hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 74182639.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|74182639|dbj|BAE34673.1|
Accession: [none]
Description: unnamed protein product [Mus musculus]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
UPF0547 Uncharacterised protein family UPF054 11.1 0.052 1
PRD PRD domain 3.7 2.6 1
DUF551 Protein of unknown function (DUF551) 1.9 3.2 1
Agro_virD5 Agrobacterium VirD5 protein -0.8 3.6 1
AMP_N Aminopeptidase P, N-terminal domain 1.9 4.4 1
TIR TIR domain 0.9 5.4 1
IMPDH IMP dehydrogenase / GMP reductase dom 0.6 6 1
c-SKI_SMAD_bind c-SKI Smad4 binding domain 1.6 6.1 1
NUP Purine nucleoside permease (NUP) -0.2 6.3 1
Orthopox_N1 Orthopoxvirus N1 protein 0.7 6.4 1
IFRD Interferon-related developmental regu -0.2 6.5 1
PSI Plexin repeat 1.7 7.6 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
Agro_virD5 1/1 87 116 .. 740 769 .. -0.8 3.6
PSI 1/1 142 155 .. 50 63 .] 1.7 7.6
UPF0547 1/1 152 162 .. 1 11 [. 11.1 0.052
DUF551 1/1 175 181 .. 74 80 .] 1.9 3.2
AMP_N 1/1 238 249 .. 1 12 [. 1.9 4.4
NUP 1/1 308 316 .. 1 9 [. -0.2 6.3
c-SKI_SMAD_bind 1/1 344 360 .. 82 98 .] 1.6 6.1
IFRD 1/1 345 356 .. 354 365 .] -0.2 6.5
PRD 1/1 349 361 .. 1 13 [. 3.7 2.6
TIR 1/1 396 411 .. 131 150 .] 0.9 5.4
Orthopox_N1 1/1 465 478 .. 100 113 .] 0.7 6.4
IMPDH 1/1 486 494 .] 1 9 [. 0.6 6
Alignments of top-scoring domains:
Agro_virD5: domain 1 of 1, from 87 to 116: score -0.8, E = 3.6
*->YtvsRDPvLsPPsKeqapqLLHLGpRGqtE<-*
Yt+sR+P L+P s +a +L + R q E
gi|7418263 87 YTISREPALLPGSEAEAIELAVVKGRRQRE 116
PSI: domain 1 of 1, from 142 to 155: score 1.7, E = 7.6
CS ..B..TT-BCCCSS
*->dqwldwswsssqCp<-*
++w ++ + s+ Cp
gi|7418263 142 QSWAGSRQGSKECP 155
UPF0547: domain 1 of 1, from 152 to 162: score 11.1, E = 0.052
*->KtCPeCdaivp<-*
K+CP+C ++vp
gi|7418263 152 KECPGCAQLVP 162
DUF551: domain 1 of 1, from 175 to 181: score 1.9, E = 3.2
*->PLPEPPq<-*
PLPE+P
gi|7418263 175 PLPEAPG 181
AMP_N: domain 1 of 1, from 238 to 249: score 1.9, E = 4.4
*->ipadefaaRRkr<-*
++a+ fa+RR+r
gi|7418263 238 VKAQTFAERRER 249
NUP: domain 1 of 1, from 308 to 316: score -0.2, E = 6.3
*->iqpKVmvIt<-*
+pKVm+I+
gi|7418263 308 LPPKVMLIS 316
c-SKI_SMAD_bind: domain 1 of 1, from 344 to 360: score 1.6, E = 6.1
CS CHHHHHHHHHHHHCC--
*->eeakLeqvLeevkekFd<-*
e+a+ e +Lee++ k +
gi|7418263 344 EHATFEDILEEIEKKLN 360
IFRD: domain 1 of 1, from 345 to 356: score -0.2, E = 6.5
*->RstFRDVlrfvE<-*
++tF D+l+ +E
gi|7418263 345 HATFEDILEEIE 356
PRD: domain 1 of 1, from 349 to 361: score 3.7, E = 2.6
CS HHHHHHHHHHHTS
*->eelleeiekklqi<-*
e++leeiekkl+i
gi|7418263 349 EDILEEIEKKLNI 361
TIR: domain 1 of 1, from 396 to 411: score 0.9, E = 5.4
CS SG.....GGCCHHHHHHHHH
*->dktersqsdrikfWkkalya<-*
+k+e d+i+fWk++
gi|7418263 396 EKEE----DMIHFWKRLSRL 411
Orthopox_N1: domain 1 of 1, from 465 to 478: score 0.7, E = 6.4
*->rmiekyfddlmidl<-*
+mie+yfd + l
gi|7418263 465 QMIETYFDFRLYRL 478
IMPDH: domain 1 of 1, from 486 to 494: score 0.6, E = 6
CS EB-GGGGEE
RF xxxxxxxxx
*->egLTFDDVL<-*
+ L+FDDVL
gi|7418263 486 KLLDFDDVL 494
//