, from 1383 to 1399: score 1.8, E = 14
                CS    BSS-B-TT-B--GGGCS
                   *->arrdiaaGepltpsdle<-*
                      a++d+ +++++t+ d+
  gi|7108362  1383    AWVDVTENQVITATDIG    1399

PDEase_I: domain 1 of 4, from 1384 to 1402: score 2.5, E = 0.64
                   *->LadvvekDdiqplldtiedNr<-*
                      ++dv+e   +++ +d i +N+
  gi|7108362  1384    WVDVTEN-QVITATD-IGNNK    1402

Dockerin_1: domain 2 of 12, from 1386 to 1398: score 5.8, E = 1.2
                CS    -TT-SS--SHHHH
                   *->DvNgDGkVnalDl<-*
                      Dv ++ +++a+D+
  gi|7108362  1386    DVTENQVITATDI    1398

Copper-bind: domain 1 of 3, from 1392 to 1409: score 0.8, E = 11
                CS    EEEEEEETTEETSEEESSE
                   *->aevllgvdsgdqmvFepke<-*
                      +  ++++++++ + F+p++
  gi|7108362  1392    VITATDIGNNK-LRFNPAA    1409

Flagellin_IN: domain 1 of 7, from 1418 to 1446: score 5.1, E = 1.4
                   *->tltinggggkens.vadgvdislsagdsl<-*
                      ++++++++g+++s  a++++++++a+ ++
  gi|7108362  1418    SFDFTVNDGDADSaSANTITVNVTAVNDA    1446

Glyco_transf_36: domain 1 of 4, from 1426 to 1444: score 0.6, E = 13
                   *->gnadsdsahpifskldvet<-*
                      g+ads sa+ i  ++++ +
  gi|7108362  1426    GDADSASANTITVNVTAVN    1444

Haemagg_act: domain 1 of 5, from 1428 to 1446: score 0.3, E = 14
                CS    X---EE-TT-EEE-...-T
                   *->aqslpdgglvtngtvtiqa<-*
                      a+s+++++  +n+t+ ++a
  gi|7108362  1428    ADSASANTITVNVTAVNDA    1446

Fil_haemagg: domain 2 of 4, from 1431 to 1487: score 0.4, E = 22
                CS    EEESSEEEETT  TT--EE-SEEEEEE-STT-EEEE-S-EEESSE..
                   *->vaaGaltlnaa..alggldlnnggtlsagggltltaagllnnggtli
                      ++a++ t+n++  +++  ++n + +++ +++lt+t +  +  +g
  gi|7108362  1431    ASANTITVNVTavNDAPVADNETNSVNEDATLTVTDGTSDVLHG--- 1474

                CS .................EEEEESS-EEEEE
                   aggdlllaagalrnggdltltaaGdLdnsg<-*
                                     t t  ++L++++
  gi|7108362  1475 -----------------DTDTENDALTVTQ    1487

Gp5_C: domain 1 of 11, from 1450 to 1468: score 2.7, E = 10
                CS    S-EEEEESS-EEEEES SE
                   *->GnesltVkGnrtvtVg.Gn<-*
                      +ne+ +V+ ++t+tV +G+
  gi|7108362  1450    DNETNSVNEDATLTVTdGT    1468

HIM: domain 1 of 7, from 1476 to 1488: score 5.0, E = 2.1
                CS    .-EETT-TT--CC
                   *->tvtktDAvnvsQL<-*
                      t t++DA++v+Q
  gi|7108362  1476    TDTENDALTVTQI    1488

Big_2: domain 1 of 4, from 1484 to 1503: score 0.4, E = 20
                CS    EEEEEEETTT.TEEES--SEEE
                   *->avtsvtvsptgntaslakGatl<-*
                       vt+++v+++  +as ++G ++
  gi|7108362  1484    TVTQIAVTGA--SASSVAGSST    1503

Attacin_N: domain 2 of 5, from 1498 to 1510: score 2.0, E = 10
                   *->qhGsvtvNsdGgs<-*
                       +Gs t Ns+G+s
  gi|7108362  1498    VAGSSTYNSNGTS    1510

FlgN: domain 1 of 1, from 1499 to 1512: score 0.9, E = 9.8
                   *->assttYgadGqtst<-*
                      a+s+tY+++G ++t
  gi|7108362  1499    AGSSTYNSNGTSKT    1512

PKD: domain 3 of 23, from 1551 to 1567: score 5.9, E = 0.28
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++at +t+tV
  gi|7108362  1551    TVSDGTATDTAT-ITITV    1567

Cadherin: domain 1 of 10, from 1552 to 1568: score 0.8, E = 16
                CS    ----.........S---EEEE--EEE-
                   *->AtDadpllasgggpplsstatvtitVl<-*
                      ++D+            ++tat+titV+
  gi|7108362  1552    VSDG----------TATDTATITITVT    1568

Big_3: domain 2 of 4, from 1560 to 1567: score 0.0, E = 41
                   *->tatftVtV<-*
                      tat+t+tV
  gi|7108362  1560    TATITITV    1567

Mid2: domain 1 of 3, from 1592 to 1618: score 2.3, E = 3.7
                   *->nidDfeiidadDvlntseplsvgatnsdar<-*
                      +++Df+ +dadD   ++ + sv++t  ++
  gi|7108362  1592    SASDFGYTDADD---DDALVSVKITGLESA    1618

DUF1521: domain 2 of 4, from 1621 to 1659: score 2.2, E = 1.2
                   *->lvanqnGkGWvDeqtGhavtqadldlte...ngaiygdgk<-*
                      l++n nG+ WvD    ++ t+ d+  ++ + n+a+  +g+
  gi|7108362  1621    LQYN-NGSAWVDVTENQVITATDIGNNKlrfNPAANENGS    1659

SAF: domain 2 of 4, from 1628 to 1644: score 1.8, E = 14
                CS    BSS-B-TT-B--GGGCS
                   *->arrdiaaGepltpsdle<-*
                      a++d+ +++++t+ d+
  gi|7108362  1628    AWVDVTENQVITATDIG    1644

PDEase_I: domain 2 of 4, from 1629 to 1647: score 2.5, E = 0.64
                   *->LadvvekDdiqplldtiedNr<-*
                      ++dv+e   +++ +d i +N+
  gi|7108362  1629    WVDVTEN-QVITATD-IGNNK    1647

Dockerin_1: domain 3 of 12, from 1631 to 1643: score 5.8, E = 1.2
                CS    -TT-SS--SHHHH
                   *->DvNgDGkVnalDl<-*
                      Dv ++ +++a+D+
  gi|7108362  1631    DVTENQVITATDI    1643

Copper-bind: domain 2 of 3, from 1637 to 1654: score 0.8, E = 11
                CS    EEEEEEETTEETSEEESSE
                   *->aevllgvdsgdqmvFepke<-*
                      +  ++++++++ + F+p++
  gi|7108362  1637    VITATDIGNNK-LRFNPAA    1654

Flagellin_IN: domain 2 of 7, from 1663 to 1691: score 5.1, E = 1.4
                   *->tltinggggkens.vadgvdislsagdsl<-*
                      ++++++++g+++s  a++++++++a+ ++
  gi|7108362  1663    SFDFTVNDGDADSaSANTITVNVTAVNDA    1691

Glyco_transf_36: domain 2 of 4, from 1671 to 1689: score 0.6, E = 13
                   *->gnadsdsahpifskldvet<-*
                      g+ads sa+ i  ++++ +
  gi|7108362  1671    GDADSASANTITVNVTAVN    1689

Haemagg_act: domain 2 of 5, from 1673 to 1700: score 1.6, E = 5.9
                CS    X---EE-TT-EEE-...-TTS--EEE--
                   *->aqslpdgglvtngtvtiqatgvpitggt<-*
                      a+s+++++  +n+t+ ++a ++ +++g+
  gi|7108362  1673    ADSASANTITVNVTAVNDAPTARGDTGI    1700

Big_2: domain 2 of 4, from 1696 to 1731: score 0.8, E = 15
                CS    TT.... SBEEEEES-TTTEEEE...     .TTTE
                   *->snkdiT.kkvtWsSsnpsvAtVsntn.....SgstG<-*
                      ++++i++++vt ++sn+s At s+t  +  +S+s G
  gi|7108362  1696    GDTGIVnEDVTLTVSNSSNATTSVTAasfvrSKSLG    1731

He_PIG: domain 2 of 4, from 1704 to 1714: score 0.6, E = 22
                   *->tftvtatdgsg<-*
                      ++t+t++++s+
  gi|7108362  1704    DVTLTVSNSSN    1714

PKD: domain 4 of 23, from 1704 to 1726: score 0.4, E = 14
                CS    EEEEEEEETTCEEEEEE EEEEE
                   *->tVtLtvsngvgsasatt.ttvtV<-*
                      +VtLtvsn+ +++++ t ++++
  gi|7108362  1704    DVTLTVSNSSNATTSVTaASFVR    1726

SUN: domain 1 of 1, from 1705 to 1747: score 0.1, E = 5.9
                   *->tsvlsStaasattssAAssatsSssedsaseskrdgkFe.DGT<-*
                       +   S++  atts  A s   S s  +a  +  + kF +DGT
  gi|7108362  1705    VTLTVSNSSNATTSVTAASFVRSKSLGDAGYQSQETKFSpDGT    1747

MORN_2: domain 2 of 2, from 1735 to 1757: score 0.6, E = 59
                   *->keGeekfyyenGklkeei.eykn<-*
                       +  e+++ ++G     +++y+n
  gi|7108362  1735    YQSQETKFSPDGTKMFVLdTYQN    1757

Baculo_ODV-E27: domain 1 of 1, from 1782 to 1799: score 0.3, E = 4.5
                   *->Edfdkikssssgkklgfkkil<-*
                      E+fd ++ +ss+++++   ++
  gi|7108362  1782    ETFDLSNENSSSSNFT---FN    1799

FAINT: domain 1 of 1, from 1783 to 1845: score 2.6, E = 3.5
                   *->tLDlnnsessnkksstdefdyikvhlslsngvnyktytpk.sgykrf
                      t+Dl      ++ +s+++                 ++t++++g k f
  gi|7108362  1783    TFDL------SNENSSSS-----------------NFTFNnDGTK-F 1805

                   skVnkdtvNiSqygneglitsgdtviWeskdgeelskvvvvylkdkkkvl
                               y+           ++e++ +  + +++++y+++  +
  gi|7108362  1806 YSA---------YSGR---------LYEYDVSTAYDISTSSYNNNFFD-- 1835

                   vnslNpkskylvlllinnsk<-*
                             l+l   n+ +
  gi|7108362  1836 ----------LILEYPNTRN    1845

DUF646: domain 1 of 1, from 1800 to 1814: score 2.4, E = 2.9
                   *->NDGTkfpsykakaGrkY<-*
                      NDGTk   y+a +Gr+Y
  gi|7108362  1800    NDGTK--FYSAYSGRLY    1814

PQQ: domain 1 of 2, from 1802 to 1820: score 1.9, E = 12
                CS    TEEEEETTTSEEEEEETTT
                   *->gvvyvgtadGylyAlDakT<-*
                      g+ ++  ++G+ly +D++T
  gi|7108362  1802    GTKFYSAYSGRLYEYDVST    1820

PQQ: domain 2 of 2, from 1849 to 1866: score 0.6, E = 28
                CS    TEEEEE TTTSEEEEEET
                   *->gvvyvg.tadGylyAlDa<-*
                      gv+++ +++  +l+AlDa
  gi|7108362  1849    GVNVAFnSDGTKLFALDA    1866

EI24: domain 1 of 1, from 1863 to 1888: score 7.2, E = 0.078
                   *->aygavprsshevssrEACqHLDspttfpsparS<-*
                      a  a++r +he s +       + ++++s++r+
  gi|7108362  1863    ALDAQQREVHEYSLS-------TAFDVTSASRT    1888

DUF1306: domain 1 of 1, from 1882 to 1897: score 1.3, E = 5.9
                   *->vesPqivnnyveiagv<-*
                      v s++ +nnyv+++++
  gi|7108362  1882    VTSASRTNNYVSVGTQ    1897

IRK_N: domain 1 of 1, from 1883 to 1898: score 1.7, E = 7.8
                   *->taavRanrYsivssEE<-*
                      t+a+R+n Y  v   E
  gi|7108362  1883    TSASRTNNYVSVGTQE    1898

Cu2_monoox_C: domain 1 of 1, from 1896 to 1924: score 2.8, E = 1.7
                   *->ssvelpysacsgdflpkyFgsnfpsdvsv<-*
                      ++++ py++++++   k F s  ++dv++
  gi|7108362  1896    TQEASPYGFAFSNDGKKMFISGLGKDVNE    1924

NAF: domain 1 of 1, from 1926 to 1938: score 2.8, E = 3.1
                   *->SSlSsGfDLSGLFE<-*
                      + lS+GfDLS+ FE
  gi|7108362  1926    T-LSTGFDLSSTFE    1938

TMP_2: domain 1 of 1, from 2012 to 2024: score 0.5, E = 8.7
                   *->hfLtAaqleqIaa<-*
                      ++Lt++++ +++a
  gi|7108362  2012    DALTVTTYSHTSA    2024

DUF2216: domain 1 of 2, from 2033 to 2046: score 0.5, E = 7.3
                   *->SStsStGSagSpDq<-*
                      SStsStG ag +
  gi|7108362  2033    SSTSSTGTAGTNNV    2046

Bromo_MP: domain 1 of 1, from 2062 to 2101: score 1.1, E = 6
                   *->teglDfTvkekeeddkdegkkkgivlteavkesesskvvegkgviee
                      t++ D+Tv+++ + +              v++  + +v +g+g +++
  gi|7108362  2062    TYTADLTVTQALDSGDT------------VTDIFTYTVDDGNGGTDT 2096

                   atvtv<-*
                    t+t+
  gi|7108362  2097 VTITI    2101

SoxZ: domain 1 of 1, from 2083 to 2101: score 1.1, E = 8.8
                CS    EEEEETTS-EEEEEEEE--
                   *->fsWtDnkGssetaeakItv<-*
                      f++t ++G+ +t++++It+
  gi|7108362  2083    FTYTVDDGNGGTDTVTITI    2101

HYR: domain 2 of 5, from 2084 to 2103: score 2.3, E = 4.8
                   *->tYtatDnaGNeAdsCtFtVtV<-*
                      tYt+ D +G ++ + t t+tV
  gi|7108362  2084    TYTVDDGNGGTD-TVTITITV    2103

PKD: domain 5 of 23, from 2086 to 2103: score 4.4, E = 0.83
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tv +g+g +++ t+t+tV
  gi|7108362  2086    TVDDGNGGTDTVTITITV    2103

Xol-1_GHMP-like: domain 1 of 2, from 2116 to 2140: score 6.9, E = 0.041
                CS    EEE-----------EE-HHHHHHEE
                   *->VgilAEDGsLEnsnGttEHFnKKyD<-*
                      Vg++ EDG L  snG        yD
  gi|7108362  2116    VGVIVEDGTLTVSNGANANVSGSYD    2140

Endotoxin_mid: domain 1 of 1, from 2125 to 2138: score 0.6, E = 5.5
                CS    EE------EEEE--
                   *->LlvssGAnLYAsGs<-*
                      L vs GAn   sGs
  gi|7108362  2125    LTVSNGANANVSGS    2138

DUF2190: domain 1 of 1, from 2251 to 2270: score 2.6, E = 3.5
                   *->YvQpGkTItvtAaaaAVaSGd<-*
                      ++++G T+tv++ a A +SG+
  gi|7108362  2251    FIKEGGTLTVANSA-AANSGA    2270

Haemagg_act: domain 3 of 5, from 2263 to 2304: score 3.6, E = 1.5
                CS    X---EE-TT-EEE-...-TTS--EEE-----TTSEEEEEEEE
                   *->aqslpdgglvtngtvtiqatgvpitggtipqtsgnlfisfss<-*
                      ++++ +g++  n t++i+++g  it +t++  +gn++ +fss
  gi|7108362  2263    SAAANSGASTGNHTGDITDNGSNITSITATTAGGNAQTTFSS    2304

Attacin_N: domain 3 of 5, from 2314 to 2323: score 0.8, E = 22
                   *->qhGsvtvNsdGg<-*
                        G++t+NsdG+
  gi|7108362  2314    --GTLTINSDGS    2323

DUF48: domain 1 of 1, from 2315 to 2332: score 1.7, E = 3.1
                   *->tLYittqGtylrkdnerl<-*
                      tL i+++G+y  + n ++
  gi|7108362  2315    TLTINSDGSYSYVANSNI    2332

PKD: domain 6 of 23, from 2371 to 2388: score 6.3, E = 0.22
                CS    EEEEETTCEEEEEEEEEEE
                   *->LtvsngvgsasattttvtV<-*
                      Lt+ +++g+++   +t++V
  gi|7108362  2371    LTARDDNGTVNED-ATLEV    2388

Gp5_C: domain 2 of 11, from 2374 to 2398: score 6.1, E = 0.91
                CS    S-EEEEESS-EEEEES SEEEEEES
                   *->GnesltVkGnrtvtVg.GnqTtsVg<-*
                       +++ tV+ ++t+ V++G++ t+V
  gi|7108362  2374    RDDNGTVNEDATLEVDdGDNLTTVA    2398

ER_lumen_recept: domain 1 of 1, from 2441 to 2455: score 1.0, E = 5.9
                   *->ScsGiSlkTQiLYai<-*
                      S+sG+S+++ + Y +
  gi|7108362  2441    SASGLSGRSLFQYTL    2455

DUF2216: domain 2 of 2, from 2461 to 2471: score 0.0, E = 10
                   *->sStGSagSpDq<-*
                      +St+S+ S+D+
  gi|7108362  2461    VSTASVSSNDN    2471

ClpS: domain 1 of 1, from 2533 to 2547: score 4.2, E = 3.6
                   *->lkpppmYkViLlNDD<-*
                       + ++ Y++ L+NDD
  gi|7108362  2533    GNQYKNYRTFLFNDD    2547

DUF520: domain 1 of 1, from 2535 to 2540: score -0.7, E = 8.7
                   *->QFtNFR<-*
                      Q++N+R
  gi|7108362  2535    QYKNYR    2540

DUF2416: domain 1 of 1, from 2602 to 2614: score 0.3, E = 7.4
                   *->tkyiGSaaKlsrk<-*
                      t++iGS aK+s++
  gi|7108362  2602    TTTIGSTAKISQW    2614

PhoPQ_related: domain 1 of 1, from 2645 to 2656: score -1.6, E = 3.8
                   *->vPNQpLtFandg<-*
                      vP Q++tF+ndg
  gi|7108362  2645    VPTQFITFNNDG    2656

Fmp27_GFWDK: domain 1 of 1, from 2650 to 2671: score 1.5, E = 1.2
                   *->inwkkdGdfhlhlKGSrDPYki<-*
                      i +++dG+   ++ GS+DP ki
  gi|7108362  2650    ITFNNDGSKFFSFNGSSDPAKI    2671

DUF2458: domain 1 of 1, from 2667 to 2674: score 1.2, E = 5
                   *->DPsyITnw<-*
                      DP++I++w
  gi|7108362  2667    DPAKIKEW    2674

Peptidase_S9_N: domain 1 of 1, from 2702 to 2717: score 0.5, E = 4
                CS    EEEETTTTCEEEEEEE
                   *->Ydldlatgerellkdr<-*
                      Yd+d++++++++ + r
  gi|7108362  2702    YDTDPDSDTLTVTAIR    2717

YycH: domain 1 of 1, from 2749 to 2762: score 0.6, E = 4.1
                   *->itkdllykegAekggE<-*
                      +t  ++++ +A+++++
  gi|7108362  2749    YT--YVANQDAADALD    2762

CoatB: domain 1 of 1, from 2757 to 2768: score 3.0, E = 4.9
                   *->asasaidvgDVvt<-*
                       +a a d+gDVvt
  gi|7108362  2757    -AADALDPGDVVT    2768

Big_1: domain 1 of 5, from 2781 to 2803: score 1.2, E = 5.7
                CS    SS--EEEEEEEEETTTEE-TT-E
                   *->gndaiTlTAtVkDanGnPVagqe<-*
                      ++d + lT+tV+  n++PVa+ e
  gi|7108362  2781    ETDIAVLTITVNGINDTPVADAE    2803

Herpes_ICP4_C: domain 1 of 1, from 2813 to 2852: score -1.1, E = 7.1
                   *->lnppegtsaaly.slaeamvAhpriPsvtWdsgfGgsaeTv<-*
                      l++++gts +l++  + +  A++ ++s++  ++ G+ a+ v
  gi|7108362  2813    LTVTDGTSDLLHgDTDADASASLSVSSIVATTASGS-ATAV    2852

CBM_5_12: domain 1 of 1, from 2849 to 2861: score 4.1, E = 4.7
                CS    --B--TTEEE-TT
                   *->apaWqagtvYtgG<-*
                      a+a ++gt+Y+ G
  gi|7108362  2849    ATAVNPGTAYNSG    2861

PKD: domain 7 of 23, from 2896 to 2912: score 0.4, E = 14
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      t s+g  + +at +t+tV
  gi|7108362  2896    TLSDGTATHTAT-LTITV    2912

I-set: domain 1 of 5, from 2900 to 2910: score 2.3, E = 6.3
                CS    EEEEEEEEEEE
                   *->GeaeasaeLtV<-*
                      G+a+ +a+Lt+
  gi|7108362  2900    GTATHTATLTI    2910

PPC: domain 1 of 1, from 3016 to 3126: score 2.0, E = 7.4
                CS    -EEEEEEEES     TTCE EEEEE            ECTSSS...S
                   *->dvdvysFtvp.....aggt.lsisl............dggsslrsls
                       +dv++ t++++++++ + +l+i++++ ++ ++ ++++g+
  gi|7108362  3016    VTDVFTYTISdgnggTDTAnLTITVtgvndapsatndTGSV------ 3056

                CS ...CCEEEEEEECCCS ESSSSTTCE-.....ECCTTEEEEEECC
                   gnGdadtlLywlldgd.pslsaydaystTrdvdnggsdelisfta.....
                      + d+ L+ ++++++++++++d ++     d ++s +++ +t  ++++
  gi|7108362  3057 ---NEDATLT-VSTASsGVTQDNDTDA-----DADDSASSLVITQikkdg 3097

                CS                 .-SEEE EEEEEE
                   ................peaGtY.yirVyg<-*
                   +++++ ++++++++++  +GtY+ + + +
  gi|7108362  3098 gsnssvsggtnhsngtSVTGTYgTLVIGA    3126

HYR: domain 3 of 5, from 3021 to 3040: score 7.5, E = 0.14
                   *->tYtatDnaGNeAdsCtFtVtV<-*
                      tYt +D +G ++ + ++t+tV
  gi|7108362  3021    TYTISDGNGGTD-TANLTITV    3040

PKD: domain 8 of 23, from 3023 to 3040: score 2.3, E = 3.5
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      t s+g+g +++ ++t+tV
  gi|7108362  3023    TISDGNGGTDTANLTITV    3040

Cadherin: domain 2 of 10, from 3031 to 3041: score 0.5, E = 20
                CS    -EEEE--EEE-
                   *->sstatvtitVl<-*
                      ++ta +titV+
  gi|7108362  3031    TDTANLTITVT    3041

I-set: domain 2 of 5, from 3049 to 3064: score 8.1, E = 0.13
                CS    EEETTEEEEEEEEEEE
                   *->AtNsaGeaeasaeLtV<-*
                      AtN  G++  +a+LtV
  gi|7108362  3049    ATNDTGSVNEDATLTV    3064

PKD: domain 9 of 23, from 3049 to 3064: score 4.6, E = 0.7
                CS    EEETTCEEEEEEEEEEE
                   *->vsngvgsasattttvtV<-*
                      ++n+ gs++   +t+tV
  gi|7108362  3049    ATNDTGSVNED-ATLTV    3064

Gp5_C: domain 3 of 11, from 3050 to 3064: score 0.6, E = 47
                CS    S-EEEEESS-EEEEE
                   *->GnesltVkGnrtvtV<-*
                       n++ +V+ ++t+tV
  gi|7108362  3050    TNDTGSVNEDATLTV    3064

DUF1869: domain 1 of 1, from 3057 to 3079: score 0.7, E = 2.1
                   *->nnkatyllTVTNNsNGVSVDkdfea<-*
                      n  a  +lTV   s GV  D d++a
  gi|7108362  3057    NEDA--TLTVSTASSGVTQDNDTDA    3079

B_lectin: domain 1 of 1, from 3100 to 3128: score 6.9, E = 0.28
                CS    SSSETTSEEETTBEEEET  EEEEEETTS
                   *->nrtyvWvANrdnpslpvs..gtLkiqsDG<-*
                      n  +++ +N+ n+++ +++ gtL+i+++G
  gi|7108362  3100    NSSVSGGTNHSNGTSVTGtyGTLVIGANG    3128

HYR: domain 4 of 5, from 3153 to 3172: score 5.8, E = 0.42
                   *->tYtatDnaGNeAdsCtFtVtV<-*
                      tYt++D +G ++ + + t+tV
  gi|7108362  3153    TYTVSDGNGGTD-TANITITV    3172

PKD: domain 10 of 23, from 3155 to 3172: score 5.8, E = 0.3
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g+g +++ ++t+tV
  gi|7108362  3155    TVSDGNGGTDTANITITV    3172

Flagellin_IN: domain 3 of 7, from 3167 to 3190: score 1.2, E = 18
                   *->tltinggggkensvadgvdislsagdslaa<-*
                      ++ti+++g + +      +i ++++ds+ +
  gi|7108362  3167    NITITVTGVNDD------PIGVNDTDSVNE    3190

DUF2057: domain 1 of 2, from 3192 to 3220: score 2.0, E = 2.7
                   *->atLtlpdnielLaVnGkkveLssslfsgtssleLpd<-*
                      at+t +++ elL+++   ++       ++ssl+ ++
  gi|7108362  3192    ATITESSGSELLVADDTDAD-------DSSSLTVTQ    3220

SRR: domain 1 of 5, from 3239 to 3252: score 1.7, E = 50
                   *->ekfekVknnYelLs<-*
                       +f+ V + Y+ L+
  gi|7108362  3239    SNFTTVTGTYGTLK    3252

PKD: domain 11 of 23, from 3284 to 3300: score 3.6, E = 1.4
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++at + +tV
  gi|7108362  3284    TVSDGTATSTAT-LIITV    3300

Cadherin: domain 3 of 10, from 3285 to 3301: score 2.1, E = 6.7
                CS    ----.........S---EEEE--EEE-
                   *->AtDadpllasgggpplsstatvtitVl<-*
                      ++D+            +stat++itV+
  gi|7108362  3285    VSDG----------TATSTATLIITVT    3301

Flocculin: domain 1 of 5, from 3287 to 3307: score 1.7, E = 20
                   *->tgtFTsTYStemTTvtGTnGlp<-*
                      +gt TsT  t++ TvtG n +p
  gi|7108362  3287    DGTATST-ATLIITVTGINDVP    3307

I-set: domain 3 of 5, from 3288 to 3298: score 1.6, E = 9.6
                CS    EEEEEEEEEEE
                   *->GeaeasaeLtV<-*
                      G+a+++a+L++
  gi|7108362  3288    GTATSTATLII    3298

DUF2057: domain 2 of 2, from 3320 to 3348: score 2.0, E = 2.7
                   *->atLtlpdnielLaVnGkkveLssslfsgtssleLpd<-*
                      at+t +++ elL+++   ++       ++ssl+ ++
  gi|7108362  3320    ATITESSGSELLVADDTDAD-------DSSSLTVTQ    3348

SRR: domain 2 of 5, from 3367 to 3380: score 1.7, E = 50
                   *->ekfekVknnYelLs<-*
                       +f+ V + Y+ L+
  gi|7108362  3367    SNFTTVTGTYGTLK    3380

Cadherin: domain 4 of 10, from 3413 to 3429: score 1.6, E = 9.6
                CS    ----.........S---EEEE--EEE-
                   *->AtDadpllasgggpplsstatvtitVl<-*
                      ++D+           +++tat++itV+
  gi|7108362  3413    VSDN----------TWFDTATLIITVT    3429

APC_crr: domain 1 of 4, from 3438 to 3453: score 2.0, E = 19
                CS    ---------SS------
                   *->edtsksyavEdTPlnfS<-*
                      +d+++  + EdTP++fS
  gi|7108362  3438    ADKTVTTN-EDTPYVFS    3453

Thy1: domain 1 of 3, from 3446 to 3470: score 0.5, E = 9.8
                CS    EEEEE---TTSS---S-..-HHHHHHH
                   *->advgfinltdaeivtdvkpdaadalie<-*
                       d++++ + ++ ++td+  d++dal++
  gi|7108362  3446    EDTPYVFSANDFGYTDA--DDDDALVS    3470

DUF1521: domain 3 of 4, from 3482 to 3520: score 2.2, E = 1.2
                   *->lvanqnGkGWvDeqtGhavtqadldlte...ngaiygdgk<-*
                      l++n nG+ WvD    ++ t+ d+  ++ + n+a+  +g+
  gi|7108362  3482    LQYN-NGSAWVDVTENQVITATDIGNNKlrfNPAANENGS    3520

SAF: domain 3 of 4, from 3489 to 3505: score 1.8, E = 14
                CS    BSS-B-TT-B--GGGCS
                   *->arrdiaaGepltpsdle<-*
                      a++d+ +++++t+ d+
  gi|7108362  3489    AWVDVTENQVITATDIG    3505

PDEase_I: domain 3 of 4, from 3490 to 3508: score 2.5, E = 0.64
                   *->LadvvekDdiqplldtiedNr<-*
                      ++dv+e   +++ +d i +N+
  gi|7108362  3490    WVDVTEN-QVITATD-IGNNK    3508

Dockerin_1: domain 4 of 12, from 3492 to 3504: score 5.8, E = 1.2
                CS    -TT-SS--SHHHH
                   *->DvNgDGkVnalDl<-*
                      Dv ++ +++a+D+
  gi|7108362  3492    DVTENQVITATDI    3504

Copper-bind: domain 3 of 3, from 3498 to 3515: score 0.8, E = 11
                CS    EEEEEEETTEETSEEESSE
                   *->aevllgvdsgdqmvFepke<-*
                      +  ++++++++ + F+p++
  gi|7108362  3498    VITATDIGNNK-LRFNPAA    3515

Flagellin_IN: domain 4 of 7, from 3524 to 3552: score 5.1, E = 1.4
                   *->tltinggggkens.vadgvdislsagdsl<-*
                      ++++++++g+++s  a++++++++a+ ++
  gi|7108362  3524    SFDFTVNDGDADSaSANTITVNVTAVNDA    3552

Glyco_transf_36: domain 3 of 4, from 3532 to 3550: score 0.6, E = 13
                   *->gnadsdsahpifskldvet<-*
                      g+ads sa+ i  ++++ +
  gi|7108362  3532    GDADSASANTITVNVTAVN    3550

Haemagg_act: domain 4 of 5, from 3534 to 3568: score 1.2, E = 7.8
                CS    X---EE-TT-EEE-...-TTS--EEE-----TTSE
                   *->aqslpdgglvtngtvtiqatgvpitggtipqtsgn<-*
                      a+s+++++  +n+t+ ++a  +  ++g++  ++++
  gi|7108362  3534    ADSASANTITVNVTAVNDAPVADDETGAVNEDATL    3568

Fil_haemagg: domain 3 of 4, from 3537 to 3593: score 0.8, E = 16
                CS    EEESSEEEETT  TT--EE-SEEEEEE-STT-EEEE-S-EEESSE..
                   *->vaaGaltlnaa..alggldlnnggtlsagggltltaagllnnggtli
                      ++a++ t+n++  +++  +++ +g+++ +++lt+t +  +  +g+++
  gi|7108362  3537    ASANTITVNVTavNDAPVADDETGAVNEDATLTVTDGTSDVLHGDTD 3583

                CS .................EEEEE
                   aggdlllaagalrnggdltlta<-*
                   a +d+            lt+t+
  gi|7108362  3584 ADSDT------------LTVTT    3593

I-set: domain 4 of 5, from 3554 to 3570: score 0.6, E = 18
                CS    EEEETTEEEEEEEEEEE
                   *->vAtNsaGeaeasaeLtV<-*
                      vA  + G +  +a+LtV
  gi|7108362  3554    VADDETGAVNEDATLTV    3570

Gp5_C: domain 4 of 11, from 3556 to 3574: score 2.7, E = 10
                CS    S-EEEEESS-EEEEES SE
                   *->GnesltVkGnrtvtVg.Gn<-*
                      ++e+  V+ ++t+tV +G+
  gi|7108362  3556    DDETGAVNEDATLTVTdGT    3574

PKD: domain 12 of 23, from 3662 to 3678: score 3.7, E = 1.4
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      t s+g  +++at +t+tV
  gi|7108362  3662    TLSDGTATDTAT-ITITV    3678

Big_2: domain 3 of 4, from 3663 to 3689: score 0.1, E = 24
                CS    EEEE-SSS-EEEEEEETT.TEEEEEEE
                   *->lVtalakGtatItatsgdgnksasvtv<-*
                      l  + a+ tatIt t+  +n+   + +
  gi|7108362  3663    LSDGTATDTATITITVTGINDAPAAVN    3689

Cadherin: domain 5 of 10, from 3669 to 3679: score 1.0, E = 15
                CS    -EEEE--EEE-
                   *->sstatvtitVl<-*
                      ++tat+titV+
  gi|7108362  3669    TDTATITITVT    3679

Big_3: domain 3 of 4, from 3671 to 3678: score 0.0, E = 41
                   *->tatftVtV<-*
                      tat+t+tV
  gi|7108362  3671    TATITITV    3678

DUF1521: domain 4 of 4, from 3861 to 3899: score 3.6, E = 0.41
                   *->lvanqnGkGWvDeqtGhavtqadldlte...ngaiygdgk<-*
                      l++n nG+ WvD    ++ t+ d+ +++ + n+a+  +g+
  gi|7108362  3861    LQYN-NGSAWVDVTENQVITATDIAANKlrfNPAANENGS    3899

SAF: domain 4 of 4, from 3868 to 3884: score 3.1, E = 6.3
                CS    BSS-B-TT-B--GGGCS
                   *->arrdiaaGepltpsdle<-*
                      a++d+ +++++t+ d++
  gi|7108362  3868    AWVDVTENQVITATDIA    3884

PDEase_I: domain 4 of 4, from 3869 to 3887: score 3.2, E = 0.36
                   *->LadvvekDdiqplldtiedNr<-*
                      ++dv+e   +++ +d i++N+
  gi|7108362  3869    WVDVTEN-QVITATD-IAANK    3887

Dockerin_1: domain 5 of 12, from 3871 to 3885: score 7.9, E = 0.27
                CS    -TT-SS--SHHHHHH
                   *->DvNgDGkVnalDlal<-*
                      Dv ++ +++a+D+a+
  gi|7108362  3871    DVTENQVITATDIAA    3885

Flagellin_IN: domain 5 of 7, from 3903 to 3931: score 5.1, E = 1.4
                   *->tltinggggkens.vadgvdislsagdsl<-*
                      ++++++++g+++s  a++++++++a+ ++
  gi|7108362  3903    SFDFTVNDGDADSaSANTITVNVTAVNDA    3931

Glyco_transf_36: domain 4 of 4, from 3911 to 3929: score 0.6, E = 13
                   *->gnadsdsahpifskldvet<-*
                      g+ads sa+ i  ++++ +
  gi|7108362  3911    GDADSASANTITVNVTAVN    3929

Haemagg_act: domain 5 of 5, from 3913 to 3931: score 0.3, E = 14
                CS    X---EE-TT-EEE-...-T
                   *->aqslpdgglvtngtvtiqa<-*
                      a+s+++++  +n+t+ ++a
  gi|7108362  3913    ADSASANTITVNVTAVNDA    3931

Fil_haemagg: domain 4 of 4, from 3916 to 3973: score 2.3, E = 6.4
                CS    EEESSEEEETT  TT--EE-SEEEEEE-STT-EEEE-S-EEESSE..
                   *->vaaGaltlnaa..alggldlnnggtlsagggltltaagllnnggtli
                      ++a++ t+n++  +++  +++ + +++ +++lt+t ++ +  +g+
  gi|7108362  3916    ASANTITVNVTavNDAPVADDETNSVNEDATLTVTDGSSDVLHGD-- 3960

                CS .................EEEEESS-EEEEE
                   aggdlllaagalrnggdltltaaGdLdnsg<-*
                                    + ++++++L+++
  gi|7108362  3961 -----------------TDVDSGDTLTVTT    3973

Gp5_C: domain 5 of 11, from 3935 to 3949: score 2.8, E = 9.4
                CS    S-EEEEESS-EEEEE
                   *->GnesltVkGnrtvtV<-*
                      ++e+ +V+ ++t+tV
  gi|7108362  3935    DDETNSVNEDATLTV    3949

He_PIG: domain 3 of 4, from 3944 to 3954: score 1.5, E = 12
                   *->tftvtatdgsg<-*
                      ++t+t+tdgs
  gi|7108362  3944    DATLTVTDGSS    3954

PKD: domain 13 of 23, from 4042 to 4058: score 3.7, E = 1.4
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      t s+g  +++at +t+tV
  gi|7108362  4042    TLSDGTATDTAT-ITITV    4058

Big_2: domain 4 of 4, from 4043 to 4069: score 0.9, E = 14
                CS    EEEE-SSS-EEEEEEETT.TEEEEEEE
                   *->lVtalakGtatItatsgdgnksasvtv<-*
                      l  + a+ tatIt t+  +n+  ++ +
  gi|7108362  4043    LSDGTATDTATITITVTGINDAPVAVN    4069

Big_1: domain 2 of 5, from 4045 to 4067: score 1.6, E = 4.3
                CS    SEEESSSS--EEEEEEEEETTTEE-T
                   *->ttavAngndaiTlTAtVkDanGnPVa<-*
                      +   ++++d++T+T+tV+  n+ PVa
  gi|7108362  4045    D---GTATDTATITITVTGINDAPVA    4067

Cadherin: domain 6 of 10, from 4049 to 4059: score 1.0, E = 15
                CS    -EEEE--EEE-
                   *->sstatvtitVl<-*
                      ++tat+titV+
  gi|7108362  4049    TDTATITITVT    4059

Big_3: domain 4 of 4, from 4051 to 4058: score 0.0, E = 41
                   *->tatftVtV<-*
                      tat+t+tV
  gi|7108362  4051    TATITITV    4058

HIM: domain 2 of 7, from 4221 to 4235: score 3.3, E = 7.1
                CS    --S...-EETT-TT--CC
                   *->asGeitvtktDAvnvsQL<-*
                      +s+   +++ DA++v+Q
  gi|7108362  4221    DSD---ADDDDAFTVTQI    4235

Flocculin: domain 2 of 5, from 4302 to 4322: score 0.1, E = 51
                   *->tgtFTsTYStemTTvtGTnGlp<-*
                      +gt T T  t++ TvtG+n +p
  gi|7108362  4302    DGTATDT-ATLIFTVTGVNDVP    4322

Mid2: domain 2 of 3, from 4340 to 4366: score 1.0, E = 8.2
                   *->nidDfeiidadDvlntseplsvgatnsdar<-*
                      +++Df+ +dadD   ++ + sv++t  ++
  gi|7108362  4340    SASDFGYTDADD---DDVLVSVKITTLESA    4366

P35: domain 1 of 1, from 4348 to 4359: score -1.2, E = 6.6
                   *->dlnknviLvdiK<-*
                      d ++ ++Lv +K
  gi|7108362  4348    DADDDDVLVSVK    4359

DUF167: domain 1 of 2, from 4350 to 4361: score 0.6, E = 14
                CS    ETTEEEEEEES-
                   *->kgegvllrVrVk<-*
                      ++++vl++V+++
  gi|7108362  4350    DDDDVLVSVKIT    4361

Whi5: domain 1 of 5, from 4377 to 4385: score 2.5, E = 15
                   *->wtdlsLdel<-*
                      w+d++L+++
  gi|7108362  4377    WVDVTLNQV    4385

Dockerin_1: domain 6 of 12, from 4379 to 4399: score 7.2, E = 0.46
                CS    -TT-SS--SHHHHHHHHHHH-
                   *->DvNgDGkVnalDlallkkyll<-*
                      Dv  + +++a+D+a+ k  l+
  gi|7108362  4379    DVTLNQVITATDIAANKLRLN    4399

DUF2377: domain 1 of 2, from 4408 to 4416: score 0.7, E = 12
                   *->PypaFrFlV<-*
                      Py +F+F V
  gi|7108362  4408    PYTTFNFTV    4416

Big_1: domain 3 of 5, from 4418 to 4445: score 0.0, E = 14
                CS    S-SEEESSSS--EEEEEEEEETTTEE-TT-E
                   *->dkttavAngndaiTlTAtVkDanGnPVagqe<-*
                      d++   A+ ++++T+T++V++ n+ PVa+ e
  gi|7108362  4418    DGD---ADSATPNTITVNVTNVNNAPVADNE    4445

Gp5_C: domain 6 of 11, from 4443 to 4461: score 3.0, E = 8.4
                CS    S-EEEEESS-EEEEES SE
                   *->GnesltVkGnrtvtVg.Gn<-*
                      +ne+ +V+ ++tvtV +G+
  gi|7108362  4443    DNETNSVNEDATVTVTdGT    4461

C2-set: domain 1 of 3, from 4455 to 4468: score 0.8, E = 16
                CS    EEEETTTCTEEEEE
                   *->vtvtcsvpnlLtce<-*
                      vtvt +++++L+++
  gi|7108362  4455    VTVTDGTSDVLHGD    4468

SRR: domain 3 of 5, from 4500 to 4513: score 1.7, E = 49
                   *->ekfekVknnYelLs<-*
                       +f+ V + Y+ L+
  gi|7108362  4500    SNFTSVTGTYGTLK    4513

PKD: domain 14 of 23, from 4545 to 4561: score 2.2, E = 3.9
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++at + +tV
  gi|7108362  4545    TVSDGTATDTAT-LIFTV    4561

CLAG: domain 1 of 1, from 4646 to 4671: score -2.9, E = 8.7
                   *->NknytYvDdedyFDDlddNEQFLNek<-*
                      N  ytYv d    DDld N Q   +
  gi|7108362  4646    NGTYTYVADQNAADDLDLNDQVTDSF    4671

Xol-1_GHMP-like: domain 2 of 2, from 4703 to 4727: score 7.4, E = 0.028
                CS    EEE-----------EE-HHHHHHEE
                   *->VgilAEDGsLEnsnGttEHFnKKyD<-*
                      Vg++ EDG L  snG        yD
  gi|7108362  4703    VGVIVEDGTLTVSNGANANLSGSYD    4727

I-set: domain 5 of 5, from 4842 to 4858: score 4.8, E = 1.2
                CS    EEEETTEEEEEEEEEEE
                   *->vAtNsaGeaeasaeLtV<-*
                      vA N  G++  +a+LtV
  gi|7108362  4842    VANNDTGSVNEDATLTV    4858

PKD: domain 15 of 23, from 4842 to 4858: score 2.7, E = 2.8
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      +++n+ gs++   +t+tV
  gi|7108362  4842    VANNDTGSVNED-ATLTV    4858

Gp5_C: domain 7 of 11, from 4844 to 4858: score 2.7, E = 10
                CS    S-EEEEESS-EEEEE
                   *->GnesltVkGnrtvtV<-*
                       n++ +V+ ++t+tV
  gi|7108362  4844    NNDTGSVNEDATLTV    4858

Attacin_N: domain 4 of 5, from 4848 to 4869: score 0.1, E = 34
                   *->GgVfaagntklgpaTaGlaldvN<-*
                      G+V+ ++ +++++a+ G++ d N
  gi|7108362  4848    GSVNEDATLTVSSASSGVTQD-N    4869

Dockerin_1: domain 7 of 12, from 4872 to 4882: score 4.0, E = 4.3
                CS    -TT-SS--SHH
                   *->DvNgDGkVnal<-*
                      Dv+gD +V++l
  gi|7108362  4872    DVDGDDTVSSL    4882

HIM: domain 3 of 7, from 5127 to 5141: score 3.3, E = 7.1
                CS    --S...-EETT-TT--CC
                   *->asGeitvtktDAvnvsQL<-*
                      +s+   +++ DA++v+Q
  gi|7108362  5127    DSD---ADDDDAFTVTQI    5141

SRR: domain 4 of 5, from 5159 to 5172: score 3.7, E = 15
                   *->ekfekVknnYelLs<-*
                      ++f+ V + Y+ L+
  gi|7108362  5159    NNFTSVTGTYGTLK    5172

PKD: domain 16 of 23, from 5204 to 5220: score 2.2, E = 3.9
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++at + +tV
  gi|7108362  5204    TVSDGTATDTAT-LIFTV    5220

Flocculin: domain 3 of 5, from 5207 to 5242: score 1.5, E = 22
                   *->tgtFTsTYStemTTvtGTnGlpT..tETiivvr.TPt<-*
                      +gt T T  t++ TvtG+n +pT +++Ti   ++TP+
  gi|7108362  5207    DGTATDT-ATLIFTVTGVNDVPTasDKTISTAEdTPY    5242

APC_crr: domain 2 of 4, from 5236 to 5245: score 3.8, E = 5.6
                CS    --SS------
                   *->avEdTPlnfS<-*
                      ++EdTP++fS
  gi|7108362  5236    TAEDTPYVFS    5245

Thy1: domain 2 of 3, from 5238 to 5262: score 2.1, E = 3.6
                CS    EEEEE---TTSS---S-..-HHHHHHH
                   *->advgfinltdaeivtdvkpdaadalie<-*
                       d++++ +t++ ++td+  d++dal++
  gi|7108362  5238    EDTPYVFSTSDFGYTDA--DDDDALVS    5262

Whi5: domain 2 of 5, from 5282 to 5290: score 2.5, E = 15
                   *->wtdlsLdel<-*
                      w+d++L+++
  gi|7108362  5282    WVDVTLNQV    5290

Dockerin_1: domain 8 of 12, from 5284 to 5304: score 7.2, E = 0.46
                CS    -TT-SS--SHHHHHHHHHHH-
                   *->DvNgDGkVnalDlallkkyll<-*
                      Dv  + +++a+D+a+ k  l+
  gi|7108362  5284    DVTLNQVITATDIAANKLRLN    5304

Gp5_C: domain 8 of 11, from 5348 to 5366: score 3.0, E = 8.4
                CS    S-EEEEESS-EEEEES SE
                   *->GnesltVkGnrtvtVg.Gn<-*
                      +ne+ +V+ ++tvtV +G+
  gi|7108362  5348    DNETNSVNEDATVTVTdGT    5366

C2-set: domain 2 of 3, from 5360 to 5373: score 0.8, E = 16
                CS    EEEETTTCTEEEEE
                   *->vtvtcsvpnlLtce<-*
                      vtvt +++++L+++
  gi|7108362  5360    VTVTDGTSDVLHGD    5373

PKD: domain 17 of 23, from 5450 to 5466: score 2.2, E = 3.9
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++at + +tV
  gi|7108362  5450    TVSDGTATDTAT-LIFTV    5466

Stig1: domain 1 of 1, from 5460 to 5497: score -0.3, E = 7.4
                   *->ltaisivvlilileltitlneptnssanvassarkglv<-*
                       t+i++v  i + +++ +++  +n +a v+ + ++ l+
  gi|7108362  5460    ATLIFTVTGINDAPVAVNDSDVVNEDATVTQTSGSSLL    5497

PKD: domain 18 of 23, from 5578 to 5594: score 2.2, E = 3.9
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++at + +tV
  gi|7108362  5578    TVSDGTATDTAT-LIFTV    5594

HIM: domain 4 of 7, from 5629 to 5643: score 3.3, E = 7.1
                CS    --S...-EETT-TT--CC
                   *->asGeitvtktDAvnvsQL<-*
                      +s+   +++ DA++v+Q
  gi|7108362  5629    DSD---ADDDDAFTVTQI    5643

Gp5_C: domain 9 of 11, from 5694 to 5717: score 1.4, E = 27
                CS    -EEEEESS-EEEEES SEEEEEES
                   *->nesltVkGnrtvtVg.GnqTtsVg<-*
                      ++s++V +++t t+ +G+ T +
  gi|7108362  5694    DASDSVTDSFTYTISdGDTTDTAT    5717

APC_crr: domain 3 of 4, from 5740 to 5750: score 2.4, E = 14
                CS    SS---------
                   *->EdTPlnfSrrS<-*
                      EdTP++fS ++
  gi|7108362  5740    EDTPYVFSASD    5750

Whi5: domain 3 of 5, from 5784 to 5792: score 2.5, E = 15
                   *->wtdlsLdel<-*
                      w+d++L+++
  gi|7108362  5784    WVDVTLNQV    5792

Dockerin_1: domain 9 of 12, from 5786 to 5806: score 7.2, E = 0.46
                CS    -TT-SS--SHHHHHHHHHHH-
                   *->DvNgDGkVnalDlallkkyll<-*
                      Dv  + +++a+D+a+ k  l+
  gi|7108362  5786    DVTLNQVITATDIAANKLRLN    5806

DUF2377: domain 2 of 2, from 5815 to 5823: score 0.7, E = 12
                   *->PypaFrFlV<-*
                      Py +F+F V
  gi|7108362  5815    PYTTFNFTV    5823

Flagellin_IN: domain 6 of 7, from 5818 to 5846: score 2.0, E = 10
                   *->tltinggggkens.vadgvdislsagdsl<-*
                      t+++++++g+++s++ ++++++++a+ ++
  gi|7108362  5818    TFNFTVNDGDASSsTPNTITVNVTAVNDT    5846

Flagellin_IN: domain 7 of 7, from 5853 to 5868: score 0.1, E = 36
                   *->sAsvdadtnggrLvltstt<-*
                      +Asv++d   + ++++s+
  gi|7108362  5853    TASVNED---ATTTISSAS    5868

PKD: domain 19 of 23, from 5952 to 5968: score 2.0, E = 4.5
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      t s+g  +++at +t+t+
  gi|7108362  5952    TLSDGTATDTAT-ITITI    5968

Cadherin: domain 7 of 10, from 5959 to 5969: score 0.2, E = 24
                CS    -EEEE--EEE-
                   *->sstatvtitVl<-*
                      ++tat+tit++
  gi|7108362  5959    TDTATITITIT    5969

HIM: domain 5 of 7, from 5968 to 5985: score 2.8, E = 10
                CS    EEEE--S...-EETT-TT
                   *->ItNVasGeitvtktDAvn<-*
                      It+V ++ + v++tDAvn
  gi|7108362  5968    ITGVNDAPVAVNDTDAVN    5985

PKD: domain 20 of 23, from 6080 to 6096: score 2.2, E = 3.9
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++at + +tV
  gi|7108362  6080    TVSDGTATDTAT-LIFTV    6096

Gp5_C: domain 10 of 11, from 6106 to 6124: score 2.7, E = 10
                CS    S-EEEEESS-EEEEES SE
                   *->GnesltVkGnrtvtVg.Gn<-*
                      +ne+ +V+ ++t+tV +G+
  gi|7108362  6106    DNETNSVNEDATLTVTdGT    6124

GSPII_G: domain 1 of 1, from 6148 to 6162: score 1.2, E = 8.3
                CS    S--...EEE--.TT-E
                   *->GqpGGeGtdaDpIgnW<-*
                      G++GG+Gt++  Ig++
  gi|7108362  6148    GAEGGSGTAGS-IGSG    6162

PKD: domain 21 of 23, from 6203 to 6219: score 4.6, E = 0.7
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++at +t+t+
  gi|7108362  6203    TVSDGTATDTAT-ITITI    6219

Cadherin: domain 8 of 10, from 6204 to 6220: score 0.1, E = 26
                CS    ----.........S---EEEE--EEE-
                   *->AtDadpllasgggpplsstatvtitVl<-*
                      ++D+            ++tat+tit++
  gi|7108362  6204    VSDG----------TATDTATITITIT    6220

EspB: domain 1 of 1, from 6213 to 6252: score -1.9, E = 8.8
                   *->mntiDynnqviavnsvsesttgsasataalalsidssLLtd<-*
                        ti  +   +   +v+ + t++    a+++ s+ ssLL d
  gi|7108362  6213    -ATITITITGVNDAPVAVNDTDAVNEDATVTRSSGSSLLMD    6252

HIM: domain 6 of 7, from 6219 to 6236: score 2.8, E = 10
                CS    EEEE--S...-EETT-TT
                   *->ItNVasGeitvtktDAvn<-*
                      It+V ++ + v++tDAvn
  gi|7108362  6219    ITGVNDAPVAVNDTDAVN    6236

HIM: domain 7 of 7, from 6254 to 6268: score 3.3, E = 7.1
                CS    --S...-EETT-TT--CC
                   *->asGeitvtktDAvnvsQL<-*
                      +s+   +++ DA++v+Q
  gi|7108362  6254    DSD---ADDDDAFTVTQI    6268

Flocculin: domain 4 of 5, from 6335 to 6355: score 0.1, E = 51
                   *->tgtFTsTYStemTTvtGTnGlp<-*
                      +gt T T  t++ TvtG+n +p
  gi|7108362  6335    DGTATDT-ATLIFTVTGVNDVP    6355

Mid2: domain 3 of 3, from 6373 to 6399: score 1.0, E = 8.2
                   *->nidDfeiidadDvlntseplsvgatnsdar<-*
                      +++Df+ +dadD   ++ + sv++t  ++
  gi|7108362  6373    SASDFGYTDADD---DDVLVSVKITTLESA    6399

DUF167: domain 2 of 2, from 6383 to 6394: score 0.6, E = 14
                CS    ETTEEEEEEES-
                   *->kgegvllrVrVk<-*
                      ++++vl++V+++
  gi|7108362  6383    DDDDVLVSVKIT    6394

Whi5: domain 4 of 5, from 6410 to 6418: score 2.5, E = 15
                   *->wtdlsLdel<-*
                      w+d++L+++
  gi|7108362  6410    WVDVTLNQV    6418

Dockerin_1: domain 10 of 12, from 6412 to 6425: score 4.1, E = 3.9
                CS    -TT-SS--SHHHHH
                   *->DvNgDGkVnalDla<-*
                      Dv  + +++a+D++
  gi|7108362  6412    DVTLNQVITATDIS    6425

LRR_adjacent: domain 2 of 3, from 6416 to 6427: score 4.8, E = 1.9
                CS    S-B--ECEECCC
                   *->GalitPktISdN<-*
                       ++it ++IS+N
  gi|7108362  6416    NQVITATDISNN    6427

Big_1: domain 4 of 5, from 6451 to 6480: score 5.3, E = 0.29
                CS    S-SEEESSSS--EEEEEEEEETTTEE-TT-EEE
                   *->dkttavAngndaiTlTAtVkDanGnPVagqeVt<-*
                      d++   A+ + + T+T++V ++n+ PVa+ e++
  gi|7108362  6451    DGD---ADSSSSYTMTVNVINTNDAPVADNEIN    6480

FB_lectin: domain 1 of 1, from 6459 to 6470: score 2.8, E = 3
                CS    -EEEEEEEEEE-S
                   *->MSYTIkvrvyqtt<-*
                       SYT +v v++t+
  gi|7108362  6459    -SYTMTVNVINTN    6470

Gp5_C: domain 11 of 11, from 6476 to 6494: score 1.8, E = 20
                CS    S-EEEEESS-EEEEES SE
                   *->GnesltVkGnrtvtVg.Gn<-*
                      +ne  +V+ ++tvtV +G+
  gi|7108362  6476    DNEINSVNEDATVTVTdGT    6494

C2-set: domain 3 of 3, from 6488 to 6501: score 0.8, E = 16
                CS    EEEETTTCTEEEEE
                   *->vtvtcsvpnlLtce<-*
                      vtvt +++++L+++
  gi|7108362  6488    VTVTDGTSDVLHGD    6501

SRR: domain 5 of 5, from 6532 to 6545: score 1.7, E = 49
                   *->ekfekVknnYelLs<-*
                       +f+ V + Y+ L+
  gi|7108362  6532    SNFTSVTGTYGTLK    6545

PKD: domain 22 of 23, from 6577 to 6593: score 3.0, E = 2.2
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+++ +++at + +tV
  gi|7108362  6577    TVSDSNATDTAT-LIFTV    6593

Cadherin: domain 9 of 10, from 6578 to 6594: score 1.1, E = 14
                CS    ----.........S---EEEE--EEE-
                   *->AtDadpllasgggpplsstatvtitVl<-*
                      ++D+          + ++tat++ tV+
  gi|7108362  6578    VSDS----------NATDTATLIFTVT    6594

Flocculin: domain 5 of 5, from 6584 to 6601: score 0.8, E = 33
                   *->TsTYStemTTvtGTnGlpT<-*
                      T T  t++ TvtG+n +pT
  gi|7108362  6584    TDT-ATLIFTVTGVNDVPT    6601

APC_crr: domain 4 of 4, from 6609 to 6618: score 1.7, E = 22
                CS    --SS------
                   *->avEdTPlnfS<-*
                      + EdTP++fS
  gi|7108362  6609    TEEDTPYVFS    6618

Thy1: domain 3 of 3, from 6611 to 6635: score 2.1, E = 3.6
                CS    EEEEE---TTSS---S-..-HHHHHHH
                   *->advgfinltdaeivtdvkpdaadalie<-*
                       d++++ +t++ ++td+  d++dal++
  gi|7108362  6611    EDTPYVFSTSDFGYTDA--DDDDALVS    6635

Whi5: domain 5 of 5, from 6654 to 6663: score 3.1, E = 11
                   *->GwtdlsLdel<-*
                      +w+d++L+++
  gi|7108362  6654    NWVDVTLNQV    6663

Dockerin_1: domain 11 of 12, from 6657 to 6670: score 4.1, E = 3.9
                CS    -TT-SS--SHHHHH
                   *->DvNgDGkVnalDla<-*
                      Dv  + +++a+D++
  gi|7108362  6657    DVTLNQVITATDIS    6670

LRR_adjacent: domain 3 of 3, from 6661 to 6672: score 1.5, E = 15
                CS    S-B--ECEECCC
                   *->GalitPktISdN<-*
                       ++it ++IS++
  gi|7108362  6661    NQVITATDISNS    6672

Big_1: domain 5 of 5, from 6696 to 6723: score 5.3, E = 0.29
                CS    S-SEEESSSS--EEEEEEEEETTTEE-TT-E
                   *->dkttavAngndaiTlTAtVkDanGnPVagqe<-*
                      d++   A+ + + T+T++V+  n+nPVa+ e
  gi|7108362  6696    DGD---ADSASSYTMTINVTAINDNPVADNE    6723

Attacin_N: domain 5 of 5, from 6780 to 6791: score 6.3, E = 0.64
                   *->qhGsvtvNsdGg<-*
                      + Gs+t+NsdG+
  gi|7108362  6780    TYGSLTINSDGT    6791

HYR: domain 5 of 5, from 6811 to 6830: score 10.9, E = 0.013
                   *->tYtatDnaGNeAdsCtFtVtV<-*
                      tYt++D +G ++ ++++t+tV
  gi|7108362  6811    TYTVSDGNGGTD-TGQLTITV    6830

PKD: domain 23 of 23, from 6813 to 6830: score 6.4, E = 0.2
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g+g +++ ++t+tV
  gi|7108362  6813    TVSDGNGGTDTGQLTITV    6830

Cadherin: domain 10 of 10, from 6821 to 6831: score 1.3, E = 11
                CS    -EEEE--EEE-
                   *->sstatvtitVl<-*
                      ++t+++titV+
  gi|7108362  6821    TDTGQLTITVT    6831

Peptidase_C25_C: domain 1 of 1, from 6821 to 6838: score 3.1, E = 2.2
                CS    TT-SEEEEEEE-TTB--E
                   *->teegnltltvvgyNkltV<-*
                      t+ g lt+tv+g N  +V
  gi|7108362  6821    TDTGQLTITVTGANDAPV    6838

3Beta_HSD: domain 1 of 1, from 6934 to 6957: score 1.1, E = 2.7
                   *->YddFnrtllkelGlrlpsviivklPl<-*
                      Y+ Fn+t+  + G+ + s+i  +l+l
  gi|7108362  6934    YEYFNYTVRDGSGVTDTSSI--VLKL    6957

PolyG_pol: domain 1 of 1, from 6942 to 6960: score 0.4, E = 3.4
                   *->RlGSdsvdtiSlsRiklrnG<-*
                      R GS+ +dt+S + +kl nG
  gi|7108362  6942    RDGSGVTDTSSIV-LKLQNG    6960

L1R_F9L: domain 1 of 1, from 6982 to 7005: score 0.2, E = 8.5
                   *->MGaaasksingViivtlvnlfverylnkLaq<-*
                      M+a +  ++      +++++++++   +L++
  gi|7108362  6982    MEARV--QVE-----NTFTELNQSTEFDLNN    7005

PCNA_N: domain 1 of 1, from 7006 to 7030: score 1.8, E = 4.6
                CS    EE-TTSSEEEEEEEEEEEB-EEEEE
                   *->FenekqdkvseydlkLmliDlDsEh<-*
                      Fe+e   + ++y+  L+l+Dl  E
  gi|7108362  7006    FEFEQTARKTDYSQGLKLVDLVAET    7030

GLE1: domain 1 of 1, from 7018 to 7030: score 0.1, E = 7.5
                   *->kQflKLLrvilee<-*
                      +Q+lKL+++++e
  gi|7108362  7018    SQGLKLVDLVAET    7030

YukD: domain 1 of 1, from 7022 to 7048: score 2.1, E = 5.4
                CS    HHHHHHHHHS---S---TT-EEEEGGG
                   *->kLidnvwetlkievprregsqIrVvNK<-*
                      kL+d+v+et ++ + ++e s ++V+ K
  gi|7108362  7022    KLVDLVAETDSLQISEGELSNLKVKDK    7048

He_PIG: domain 4 of 4, from 7073 to 7090: score 3.6, E = 3.2
                   *->tpggggLPsGLtLdsstG<-*
                      +++g++LP+++ +++ tG
  gi|7108362  7073    MSDGSALPEWIKINPKTG    7090

DUF2140: domain 1 of 1, from 7079 to 7088: score 1.2, E = 7.2
                   *->LPkwVtIdPk<-*
                      LP+w++I+Pk
  gi|7108362  7079    LPEWIKINPK    7088

RE_BstXI: domain 1 of 1, from 7084 to 7105: score -1.3, E = 8.4
                   *->rKiy.KtGqtT...PRGAdkdaI<-*
                       Ki++KtGqtT++ P G dk +I
  gi|7108362  7084    -KINpKTGQTTtniPEGVDKVEI    7105

Corona_nucleoca: domain 1 of 1, from 7087 to 7124: score 0.2, E = 6.4
                   *->sktssataepkqdevkkvskvkeetdEvDkalveddtqvEiidEvd<
                      +kt  +t + +++ v+kv+   ++td       + ++ +Ei  E+d
  gi|7108362  7087    PKT-GQTTTNIPEGVDKVEIMIIATD-------KNNETREIAVEID  7124

                   -*

  gi|7108362     -    -

Mis14: domain 1 of 1, from 7111 to 7145: score 1.2, E = 8.9
                   *->daDeetsadqvtkeaweevksdkslqryresLssvkrlqpsi<-*
                      d + et+ + ++ ++ e +k+d      r ++++ kr+++si
  gi|7108362  7111    DKNNETR-EIAVEIDPEKIKQD------RKIIKQAKRTNSSI    7145

Syntaxin-18_N: domain 1 of 1, from 7126 to 7146: score 2.6, E = 3.1
                   *->nktkpkDeFlKeAyrinkhIt<-*
                      +k+k+    +K+A+r+n++It
  gi|7108362  7126    EKIKQDRKIIKQAKRTNSSIT    7146

Dockerin_1: domain 12 of 12, from 7147 to 7154: score 0.2, E = 66
                CS    TT-SS--S
                   *->vNgDGkVn<-*
                      vN+DG+Vn
  gi|7108362  7147    VNEDGTVN    7154

GbpC: domain 1 of 1, from 7154 to 7176: score -0.7, E = 9.8
                   *->EkhK.nevadGYlsePsekaQsLvFdn<-*
                      ++ K+ne  dG++      +++L+F+n
  gi|7108362  7154    NIVKqNE--DGLVERSF--NKTLNFNN    7176

NOPS: domain 1 of 1, from 7160 to 7175: score 2.2, E = 2.2
                   *->eDGLPEKllnKkspdyq<-*
                      eDGL E+++nK+   ++
  gi|7108362  7160    EDGLVERSFNKT-LNFN    7175

SWIRM: domain 1 of 1, from 7163 to 7185: score 1.9, E = 7.6
                   *->lkeaaraswldlsalppiEllse<-*
                      l+e+++ ++l+++++ +i + +e
  gi|7108362  7163    LVERSFNKTLNFNNPADINEIIE    7185

Complex1_24kDa: domain 1 of 1, from 7177 to 7188: score 1.4, E = 6.1
                   *->pekieeLLdrlk<-*
                      p++i e+++ +k
  gi|7108362  7177    PADINEIIETFK    7188

S-methyl_trans: domain 1 of 1, from 7177 to 7189: score 0.7, E = 4
                CS    HHHHHHHHHHTHH
                   *->PdHIreIaeavdk<-*
                      P +I+eI e++++
  gi|7108362  7177    PADINEIIETFKP    7189

DUF257: domain 1 of 1, from 7180 to 7192: score 0.4, E = 8.3
                   *->ieefidkiKfGEtV<-*
                      i+e+i+++K+ Et+
  gi|7108362  7180    INEIIETFKP-ETI    7192

Orthopox_F6: domain 1 of 1, from 7180 to 7194: score 1.4, E = 8.2
                   *->inEnlEqYKtesFlt<-*
                      inE +E +K e  ++
  gi|7108362  7180    INEIIETFKPETIFQ    7194

XFP_N: domain 1 of 1, from 7305 to 7312: score -0.5, E = 9.4
                   *->DwrdYavd<-*
                      Dw dY++d
  gi|7108362  7305    DWEDYGND    7312

//