hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            78186267.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|78186267|ref|YP_374310.1|
Accession:      [none]
Description:    VCBS [Pelodictyon luteolum DSM 273]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
HemolysinCabind Hemolysin-type calcium-binding repeat   411.5   1.4e-123  31
PKD             PKD domain                               28.9    2.5e-08  10
Flagellin_IN    Flagellin hook IN motif                  29.5    1.8e-07   9
SoxZ            Sulphur oxidation protein SoxZ           18.3      5e-05   4
BiPBP_C         Penicillin-Binding Protein C-terminus    18.1    0.00012   4
Fil_haemagg     Haemagluttinin repeat                    18.5    0.00014   5
SLT_beta        Shiga-like toxin beta subunit            17.8    0.00014   5
Gp5_C           Gp5 C-terminal repeat (3 copies)         15.8    0.00093   7
YaeQ            YaeQ protein                             11.7     0.0025   2
He_PIG          Putative Ig domain                       13.3     0.0054   4
PhageMaj_Tail   Phage major tail protein, TP901-1        13.2     0.0066   3
FG-GAP          FG-GAP repeat                             9.7      0.076   3
PAAR_motif      PAAR motif                               10.0      0.089   5
Big_2           Bacterial Ig-like domain (group 2)        7.9       0.13   3
PEP-utilizers   PEP-utilising enzyme, mobile domain       7.5       0.21   5
Cadherin        Cadherin domain                           7.0       0.27   5
Flagellin_D3    Flagellin D3 domain                       7.8       0.28   3
Gmad2           Immunoglobulin-like domain of bacteri     5.8       0.31   1
DUF1522         Domain of Unknown Function (DUF1522)      5.7       0.41   3
DUF1034         Domain of Unknown Function (DUF1034)      6.1       0.43   1
CGGC            CGGC domain                               4.0       0.44   2
Gly_reductase   Glycine/sarcosine/betaine reductase c     2.8       0.45   1
DUF814          Domain of unknown function (DUF814)       5.7       0.46   1
Flagellin_N     Bacterial flagellin N-terminus            6.0       0.47   1
DUF490          Family of unknown function (DUF490)       4.4       0.51   1
Phage_tail_3    Phage tail protein                        5.5       0.52   1
DUF422          Protein of unknown function (DUF422)      4.5        0.6   1
Phage_attach    Phage Head-Tail Attachment                2.3       0.61   1
CBM_15          Carbohydrate binding domain (family 1     3.3       0.64   1
SipA            Salmonella invasion protein A             2.9       0.77   1
I-set           Immunoglobulin I-set domain               5.2       0.88   1
SBP_bac_5       Bacterial extracellular solute-bindin     3.1          1   1
Redoxin         Redoxin                                   4.3        1.2   1
MucBP           MucBP domain                              5.2        1.2   2
DUF2134         Predicted membrane protein (DUF2134)      3.9        1.3   1
DUF357          Protein of unknown function (DUF357)      5.0        1.3   3
DUF74           Domain of unknown function DUF74          3.7        1.4   1
CBM_6           Carbohydrate binding module (family 6     3.1        1.4   1
DUF2125         Uncharacterized protein conserved in      0.9        1.5   1
SecA_DEAD       SecA DEAD-like domain                     2.7        1.6   1
Bul1_N          Bul1 N terminus                           1.6        1.6   1
Glutaredoxin    Glutaredoxin                              4.1        1.8   1
PilM            PilM                                      4.1        1.9   1
Rep_trans       Replication initiation factor             3.1        1.9   1
SLH             S-layer homology domain                   4.6          2   1
CRAM_rpt        Cysteine-rich, acidic integral membra     2.4        2.2   1
G-gamma         GGL domain                                4.0        2.2   1
Big_1           Bacterial Ig-like domain (group 1)        2.5        2.3   1
NIF3            NIF3 (NGG1p interacting factor 3)         2.6        2.3   1
Reovirus_M2     Reovirus major virion structural prot    -0.5        2.5   1
Lipoprotein_2   Borrelia lipoprotein                      2.7        2.6   1
Big_4           Bacterial Ig-like domain (group 4)        4.4        2.6   2
Ribosomal_S7e   Ribosomal protein S7e                     2.1        2.7   1
Flavodoxin_NdrI NrdI Flavodoxin like                      2.9        2.7   1
SH3_5           Bacterial SH3 domain                      4.6        2.8   1
SURF2           Surfeit locus protein 2 (SURF2)           2.0        2.8   1
DNA_gyraseA_C   DNA gyrase C-terminal domain, beta-pr     4.6          3   1
Secretin        Bacterial type II and III secretion s     2.1        3.2   1
CW_binding_1    Putative cell wall binding repeat         4.2        3.2   1
EF_assoc_2      EF hand associated                        3.2        3.3   1
Phage_fiber_2   Phage tail fibre repeat                   2.7        3.3   1
Apo-CIII        Apolipoprotein CIII (Apo-CIII)            2.5        3.3   1
DUF820          Protein of unknown function (DUF820)      2.4        3.5   1
HpaB            4-hydroxyphenylacetate 3-hydroxylase      1.2        3.6   1
DUF1772         Domain of unknown function (DUF1772)      2.7        3.6   1
PDE8            PDE8 phosphodiesterase                    2.7        3.6   1
ADH_zinc_N      Zinc-binding dehydrogenase                2.2        3.7   1
Ribosomal_L44   Ribosomal protein L44                     2.8        3.9   1
Drmip_Hesp      Developmentally Regulated MAPK Intera     2.3          4   1
HIM             Haemagglutinin                            4.1        4.1   2
Peptidase_C47   Staphopain peptidase C47                  1.2        4.1   1
DUF427          Domain of unknown function (DUF427)       2.4        4.1   1
Viral_Rep_C     Viral replication domain C-terminal       2.1        4.2   1
GumN            GumN protein                              1.6        4.3   1
DUF2523         Protein of unknown function (DUF2523)     3.3        4.4   1
QLQ             QLQ                                       3.6        4.4   1
Peptidase_S6    Immunoglobulin A1 protease               -0.1        4.5   1
DUF607          Protein of unknown function, DUF607       1.6        4.5   1
DUF2407         Putative membrane protein (DUF2407)       0.4        4.5   2
DUF592          Protein of unknown function (DUF592)      0.0        4.7   1
Pox_G7          Poxvirus G7-like                         -0.1        4.8   1
Mito_carr       Mitochondrial carrier protein             2.3        4.9   1
CAP160          CAP160 repeat                             3.8        4.9   2
GHMP_kinases_C  GHMP kinases C terminal                   2.1        4.9   1
Fibritin_C      Fibritin C-terminal region                1.4        5.1   1
DUF1112         Protein of unknown function (DUF1112)     1.0        5.1   1
Tenui_NS3       Tenuivirus NS-3 Protein                   0.3        5.2   1
G6PD_N          Glucose-6-phosphate dehydrogenase, NA     0.2        5.3   1
Halo_GVPC       Halobacterial gas vesicle protein C (     4.2        5.3   2
PvlArgDC        Pyruvoyl-dependent arginine decarboxy     1.2        5.4   1
DUF336          Domain of unknown function (DUF336)       2.2        5.4   1
DUF769          Xylella fastidiosa protein of unknown     0.1        5.4   1
DUF811          Domain of unknown function (DUF811)       0.9        5.4   1
Haemagg_act     haemagglutination activity domain         1.7        5.5   2
Reg_prop        Two component regulator propeller         5.3        5.6   1
DUF2207         Predicted membrane protein (DUF2207)      0.0        5.6   1
RA              Ras association (RalGDS/AF-6) domain      3.0        5.6   4
YopE            Yersinia virulence determinant (YopE)     2.7        5.6   1
DUF1980         Domain of unknown function (DUF1980)      1.2        5.7   1
FmdA_AmdA       Acetamidase/Formamidase family            0.1        5.7   1
DUF2328         Uncharacterized protein conserved in      0.3        5.7   1
FAD_binding_1   FAD binding domain                        0.8        5.8   1
PepSY           Peptidase propeptide and YPEB domain      3.1        5.9   1
Myosin_N        Myosin N-terminal SH3-like domain         3.2        5.9   2
PPC             Bacterial pre-peptidase C-terminal do     2.3        6.1   2
Phage_Capsid_P3 P3 major capsid protein                  -0.8        6.2   1
DUF920          Bacterial protein of unknown function     1.3        6.2   1
Hexapep         Bacterial transferase hexapeptide (th     3.9        6.5   1
DUF2345         Uncharacterized protein conserved in      1.7        6.5   1
Tautomerase     Tautomerase enzyme                        2.9        6.6   1
DFF-C           DNA Fragmentation factor 45kDa, C ter     1.2        6.7   1
PUA             PUA domain                                2.8        6.8   1
DUF847          Predicted lysozyme (DUF847)               2.4        6.9   1
FTP             Fungalysin/Thermolysin Propeptide Mot     2.7        6.9   1
Parvo_NS1       Parvovirus non-structural protein NS1    -0.2          7   1
Fimbrial        Fimbrial protein                          0.9        7.1   1
CsgG            Curli production assembly/transport c     0.8        7.4   1
gp12-short_mid  Phage short tail fibre protein gp12,      1.3        7.5   1
DUF1900         Domain of unknown function (DUF1900)      1.7        7.5   1
RhgB_N          Rhamnogalacturonase B, N-terminal         0.4        7.5   1
Avidin          Avidin family                             1.3        7.5   2
RCC1            Regulator of chromosome condensation      2.0        7.5   1
DUF59           Domain of unknown function DUF59          2.3        7.8   1
Eeig1           Oestrogen-responsive protein Fam102A-     0.7        7.8   1
Transposase_34  IS66 Orf2 like protein                    1.6          8   1
DUF1759         Protein of unknown function (DUF1759)     0.1          8   1
Chlam_PMP       Chlamydia polymorphic membrane protei     4.1        8.2   1
Complex1_24kDa  Respiratory-chain NADH dehydrogenase      1.0        8.2   1
CinA            Competence-damaged protein                1.1        8.2   1
SBP56           56kDa selenium binding protein (SBP56    -1.1        8.3   1
DUF1750         Fungal domain of unknown function (DU    -2.2        8.3   1
CTP-dep_RFKase  Domain of unknown function DUF120         1.1        8.3   1
DUF801          C. elegans protein of unknown functio     2.4        8.3   2
XylR_N          Activator of aromatic catabolism          1.5        8.3   1
DUF2514         Protein of unknown function (DUF2514)     0.6        8.3   1
DnaD            DnaD-like domain                          2.3        8.4   1
CbbQ_C          CbbQ/NirQ/NorQ C-terminal                 1.7        8.4   1
Fe_hyd_lg_C     Iron only hydrogenase large subunit,     -1.8        8.6   1
TatD_DNase      TatD related DNase                       -0.4        8.7   1
Ribosomal_S11   Ribosomal protein S11                     0.3        8.7   1
SEA             SEA domain                                1.5        8.8   1
ChiC            Chitinase C                               0.3        8.8   1
ISN1            IMP-specific 5'-nucleotidase             -1.7        8.8   1
Vps26           Vacuolar protein sorting-associated p    -1.1          9   1
DUF2510         Protein of unknown function (DUF2510)     1.8          9   1
Colipase_C      Colipase, C-terminal domain               1.8        9.1   1
ThiS            ThiS family                               0.0        9.2   1
RtxA            RtxA repeat                               3.2        9.2   4
FabA            FabA-like domain                          1.3        9.3   1
UPF0565         Uncharacterised protein family UPF056    -0.8        9.3   1
7tm_2           7 transmembrane receptor (Secretin fa    -0.3        9.4   1
PRK             Phosphoribulokinase / Uridine kinase     -0.1        9.4   1
YbbR            YbbR-like protein                         1.4        9.4   1
ImpE            ImpE protein                              0.5        9.5   1
DUF1565         Protein of unknown function (DUF1565)    -1.0        9.5   1
DUF853          Bacterial protein of unknown function    -1.6        9.6   1
BHD_3           Rad4 beta-hairpin domain 3                1.4        9.6   1
IL5             Interleukin 5                             0.8        9.8   1
C2-set          Immunoglobulin C2-set domain              1.6        9.8   1
DUF2021         Domain of unknown function (DUF2021)      0.6        9.8   1
Ribonuclease_3  RNase3 domain                             1.1         10   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
DUF2514           1/1      24    35 ..   165   176 .]     0.6      8.3
DUF820            1/1      42    58 ..   109   131 .]     2.4      3.5
DUF59             1/1      49    58 ..    74    83 .]     2.3      7.8
SURF2             1/1      73    92 ..     1    21 [.     2.0      2.8
ISN1              1/1      75    83 ..   443   451 .]    -1.7      8.8
ChiC              1/1      81   101 ..   174   195 .]     0.3      8.8
DUF422            1/1     233   264 ..     1    32 [.     4.5      0.6
Ribonuclease_3    1/1     261   269 ..    92   100 .]     1.1       10
DUF2510           1/1     266   281 ..     9    24 ..     1.8        9
Lipoprotein_2     1/1     284   297 ..   176   189 .]     2.7      2.6
GHMP_kinases_C    1/1     291   319 ..    63    93 .]     2.1      4.9
Ribosomal_S7e     1/1     297   317 ..     1    23 [.     2.1      2.7
DUF336            1/1     370   385 ..   123   138 .]     2.2      5.4
CinA              1/1     403   415 ..    18    30 ..     1.1      8.2
Big_4             1/2     425   436 ..    51    62 .]     1.3       19
Fimbrial          1/1     425   433 ..     1     9 [.     0.9      7.1
IL5               1/1     447   480 ..     1    34 [.     0.8      9.8
CTP-dep_RFKase    1/1     470   480 ..   119   129 .]     1.1      8.3
He_PIG            1/4     498   565 ..    32    61 .]     3.3      3.7
SLT_beta          1/5     533   562 ..     1    27 [.     4.0      1.3
RA                1/4     554   575 ..     1    23 [.     0.5       26
SoxZ              1/4     554   576 ..    82   104 .]     4.0      1.2
Cadherin          1/5     555   577 ..    76   107 .]     0.8       16
Flagellin_IN      1/9     555   584 ..     1    30 [.     3.7      3.5
BiPBP_C           1/4     556   572 ..    77    94 .]     4.5      1.1
PKD               1/10    557   576 ..    73    92 .]     2.8      2.6
He_PIG            2/4     594   661 ..    32    61 .]     3.3      3.7
SLT_beta          2/5     629   658 ..     1    27 [.     4.0      1.3
RA                2/4     650   671 ..     1    23 [.     0.5       26
SoxZ              2/4     650   672 ..    82   104 .]     4.0      1.2
Cadherin          2/5     651   673 ..    76   107 .]     0.8       16
Flagellin_IN      2/9     651   680 ..     1    30 [.     3.7      3.5
BiPBP_C           2/4     652   668 ..    77    94 .]     4.5      1.1
PKD               2/10    653   672 ..    73    92 .]     2.8      2.6
He_PIG            3/4     690   757 ..    32    61 .]     3.3      3.7
SLT_beta          3/5     725   754 ..     1    27 [.     4.0      1.3
RA                3/4     746   767 ..     1    23 [.     0.5       26
SoxZ              3/4     746   768 ..    82   104 .]     4.0      1.2
Cadherin          3/5     747   769 ..    76   107 .]     0.8       16
Flagellin_IN      3/9     747   776 ..     1    30 [.     3.7      3.5
BiPBP_C           3/4     748   764 ..    77    94 .]     4.5      1.1
PKD               3/10    749   768 ..    73    92 .]     2.8      2.6
He_PIG            4/4     786   853 ..    32    61 .]     3.3      3.7
SLT_beta          4/5     821   850 ..     1    27 [.     4.0      1.3
RA                4/4     842   864 ..     1    22 [.     1.4       15
SoxZ              4/4     842   864 ..    82   104 .]     6.3     0.23
Cadherin          4/5     843   865 ..    76   107 .]     1.4       11
Flagellin_IN      4/9     843   870 ..     1    28 [.     3.7      3.6
BiPBP_C           4/4     844   860 ..    77    94 .]     4.5      1.1
PKD               4/10    845   864 ..    73    92 .]     3.9      1.1
I-set             1/1     872   888 ..    80    96 .]     5.2     0.88
Phage_tail_3      1/1     872   903 ..   137   168 .]     5.5     0.52
Gp5_C             1/7     874   891 ..     1    18 [.     0.5       50
PEP-utilizers     1/5     875   893 ..    63    92 .]     2.2      6.5
Gp5_C             2/7     959   982 ..     2    24 .]     0.9       37
PKD               5/10    971   987 ..    75    92 .]     1.5      6.3
Cadherin          5/5     972   988 ..    81   107 .]     3.2      3.4
DUF801            1/2    1050  1078 ..     1    29 []     1.4       16
PKD               6/10   1082  1098 ..    75    92 .]     0.8       10
Gp5_C             3/7    1084  1102 ..     1    19 [.     4.5      2.9
Flagellin_IN      5/9    1095  1129 ..     1    35 [.     3.6      3.8
DUF801            2/2    1111  1138 ..     1    29 []     1.0       21
DUF2407           1/2    1152  1163 ..     1    17 [.     0.1      5.5
7tm_2             1/1    1193  1215 ..   245   267 ..    -0.3      9.4
Gmad2             1/1    1195  1224 ..    66    98 .]     5.8     0.31
DUF357            1/3    1229  1243 ..    61    75 .]     0.7       22
CBM_6             1/1    1234  1265 ..    34    66 ..     3.1      1.4
YaeQ              1/2    1251  1276 ..   151   176 .]     8.9    0.019
PKD               7/10   1253  1272 ..    73    92 .]     4.1        1
FG-GAP            1/3    1312  1328 ..     1    16 [.     2.1       13
DUF74             1/1    1313  1321 ..    99   107 .]     3.7      1.4
FAD_binding_1     1/1    1345  1360 ..   223   238 .]     0.8      5.8
PKD               8/10   1374  1405 ..     1    40 [.     2.7      2.8
Flagellin_IN      6/9    1422  1439 ..     1    34 [.     1.9       11
DUF1750           1/1    1466  1485 ..   730   749 .]    -2.2      8.3
BHD_3             1/1    1562  1575 ..    66    79 .]     1.4      9.6
DUF357            2/3    1568  1582 ..    61    75 .]     3.3      4.2
RtxA              1/4    1587  1605 ..     1    19 []     0.3       71
PKD               9/10   1593  1611 ..    74    92 .]     7.3      0.1
PRK               1/1    1608  1618 ..   207   217 .]    -0.1      9.4
DUF1565           1/1    1637  1650 ..     1    15 [.    -1.0      9.5
Big_2             1/3    1661  1686 ..     1    28 [.     5.1     0.83
DUF2407           2/2    1665  1676 ..     1    17 [.     0.3      4.8
Drmip_Hesp        1/1    1679  1687 ..   103   111 .]     2.3        4
MucBP             1/2    1681  1717 ..    73   108 .]     3.1      4.2
SipA              1/1    1695  1707 ..   701   713 .]     2.9     0.77
Redoxin           1/1    1720  1743 ..   154   179 .]     4.3      1.2
TatD_DNase        1/1    1730  1741 ..   275   286 .]    -0.4      8.7
Complex1_24kDa    1/1    1731  1744 ..   148   161 .]     1.0      8.2
DUF357            3/3    1736  1750 ..    61    75 .]     1.0       18
Hexapep           1/1    1811  1821 ..     8    18 .]     3.9      6.5
Parvo_NS1         1/1    1823  1838 ..   349   364 .]    -0.2        7
DUF1759           1/1    1837  1846 ..     1    10 [.     0.1        8
Avidin            1/2    1838  1856 ..    13    32 ..     0.9      9.6
Flagellin_D3      1/3    1855  1877 ..    65    92 ..     0.0       32
YaeQ              2/2    1903  1925 ..   154   176 .]     2.8      1.4
SLT_beta          5/5    1974  2001 ..     1    27 [.     2.0      4.8
Flagellin_IN      7/9    1981  2012 ..     1    36 [.     1.0       20
Myosin_N          1/2    1991  2005 ..    22    37 ..     1.6       18
Phage_fiber_2     1/1    2025  2068 ..     1    44 []     2.7      3.3
C2-set            1/1    2085  2107 ..     1    24 [.     1.6      9.8
HemolysinCabind   1/31   2086  2103 ..     1    18 []    13.0   0.0091
HemolysinCabind   2/31   2104  2121 ..     1    18 []    21.7    2e-05
HemolysinCabind   3/31   2122  2139 ..     1    18 []    21.6  2.2e-05
HemolysinCabind   4/31   2140  2157 ..     1    18 []    17.3  0.00045
HemolysinCabind   5/31   2176  2187 ..     7    18 .]    10.6    0.047
Gly_reductase     1/1    2252  2275 ..     1    25 [.     2.8     0.45
DFF-C             1/1    2435  2441 ..     1     7 [.     1.2      6.7
XylR_N            1/1    2447  2472 ..    81   105 .]     1.5      8.3
QLQ               1/1    2490  2502 ..     1    13 [.     3.6      4.4
MucBP             2/2    2564  2598 ..    68   108 .]     2.0      8.3
HemolysinCabind   6/31   2597  2609 ..     1    13 [.     6.8      0.7
HemolysinCabind   7/31   2620  2631 ..     7    18 .]     5.6      1.6
HemolysinCabind   8/31   2633  2648 ..     3    18 .]     7.7     0.37
Transposase_34    1/1    2643  2656 ..     1    14 [.     1.6        8
SH3_5             1/1    2667  2693 ..     1    28 [.     4.6      2.8
HemolysinCabind   9/31   2707  2724 ..     1    18 []    25.0  2.1e-06
HemolysinCabind  10/31   2725  2742 ..     1    18 []    24.4  3.2e-06
HemolysinCabind  11/31   2775  2786 ..     7    18 .]     4.5      3.3
UPF0565           1/1    2808  2817 ..     1    10 [.    -0.8      9.3
Pox_G7            1/1    2809  2817 ..   403   411 .]    -0.1      4.8
FmdA_AmdA         1/1    2816  2850 ..   374   417 .]     0.1      5.7
HemolysinCabind  12/31   2882  2899 ..     1    18 []     8.8     0.17
HemolysinCabind  13/31   2900  2917 ..     1    18 []    19.9  7.1e-05
HemolysinCabind  14/31   2918  2934 ..     1    17 [.    15.9   0.0012
G6PD_N            1/1    2925  2932 ..     1     8 [.     0.2      5.3
HemolysinCabind  15/31   2936  2953 ..     1    18 []    13.9   0.0047
SBP56             1/1    2937  2945 ..   477   485 .]    -1.1      8.3
YopE              1/1    2955  2965 ..    60    70 .]     2.7      5.6
Fil_haemagg       1/5    2983  3031 ..     1    75 []     3.6      2.6
Chlam_PMP         1/1    2995  3023 ..     1    19 []     4.1      8.2
DUF1034           1/1    2996  3029 ..    39    80 ..     6.1     0.43
HIM               1/2    3018  3035 ..     1    19 [.     2.1       17
DUF2523           1/1    3041  3069 ..    16    44 ..     3.3      4.4
DUF2134           1/1    3062  3142 ..     1    79 [.     3.9      1.3
DUF920            1/1    3068  3089 ..   150   171 .]     1.3      6.2
Peptidase_S6      1/1    3104  3133 ..   882   919 .]    -0.1      4.5
ThiS              1/1    3121  3149 ..     1    28 [.     0.0      9.2
DUF427            1/1    3137  3148 ..     1    12 [.     2.4      4.1
CAP160            1/2    3139  3165 ..     1    27 []     3.3      6.9
Phage_attach      1/1    3176  3189 ..     1    16 [.     2.3     0.61
CAP160            2/2    3229  3248 ..     1    21 [.     0.5       42
CBM_15            1/1    3340  3347 ..     1     8 [.     3.3     0.64
HemolysinCabind  16/31   3383  3400 ..     1    18 []     5.8      1.4
DUF1522           1/3    3390  3397 ..   111   118 .]     1.7      5.8
HemolysinCabind  17/31   3401  3418 ..     1    18 []    20.7  4.1e-05
HemolysinCabind  18/31   3419  3436 ..     1    18 []    22.4  1.3e-05
HemolysinCabind  19/31   3447  3464 ..     1    18 []    20.8  3.8e-05
Tautomerase       1/1    3468  3484 ..    46    62 .]     2.9      6.6
DUF1522           2/3    3585  3595 ..   108   118 .]     3.6      1.6
Fe_hyd_lg_C       1/1    3620  3625 ..   320   325 .]    -1.8      8.6
HemolysinCabind  20/31   3635  3652 ..     1    18 []    11.9    0.019
HemolysinCabind  21/31   3653  3670 ..     1    18 []    19.1  0.00012
EF_assoc_2        1/1    3792  3824 ..     1    37 [.     3.2      3.3
PilM              1/1    3822  3834 ..   130   142 .]     4.1      1.9
GumN              1/1    3848  3859 ..   275   286 .]     1.6      4.3
Gp5_C             4/7    3954  3978 ..     1    24 []     3.1        8
CsgG              1/1    3986  4001 ..   255   270 .]     0.8      7.4
SEA               1/1    3993  4035 ..    76   121 .]     1.5      8.8
RtxA              2/4    3996  4012 ..     1    19 []     0.3       69
Ribosomal_S11     1/1    4010  4032 ..    18    40 ..     0.3      8.7
CGGC              1/2    4043  4051 ..   118   126 .]     1.5      3.1
PAAR_motif        1/5    4046  4057 ..     1    12 [.     1.0       36
FTP               1/1    4098  4116 ..    33    51 .]     2.7      6.9
PDE8              1/1    4106  4124 ..    35    52 .]     2.7      3.6
DUF592            1/1    4123  4130 ..   169   176 .]     0.0      4.7
RtxA              3/4    4131  4149 ..     1    19 []     1.5       31
Halo_GVPC         1/2    4170  4179 ..     1    10 [.     1.4       31
DUF1112           1/1    4185  4198 ..     1    14 [.     1.0      5.1
DUF811            1/1    4234  4245 ..     1    12 [.     0.9      5.4
Haemagg_act       1/2    4272  4286 ..   125   139 .]     1.2      7.6
CbbQ_C            1/1    4300  4313 ..     1    15 [.     1.7      8.4
Flagellin_D3      2/3    4312  4344 ..     1    40 [.     6.6     0.55
HpaB              1/1    4402  4415 ..     1    14 [.     1.2      3.6
FG-GAP            2/3    4419  4431 ..     1    13 [.     2.6      9.1
SLH               1/1    4448  4480 ..     1    36 [.     4.6        2
DUF490            1/1    4492  4565 ..     1    77 [.     4.4     0.51
CRAM_rpt          1/1    4542  4564 ..     1    24 []     2.4      2.2
Flavodoxin_NdrI   1/1    4542  4554 ..   114   126 ..     2.9      2.7
Bul1_N            1/1    4550  4563 ..   504   517 .]     1.6      1.6
DnaD              1/1    4584  4594 ..    66    76 .]     2.3      8.4
G-gamma           1/1    4656  4667 ..    44    55 .]     4.0      2.2
Rep_trans         1/1    4709  4737 ..   241   269 .]     3.1      1.9
DUF1522           3/3    4820  4829 ..   110   118 .]     0.4       13
PAAR_motif        2/5    4822  4833 ..     1    12 [.     0.7       46
PKD              10/10   4823  4848 ..    62    92 .]     0.2       15
NIF3              1/1    4853  4871 ..   186   204 ..     2.6      2.3
DUF2021           1/1    4935  4946 ..    95   106 .]     0.6      9.8
RtxA              4/4    4936  4944 ..     1     9 [.     1.2       36
Flagellin_IN      8/9    4940  4958 ..    46    63 .]     2.1       10
Big_4             2/2    4986  5006 ..    38    62 .]     3.1      5.9
PhageMaj_Tail     1/3    4986  4999 ..   127   140 .]     6.2     0.49
PAAR_motif        3/5    4990  5004 ..     1    15 [.     2.7       12
PPC               1/2    5012  5073 ..    12    85 .]     1.3       12
Vps26             1/1    5023  5036 ..     1    16 [.    -1.1        9
FG-GAP            3/3    5053  5069 ..    14    36 .]     5.0      1.8
DNA_gyraseA_C     1/1    5054  5072 ..     1    19 [.     4.6        3
FabA              1/1    5070  5086 ..   126   142 .]     1.3      9.3
PEP-utilizers     2/5    5093  5114 ..    70    92 .]     0.2       25
PAAR_motif        4/5    5139  5151 ..     1    13 [.     3.9      5.2
Gp5_C             5/7    5202  5226 ..     1    24 []     5.9      1.1
Myosin_N          2/2    5245  5260 ..    20    37 ..     1.6       17
PAAR_motif        5/5    5264  5274 ..     1    11 [.     1.7       23
Reovirus_M2       1/1    5267  5275 ..     1     9 [.    -0.5      2.5
Ribosomal_L44     1/1    5276  5287 ..    69    80 .]     2.8      3.9
YbbR              1/1    5298  5345 ..    40    93 .]     1.4      9.4
Fibritin_C        1/1    5331  5354 ..     1    25 [.     1.4      5.1
DUF607            1/1    5353  5375 ..     1    28 [.     1.6      4.5
RCC1              1/1    5371  5395 ..     1    26 [.     2.0      7.5
Haemagg_act       2/2    5408  5423 ..   124   139 .]     0.5       12
Secretin          1/1    5434  5470 ..     1    37 [.     2.1      3.2
CGGC              2/2    5511  5519 ..   118   126 .]     2.5      1.4
PUA               1/1    5609  5629 ..     1    25 [.     2.8      6.8
RhgB_N            1/1    5632  5645 ..     1    14 [.     0.4      7.5
Apo-CIII          1/1    5649  5665 ..    75    91 .]     2.5      3.3
Avidin            2/2    5674  5689 ..    29    44 ..     0.3       15
Gp5_C             6/7    5675  5684 ..     9    18 ..     0.8       40
DUF853            1/1    5694  5705 ..   412   423 ..    -1.6      9.6
PhageMaj_Tail     2/3    5697  5714 ..   123   140 .]     5.4     0.82
Flagellin_N       1/1    5740  5770 ..   107   141 .]     6.0     0.47
DUF847            1/1    5791  5797 ..   100   106 .]     2.4      6.9
Fil_haemagg       2/5    5794  5844 ..     1    75 []     7.5      0.2
DUF769            1/1    5858  5879 ..   281   302 ..     0.1      5.4
gp12-short_mid    1/1    5865  5880 ..    66    81 .]     1.3      7.5
Eeig1             1/1    5866  5879 ..   208   221 .]     0.7      7.8
SBP_bac_5         1/1    5868  5919 ..   415   490 .]     3.1        1
Fil_haemagg       3/5    5994  6077 ..     1    75 []     0.7       17
ADH_zinc_N        1/1    6027  6036 ..     1    10 [.     2.2      3.7
PhageMaj_Tail     3/3    6062  6075 ..   127   140 .]     1.5        9
PEP-utilizers     3/5    6158  6165 ..    84    92 .]     0.6       19
PepSY             1/1    6158  6171 ..    55    68 .]     3.1      5.9
PPC               2/2    6173  6229 ..     9    79 ..     1.0       14
DUF814            1/1    6222  6232 ..    94   104 .]     5.7     0.46
PvlArgDC          1/1    6240  6254 ..   183   197 .]     1.2      5.4
Big_2             2/3    6293  6320 ..    62    90 .]     1.7      8.4
PEP-utilizers     4/5    6304  6314 ..    81    92 .]     3.2      3.5
DUF2345           1/1    6335  6358 ..    97   120 ..     1.7      6.5
Fil_haemagg       4/5    6339  6402 ..     1    75 []     5.8     0.61
Reg_prop          1/1    6339  6363 ..     1    23 []     5.3      5.6
PEP-utilizers     5/5    6376  6397 ..    60    92 .]     1.3       12
DUF2125           1/1    6405  6432 ..   234   261 ..     0.9      1.5
DUF2328           1/1    6416  6441 ..   163   188 .]     0.3      5.7
Big_1             1/1    6422  6457 ..     1    37 [.     2.5      2.3
Flagellin_D3      3/3    6429  6453 ..    75   100 .]     1.1       16
Big_2             3/3    6431  6453 ..    67    90 .]     1.0       13
HIM               2/2    6467  6480 ..    11    24 .]     2.0       18
DUF2207           1/1    6474  6493 ..     1    20 [.     0.0      5.6
Halo_GVPC         2/2    6477  6489 ..     1    13 [.     2.7       13
Phage_Capsid_P3   1/1    6515  6529 ..   380   394 .]    -0.8      6.2
Gp5_C             7/7    6529  6544 ..     1    16 [.     0.1       67
Mito_carr         1/1    6572  6592 ..     1    21 [.     2.3      4.9
HemolysinCabind  22/31   6714  6731 ..     1    18 []     4.2      4.2
Peptidase_C47     1/1    6728  6734 ..   170   176 .]     1.2      4.1
HemolysinCabind  23/31   6732  6749 ..     1    18 []    16.7   0.0007
Viral_Rep_C       1/1    6739  6752 ..   112   125 .]     2.1      4.2
HemolysinCabind  24/31   6750  6767 ..     1    18 []    23.3  6.8e-06
HemolysinCabind  25/31   6771  6787 ..     1    17 [.     8.5      0.2
Tenui_NS3         1/1    6800  6808 ..   189   197 .]     0.3      5.2
CW_binding_1      1/1    6805  6812 ..    12    19 .]     4.2      3.2
ImpE              1/1    6871  6879 ..   250   258 .]     0.5      9.5
DUF1980           1/1    6890  6898 ..   210   218 .]     1.2      5.7
Fil_haemagg       5/5    6951  6984 ..    45    75 .]     0.9       16
Flagellin_IN      9/9    6979  7000 ..     1    29 [.     6.2     0.68
HemolysinCabind  26/31   6981  6991 ..     8    18 .]     4.6      3.2
DUF1772           1/1    7008  7035 ..    23    54 .]     2.7      3.6
Glutaredoxin      1/1    7014  7049 ..    36    84 .]     4.1      1.8
SecA_DEAD         1/1    7024  7032 ..   263   271 .]     2.7      1.6
HemolysinCabind  27/31   7062  7072 ..     8    18 .]     3.6      6.5
HemolysinCabind  28/31   7085  7102 ..     1    18 []    15.7   0.0014
DUF1900           1/1    7100  7114 ..   125   139 .]     1.7      7.5
HemolysinCabind  29/31   7103  7111 ..    10    18 .]     5.1      2.2
HemolysinCabind  30/31   7112  7129 ..     1    18 []    12.1    0.017
HemolysinCabind  31/31   7156  7162 ..    12    18 .]     0.0       77
Colipase_C        1/1    7158  7176 ..    27    45 .]     1.8      9.1

Alignments of top-scoring domains:
DUF2514: domain 1 of 1, from 24 to 35: score 0.6, E = 8.3
                   *->ltCERaYDaltk<-*
                      ++CERaY  + k
  gi|7818626    24    QACERAYSDVNK    35

DUF820: domain 1 of 1, from 42 to 58: score 2.4, E = 3.5
                   *->peYWlvDpkyrrrrrerrvevyr<-*
                      pe++l+Dp         +vev
  gi|7818626    42    PEVLLYDPG------VAEVEVLL    58

DUF59: domain 1 of 1, from 49 to 58: score 2.3, E = 7.8
                CS    TT--EEEEEE
                   *->PGvedVeVel<-*
                      PGv +VeV l
  gi|7818626    49    PGVAEVEVLL    58

SURF2: domain 1 of 1, from 73 to 92: score 2.0, E = 2.8
                   *->MdElpkDvkAFLrehPslrlL<-*
                       +  p +++AFL  hP l  L
  gi|7818626    73    -SDSPQEILAFLISHPQLTAL    92

ISN1: domain 1 of 1, from 75 to 83: score -1.7, E = 8.8
                   *->sPqETveyL<-*
                      sPqE  ++L
  gi|7818626    75    SPQEILAFL    83

ChiC: domain 1 of 1, from 81 to 101: score 0.3, E = 8.8
                   *->ALkkDyPrgvalvdataGtGPG<-*
                      A++   P ++al +++ G++ G
  gi|7818626    81    AFLISHPQLTALHILGHGGP-G    101

DUF422: domain 1 of 1, from 233 to 264: score 4.5, E = 0.6
                   *->efqwifallGvvsMalpfvAglvyaldrrGll<-*
                      +++  ++l G+vs    ++A +v+a  ++G++
  gi|7818626   233    SYYLLVSLAGIVSSDQFSFATTVPASPTAGAV    264

Ribonuclease_3: domain 1 of 1, from 261 to 269: score 1.1, E = 10
                CS    HHHHHHHCT
                   *->iGAiyLDgG<-*
                      +GA+y D+G
  gi|7818626   261    AGAVYSDSG    269

DUF2510: domain 1 of 1, from 266 to 281: score 1.8, E = 9
                   *->SgprglRwWDGtqWTd<-*
                      S++ ++ ++DG++W +
  gi|7818626   266    SDSGTIKYYDGSAWSA    281

Lipoprotein_2: domain 1 of 1, from 284 to 297: score 2.7, E = 2.6
                   *->TVdsgLkkikEavk<-*
                      TVds L+ +++a+k
  gi|7818626   284    TVDSSLDGAGGALK    297

GHMP_kinases_C: domain 1 of 1, from 291 to 319: score 2.1, E = 4.9
                CS    TTSSSSEEEEEETEGGGHHHHHHHHH HHHHH
                   *->GaGgGptvfalfddeeeaeevlealr.krgkn<-*
                      GaG  +++  +f + ++ ++++ a++++++++
  gi|7818626   291    GAG--GALKIVF-NSSASDAIATAVAqSILYQ    319

Ribosomal_S7e: domain 1 of 1, from 297 to 317: score 2.1, E = 2.7
                   *->aKIvKagseePdefelqvaQAll<-*
                       KIv  +s++ d++ + vaQ +l
  gi|7818626   297    -KIV-FNSSASDAIATAVAQSIL    317

DUF336: domain 1 of 1, from 370 to 385: score 2.2, E = 5.4
                   *->sgeqDeaiAraGlaAl<-*
                      ++++D aiA++Gl+++
  gi|7818626   370    TVAEDTAIAITGLSVA    385

CinA: domain 1 of 1, from 403 to 415: score 1.1, E = 8.2
                   *->tiatAESCTGGll<-*
                      ti++AES T Gl+
  gi|7818626   403    TITVAESVTSGLV    415

Big_4: domain 1 of 2, from 425 to 436: score 1.3, E = 19
                   *->GtfeVtGtVeGt<-*
                      Gt++ tGtV+ +
  gi|7818626   425    GTVTLTGTVAEI    436

Fimbrial: domain 1 of 1, from 425 to 433: score 0.9, E = 7.1
                   *->GtvtFkGeV<-*
                      Gtvt++G+V
  gi|7818626   425    GTVTLTGTV    433

IL5: domain 1 of 1, from 447 to 480: score 0.8, E = 9.8
                CS    XXX--HHHHHHHHHHHHHCTHHHHHT-TT-EEEE
                   *->aveiplsalvkEtLtlLstHrtLLignetlripv<-*
                        + +l+    +tLt+L t  +LL+  +t+ i v
  gi|7818626   447    SYQGALNYNGSDTLTMLTTDGSLLTDSDTVSITV    480

CTP-dep_RFKase: domain 1 of 1, from 470 to 480: score 1.1, E = 8.3
                   *->LkDGDeVeiev<-*
                      L D D+V+i v
  gi|7818626   470    LTDSDTVSITV    480

He_PIG: domain 1 of 4, from 498 to 565: score 3.3, E = 3.7
                   *->sstGritGtPtptvqp...............................
                      + +G+itGt +++ ++++  ++ + + ++  ++++ + + +++  +
  gi|7818626   498    NEDGTITGTLAVADAAdglaspldfsvstaasngtatidattgawsy 544

                   .......Gsytftvtatdgsg<-*
                    ++ + +Gs +ftv++tdg g
  gi|7818626   545 aptadynGSDSFTVSVTDGDG    565

SLT_beta: domain 1 of 5, from 533 to 562: score 4.0, E = 1.3
                CS    X--EEEEEEEEE   EEE-TTS-EEEEETT
                   *->AapDCvkGKvEy...sKYneDDtFtvKvdd<-*
                      A+ D  +G   y +++ Yn  D Ftv v d
  gi|7818626   533    ATIDATTGAWSYaptADYNGSDSFTVSVTD    562

RA: domain 1 of 4, from 554 to 575: score 0.5, E = 26
                   *->dsgvlrVygedgtpgtyktilvs<-*
                      ds+++ V ++dg+++ + +i+v+
  gi|7818626   554    DSFTVSVTDGDGNVE-TQVISVT    575

SoxZ: domain 1 of 4, from 554 to 576: score 4.0, E = 1.2
                CS    E.EEEEEEETTS-EEEEEEEE--
                   *->delkfsWtDnkGssetaeakItv<-*
                      d++++s tD +G++et + ++tv
  gi|7818626   554    DSFTVSVTDGDGNVETQVISVTV    576

Cadherin: domain 1 of 5, from 555 to 577: score 0.8, E = 16
                CS    --EEE----.........S---EEEE--EEE-
                   *->eLtveAtDadpllasgggpplsstatvtitVl<-*
                      ++tv++tD+d         +   t ++ +tV
  gi|7818626   555    SFTVSVTDGD---------GNVETQVISVTVA    577

Flagellin_IN: domain 1 of 9, from 555 to 584: score 3.7, E = 3.5
                   *->tltinggggkensvadgvdislsagdslaa<-*
                      ++t ++++g++n++ +++ ++++a+ ++a+
  gi|7818626   555    SFTVSVTDGDGNVETQVISVTVAAVNDAAT    584

BiPBP_C: domain 1 of 4, from 556 to 572: score 4.5, E = 1.1
                   *->htLtVvDadGrsdrvVrf<-*
                      +t++V+D+dG++++   +
  gi|7818626   556    FTVSVTDGDGNVETQ-VI    572

PKD: domain 1 of 10, from 557 to 576: score 2.8, E = 2.6
                CS    EEEEEETTCEEEEEEEEEEE
                   *->tLtvsngvgsasattttvtV<-*
                      t+ v++g g++ ++ ++vtV
  gi|7818626   557    TVSVTDGDGNVETQVISVTV    576

He_PIG: domain 2 of 4, from 594 to 661: score 3.3, E = 3.7
                   *->sstGritGtPtptvqp...............................
                      + +G+itGt +++ ++++  ++ + + ++  ++++ + + +++  +
  gi|7818626   594    NEDGTITGTLAVADAAdglaspldfsvstaasngtatidattgawsy 640

                   .......Gsytftvtatdgsg<-*
                    ++ + +Gs +ftv++tdg g
  gi|7818626   641 aptadynGSDSFTVSVTDGDG    661

SLT_beta: domain 2 of 5, from 629 to 658: score 4.0, E = 1.3
                CS    X--EEEEEEEEE   EEE-TTS-EEEEETT
                   *->AapDCvkGKvEy...sKYneDDtFtvKvdd<-*
                      A+ D  +G   y +++ Yn  D Ftv v d
  gi|7818626   629    ATIDATTGAWSYaptADYNGSDSFTVSVTD    658

RA: domain 2 of 4, from 650 to 671: score 0.5, E = 26
                   *->dsgvlrVygedgtpgtyktilvs<-*
                      ds+++ V ++dg+++ + +i+v+
  gi|7818626   650    DSFTVSVTDGDGNVE-TQVISVT    671

SoxZ: domain 2 of 4, from 650 to 672: score 4.0, E = 1.2
                CS    E.EEEEEEETTS-EEEEEEEE--
                   *->delkfsWtDnkGssetaeakItv<-*
                      d++++s tD +G++et + ++tv
  gi|7818626   650    DSFTVSVTDGDGNVETQVISVTV    672

Cadherin: domain 2 of 5, from 651 to 673: score 0.8, E = 16
                CS    --EEE----.........S---EEEE--EEE-
                   *->eLtveAtDadpllasgggpplsstatvtitVl<-*
                      ++tv++tD+d         +   t ++ +tV
  gi|7818626   651    SFTVSVTDGD---------GNVETQVISVTVA    673

Flagellin_IN: domain 2 of 9, from 651 to 680: score 3.7, E = 3.5
                   *->tltinggggkensvadgvdislsagdslaa<-*
                      ++t ++++g++n++ +++ ++++a+ ++a+
  gi|7818626   651    SFTVSVTDGDGNVETQVISVTVAAVNDAAT    680

BiPBP_C: domain 2 of 4, from 652 to 668: score 4.5, E = 1.1
                   *->htLtVvDadGrsdrvVrf<-*
                      +t++V+D+dG++++   +
  gi|7818626   652    FTVSVTDGDGNVETQ-VI    668

PKD: domain 2 of 10, from 653 to 672: score 2.8, E = 2.6
                CS    EEEEEETTCEEEEEEEEEEE
                   *->tLtvsngvgsasattttvtV<-*
                      t+ v++g g++ ++ ++vtV
  gi|7818626   653    TVSVTDGDGNVETQVISVTV    672

He_PIG: domain 3 of 4, from 690 to 757: score 3.3, E = 3.7
                   *->sstGritGtPtptvqp...............................
                      + +G+itGt +++ ++++  ++ + + ++  ++++ + + +++  +
  gi|7818626   690    NEDGTITGTLAVADAAdglaspldfsvstaasngtatidattgawsy 736

                   .......Gsytftvtatdgsg<-*
                    ++ + +Gs +ftv++tdg g
  gi|7818626   737 aptadynGSDSFTVSVTDGDG    757

SLT_beta: domain 3 of 5, from 725 to 754: score 4.0, E = 1.3
                CS    X--EEEEEEEEE   EEE-TTS-EEEEETT
                   *->AapDCvkGKvEy...sKYneDDtFtvKvdd<-*
                      A+ D  +G   y +++ Yn  D Ftv v d
  gi|7818626   725    ATIDATTGAWSYaptADYNGSDSFTVSVTD    754

RA: domain 3 of 4, from 746 to 767: score 0.5, E = 26
                   *->dsgvlrVygedgtpgtyktilvs<-*
                      ds+++ V ++dg+++ + +i+v+
  gi|7818626   746    DSFTVSVTDGDGNVE-TQVISVT    767

SoxZ: domain 3 of 4, from 746 to 768: score 4.0, E = 1.2
                CS    E.EEEEEEETTS-EEEEEEEE--
                   *->delkfsWtDnkGssetaeakItv<-*
                      d++++s tD +G++et + ++tv
  gi|7818626   746    DSFTVSVTDGDGNVETQVISVTV    768

Cadherin: domain 3 of 5, from 747 to 769: score 0.8, E = 16
                CS    --EEE----.........S---EEEE--EEE-
                   *->eLtveAtDadpllasgggpplsstatvtitVl<-*
                      ++tv++tD+d         +   t ++ +tV
  gi|7818626   747    SFTVSVTDGD---------GNVETQVISVTVA    769

Flagellin_IN: domain 3 of 9, from 747 to 776: score 3.7, E = 3.5
                   *->tltinggggkensvadgvdislsagdslaa<-*
                      ++t ++++g++n++ +++ ++++a+ ++a+
  gi|7818626   747    SFTVSVTDGDGNVETQVISVTVAAVNDAAT    776

BiPBP_C: domain 3 of 4, from 748 to 764: score 4.5, E = 1.1
                   *->htLtVvDadGrsdrvVrf<-*
                      +t++V+D+dG++++   +
  gi|7818626   748    FTVSVTDGDGNVETQ-VI    764

PKD: domain 3 of 10, from 749 to 768: score 2.8, E = 2.6
                CS    EEEEEETTCEEEEEEEEEEE
                   *->tLtvsngvgsasattttvtV<-*
                      t+ v++g g++ ++ ++vtV
  gi|7818626   749    TVSVTDGDGNVETQVISVTV    768

He_PIG: domain 4 of 4, from 786 to 853: score 3.3, E = 3.7
                   *->sstGritGtPtptvqp...............................
                      + +G+itGt +++ ++++  ++ + + ++  ++++ + + +++  +
  gi|7818626   786    NEDGTITGTLAVADAAdglaspldfsvstaasngtatidattgawsy 832

                   .......Gsytftvtatdgsg<-*
                    ++ + +Gs +ftv++tdg g
  gi|7818626   833 aptadynGSDSFTVSVTDGDG    853

SLT_beta: domain 4 of 5, from 821 to 850: score 4.0, E = 1.3
                CS    X--EEEEEEEEE   EEE-TTS-EEEEETT
                   *->AapDCvkGKvEy...sKYneDDtFtvKvdd<-*
                      A+ D  +G   y +++ Yn  D Ftv v d
  gi|7818626   821    ATIDATTGAWSYaptADYNGSDSFTVSVTD    850

RA: domain 4 of 4, from 842 to 864: score 1.4, E = 15
                   *->dsgvlrVygedgtpgt.yktilv<-*
                      ds+++ V ++dg+++t+  +i v
  gi|7818626   842    DSFTVSVTDGDGNVETqVISITV    864

SoxZ: domain 4 of 4, from 842 to 864: score 6.3, E = 0.23
                CS    E.EEEEEEETTS-EEEEEEEE--
                   *->delkfsWtDnkGssetaeakItv<-*
                      d++++s tD +G++et + +Itv
  gi|7818626   842    DSFTVSVTDGDGNVETQVISITV    864

Cadherin: domain 4 of 5, from 843 to 865: score 1.4, E = 11
                CS    --EEE----.........S---EEEE--EEE-
                   *->eLtveAtDadpllasgggpplsstatvtitVl<-*
                      ++tv++tD+d         +   t ++ itV
  gi|7818626   843    SFTVSVTDGD---------GNVETQVISITVA    865

Flagellin_IN: domain 4 of 9, from 843 to 870: score 3.7, E = 3.6
                   *->tltinggggkensvadgvdislsagdsl<-*
                      ++t ++++g++n++ +++ i+++a+ ++
  gi|7818626   843    SFTVSVTDGDGNVETQVISITVAAVNDA    870

BiPBP_C: domain 4 of 4, from 844 to 860: score 4.5, E = 1.1
                   *->htLtVvDadGrsdrvVrf<-*
                      +t++V+D+dG++++   +
  gi|7818626   844    FTVSVTDGDGNVETQ-VI    860

PKD: domain 4 of 10, from 845 to 864: score 3.9, E = 1.1
                CS    EEEEEETTCEEEEEEEEEEE
                   *->tLtvsngvgsasattttvtV<-*
                      t+ v++g g++ ++ +++tV
  gi|7818626   845    TVSVTDGDGNVETQVISITV    864

I-set: domain 1 of 1, from 872 to 888: score 5.2, E = 0.88
                CS    EEEETTEEEEEEEEEEE
                   *->vAtNsaGeaeasaeLtV<-*
                      vA+N  G++  +a+LtV
  gi|7818626   872    VAVNDTGSVAEDATLTV    888

Phage_tail_3: domain 1 of 1, from 872 to 903: score 5.5, E = 0.52
                   *->iSFnktPsvsvNelmtvtvtlSlrgrpTryaa<-*
                      +++n+t+sv++++ +tv +tl +  + T + +
  gi|7818626   872    VAVNDTGSVAEDATLTVDATLGVLADDTDVDT    903

Gp5_C: domain 1 of 7, from 874 to 891: score 0.5, E = 50
                CS    S-EEEEESS-EEEEESSE
                   *->GnesltVkGnrtvtVgGn<-*
                       n++ +V  ++t+tV+ +
  gi|7818626   874    VNDTGSVAEDATLTVDAT    891

PEP-utilizers: domain 1 of 5, from 875 to 893: score 2.2, E = 6.5
                CS    TEEECTCEEEETTEEESTTEEEEE.CTSEE
                   *->nirvdakvleiateklkdGdiitvCDGstG<-*
                      n          +t ++ ++ ++tv D++ G
  gi|7818626   875    N----------DTGSVAEDATLTV-DATLG    893

Gp5_C: domain 2 of 7, from 959 to 982: score 0.9, E = 37
                CS    -EEEEESS-EEEEES SEEEEEES
                   *->nesltVkGnrtvtVg.GnqTtsVg<-*
                      ++ +tV +++t tV +G  T + +
  gi|7818626   959    DAGDTVTDTFTYTVSdGSLTDTAE    982

PKD: domain 5 of 10, from 971 to 987: score 1.5, E = 6.3
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      tvs+g  +++a  + +tV
  gi|7818626   971    TVSDGSLTDTAE-LVITV    987

Cadherin: domain 5 of 5, from 972 to 988: score 3.2, E = 3.4
                CS    ----.........S---EEEE--EEE-
                   *->AtDadpllasgggpplsstatvtitVl<-*
                      ++D+          +l++ta+++itV+
  gi|7818626   972    VSDG----------SLTDTAELVITVT    988

DUF801: domain 1 of 2, from 1050 to 1078: score 1.4, E = 16
                   *->mtvssDsttaGPsstAtnsAssEtPfvse<-*
                      +  s  s t  P stA n   +  P v
  gi|7818626  1050    LSLSGSSLTVNPNSTAFNDLGAGQPRVIL    1078

PKD: domain 6 of 10, from 1082 to 1098: score 0.8, E = 10
                CS    EEEETTCEEEEEEEEEEE
                   *->tvsngvgsasattttvtV<-*
                      +vs+g  ++++t +t+t+
  gi|7818626  1082    NVSDGTATVAQT-ATITI    1098

Gp5_C: domain 3 of 7, from 1084 to 1102: score 4.5, E = 2.9
                CS    S-EEEEESS-EEEEESSEE
                   *->GnesltVkGnrtvtVgGnq<-*
                       + + tV +++t+t+ G++
  gi|7818626  1084    SDGTATVAQTATITITGTN    1102

Flagellin_IN: domain 5 of 9, from 1095 to 1129: score 3.6, E = 3.8
                   *->tltinggggkensvadgvdislsagdslaaladaI<-*
                      t+ti+g++ + ++++++v   ++ +d ++++ +a+
  gi|7818626  1095    TITITGTNDTPSVTLGTVSSGFTEIDGVDTATNAV    1129

DUF801: domain 2 of 2, from 1111 to 1138: score 1.0, E = 21
                   *->mtvssDsttaGPsstAtnsAssEtPfvse<-*
                       tvss  t      tAtn+ +  t    e
  gi|7818626  1111    -TVSSGFTEIDGVDTATNAVAFGTTGTAE    1138

DUF2407: domain 1 of 2, from 1152 to 1163: score 0.1, E = 5.5
                   *->iVIRFSatSSaveniPD<-*
                      ++I F++++     i+D
  gi|7818626  1152    LTITFANST-----IRD    1163

7tm_2: domain 1 of 1, from 1193 to 1215: score -0.3, E = 9.4
                CS    -----------------------
                   *->GitwvlflfapeddarGvssivf<-*
                      Gitw +++ +++d+++G+ s+vf
  gi|7818626  1193    GITWSVAVTRTGDASTGTTSVVF    1215

Gmad2: domain 1 of 1, from 1195 to 1224: score 5.8, E = 0.31
                   *->tFsatvdipapaapgtgtleVfetSpsDGsgse<-*
                      t+s++v+  + a +   t +Vf+ S+s+G+
  gi|7818626  1195    TWSVAVTRTGDA-STGTTSVVFTNSASGGE--A    1224

DUF357: domain 1 of 3, from 1229 to 1243: score 0.7, E = 22
                   *->AhGwLDAGvrLGvfd<-*
                      A+++LDA ++    d
  gi|7818626  1229    AEALLDAIKYNNTSD    1243

CBM_6: domain 1 of 1, from 1234 to 1265: score 3.1, E = 1.4
                CS    -EEEEEE EEESSSEEEEEEEEEEESSSE..EEE
                   *->DWiaykd.vdfgsggaysftarvAngggggggsi<-*
                      D+i+y+++ d +++ga++f + v+ g+++  +s+
  gi|7818626  1234    DAIKYNNtSDTPTAGARTFQVTVSDGTAT--SSV    1265

YaeQ: domain 1 of 2, from 1251 to 1276: score 8.9, E = 0.019
                   *->qLqvTIqDGqvwlsdddgsvevtpev<-*
                      ++qvT++DG+++ s+   s++v pe
  gi|7818626  1251    TFQVTVSDGTATSSVATKSITVVPEN    1276

PKD: domain 7 of 10, from 1253 to 1272: score 4.1, E = 1
                CS    EEEEEETTCEEEEEEEEEEE
                   *->tLtvsngvgsasattttvtV<-*
                      ++tvs+g  ++s+ t+++tV
  gi|7818626  1253    QVTVSDGTATSSVATKSITV    1272

FG-GAP: domain 1 of 3, from 1312 to 1328: score 2.1, E = 13
                CS    CCSCEEEC -TTSSSSS
                   *->fgssvaag.DlnGDGrp<-*
                      ++s+ a+++Dl+GD ++
  gi|7818626  1312    GVSGTAVVtDLDGDSLA    1328

DUF74: domain 1 of 1, from 1313 to 1321: score 3.7, E = 1.4
                   *->AYGTAVvve<-*
                      ++GTAVv+
  gi|7818626  1313    VSGTAVVTD    1321

FAD_binding_1: domain 1 of 1, from 1345 to 1360: score 0.8, E = 5.8
                CS    S-CTTEEEE-HHHHHH
                   *->dwdgeGrirkGvaSny<-*
                      ++ + G+++ G +Sny
  gi|7818626  1345    EEFVLGGLHIGLVSNY    1360

PKD: domain 8 of 10, from 1374 to 1405: score 2.7, E = 2.8
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEEE
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysWd<-*
                      ++++       v+a+ +tV+Ft+  S + +  ++v+y+ d
  gi|7818626  1374    ITTT-------VGATETTVVFTDAESATLT-KADVAYLLD    1405

Flagellin_IN: domain 6 of 9, from 1422 to 1439: score 1.9, E = 11
                   *->tltinggggkensvadgvdislsagdslaalada<-*
                      +++                i++s+g++++ +a++
  gi|7818626  1422    NFN----------------ITVSDGTDVSSVATK    1439

DUF1750: domain 1 of 1, from 1466 to 1485: score -2.2, E = 8.3
                   *->GaDqaSdneglhhhdaddms<-*
                      GaD  S    l+ ++ ++ s
  gi|7818626  1466    GADTTSNDVSLGTAGQTEIS    1485

BHD_3: domain 1 of 1, from 1562 to 1575: score 1.4, E = 9.6
                   *->VVaeefeeallaaw<-*
                      VV +  +eall+a+
  gi|7818626  1562    VVTKAEAEALLDAI    1575

DUF357: domain 2 of 3, from 1568 to 1582: score 3.3, E = 4.2
                   *->AhGwLDAGvrLGvfd<-*
                      A+++LDA ++   +d
  gi|7818626  1568    AEALLDAIKYNNTLD    1582

RtxA: domain 1 of 4, from 1587 to 1605: score 0.3, E = 71
                   *->GaGgaNvitkvGdggdlaf<-*
                      Ga + Nv ++ G++ ++a+
  gi|7818626  1587    GARVFNVTVSDGTESSTAV    1605

PKD: domain 9 of 10, from 1593 to 1611: score 7.3, E = 0.1
                CS    EEEEETTCEEEEEEEEEEE
                   *->LtvsngvgsasattttvtV<-*
                      +tvs+g  s++a t+t+tV
  gi|7818626  1593    VTVSDGTESSTAVTKTITV    1611

PRK: domain 1 of 1, from 1608 to 1618: score -0.1, E = 9.4
                CS    EEEEEESS--S
                   *->iiqrvPtvdts<-*
                      +i +vPt+dt+
  gi|7818626  1608    TITVVPTNDTP    1618

DUF1565: domain 1 of 1, from 1637 to 1650: score -1.0, E = 9.5
                   *->vsGnDssnpGTnksa<-*
                      v+GnD++++ T  ++
  gi|7818626  1637    VAGNDVAFGTT-DQT    1650

Big_2: domain 1 of 3, from 1661 to 1686: score 5.1, E = 0.83
                CS    EEEEEEETTT.TEEES--SEEETTSEEE
                   *->avtsvtvsptgntaslakGatlqlkatv<-*
                         + tv+ +  +++ + Ga++q+++ +
  gi|7818626  1661    GIANLTVTFA--NTTIKDGASEQFTVGG    1686

DUF2407: domain 2 of 2, from 1665 to 1676: score 0.3, E = 4.8
                   *->iVIRFSatSSaveniPD<-*
                      +++ F++t+     i+D
  gi|7818626  1665    LTVTFANTT-----IKD    1676

Drmip_Hesp: domain 1 of 1, from 1679 to 1687: score 2.3, E = 4
                   *->SeqFnVtgs<-*
                      SeqF+V gs
  gi|7818626  1679    SEQFTVGGS    1687

MucBP: domain 1 of 2, from 1681 to 1717: score 3.1, E = 4.2
                   *->ktkvagitVv.gq.vTptlkdtlpvnvtYtfngtiqtV<-*
                      + +v+g ++  + ++T+ l +t    ++Yt++ t+ t
  gi|7818626  1681    QFTVGGSEIAlNAsGTTSLSNT-IDGINYTATVTTGTT    1717

SipA: domain 1 of 1, from 1695 to 1707: score 2.9, E = 0.77
                   *->vvdsvvktvdgLh<-*
                      +++s++ t+dg++
  gi|7818626  1695    GTTSLSNTIDGIN    1707

Redoxin: domain 1 of 1, from 1720 to 1743: score 4.3, E = 1.2
                CS    EEEEE-SS--TT-STTSHHHHH.HHH
                   *->tylevepgplgkvdvsdaeavLeaaL<-*
                      t +++ +g+ g+v+ ++aea+L +aL
  gi|7818626  1720    TVVFTKEGG-GEVTTANAEALL-DAL    1743

TatD_DNase: domain 1 of 1, from 1730 to 1741: score -0.4, E = 8.7
                CS    HHHHHHHHHHHH
                   *->kitteNakrlFg<-*
                      ++tt+Na++l++
  gi|7818626  1730    EVTTANAEALLD    1741

Complex1_24kDa: domain 1 of 1, from 1731 to 1744: score 1.0, E = 8.2
                   *->LTpekieeLLdrlk<-*
                      +T +  e+LLd+lk
  gi|7818626  1731    VTTANAEALLDALK    1744

DUF357: domain 3 of 3, from 1736 to 1750: score 1.0, E = 18
                   *->AhGwLDAGvrLGvfd<-*
                      A+++LDA+++    d
  gi|7818626  1736    AEALLDALKYNNASD    1750

Hexapep: domain 1 of 1, from 1811 to 1821: score 3.9, E = 6.5
                CS    EEEETTEEEET
                   *->vvIgpgvvIgd<-*
                      v+I p+v+I+d
  gi|7818626  1811    VTISPNVTIAD    1821

Parvo_NS1: domain 1 of 1, from 1823 to 1838: score -0.2, E = 7
                   *->ndhisqwsvrvthefp<-*
                      +d+i++ svr+t++f+
  gi|7818626  1823    DDAIISASVRITNPFD    1838

DUF1759: domain 1 of 1, from 1837 to 1846: score 0.1, E = 8
                   *->FdGdvlkyys<-*
                      FdGd+l + s
  gi|7818626  1837    FDGDILGFTS    1846

Avidin: domain 1 of 2, from 1838 to 1856: score 0.9, E = 9.6
                CS    TS-EEEE----TTSEEEEEE
                   *->lGStltItavNStGelTGTY<-*
                      +G++l  t+ +S G +TGTY
  gi|7818626  1838    DGDILGFTS-TSSGKITGTY    1856

Flagellin_D3: domain 1 of 3, from 1855 to 1877: score 0.0, E = 32
                CS    E-TT...T-BEEESTT-S--TTSS-TT-
                   *->tVddPTPadGkVtlaagattttaatPag<-*
                      t+++   ++G+++l+a  ++  ++ +a+
  gi|7818626  1855    TYNS---TTGTLSLVA--AAGQTPSTAD    1877

YaeQ: domain 2 of 2, from 1903 to 1925: score 2.8, E = 1.4
                   *->vTIqDGqvwlsdddgsvevtpev<-*
                      +TI+DG+++  +  ++v+vt +
  gi|7818626  1903    CTITDGDAFSLVATETVTVTSTN    1925

SLT_beta: domain 5 of 5, from 1974 to 2001: score 2.0, E = 4.8
                CS    X--EEEEEEEEEEEE-TTS  -EEEEETT
                   *->AapDCvkGKvEysKYneDD..tFtvKvdd<-*
                      A+ D   GK+ ++  n  D++  tvKv d
  gi|7818626  1974    AT-DATNGKITFTVANVVDggNITVKVTD    2001

Flagellin_IN: domain 7 of 9, from 1981 to 2012: score 1.0, E = 20
                   *->tltinggggkensvadgvdislsagdslaa.ladaIN<-*
                      ++t+++++     v+dg +i+++ +d+ ++++a+ +N
  gi|7818626  1981    KITFTVAN-----VVDGGNITVKVTDTGSEgAATSVN    2012

Myosin_N: domain 1 of 2, from 1991 to 2005: score 1.6, E = 18
                CS    CTTEEEEEETTT.TEE
                   *->kGdkVtVktedtSGkt<-*
                      +G+++tVk+ dt G++
  gi|7818626  1991    DGGNITVKVTDT-GSE    2005

Phage_fiber_2: domain 1 of 1, from 2025 to 2068: score 2.7, E = 3.3
                   *->tlkqkGivqLssatdstsEtlAatp.KAvKaayDkanekktkdee<-
                           G +qL++ +  ++ t A t+++ vK+a D+++      ++
  gi|7818626  2025    -FDTDGTTQLAAYATFADATAAGTAgQVVKIATDNTVSTFVLPDS   2068

                   *

  gi|7818626     -   -

C2-set: domain 1 of 1, from 2085 to 2107: score 1.6, E = 9.8
                CS    EEEETTTCTEEEEECCSESEEETT
                   *->vtvtcsvpnlLtcevLelTLekGp<-*
                      +t + +  n+Lt+ +L+ TL +G+
  gi|7818626  2085    ITGNDGD-NTLTGTSLNDTLSGGD    2107

HemolysinCabind: domain 1 of 31, from 2086 to 2103: score 13.0, E = 0.0091
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G++G++tL+G++ nDtl
  gi|7818626  2086    TGNDGDNTLTGTSLNDTL    2103

HemolysinCabind: domain 2 of 31, from 2104 to 2121: score 21.7, E = 2e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GG+G+D+L  g+GnDtl
  gi|7818626  2104    SGGDGDDSLVAGSGNDTL    2121

HemolysinCabind: domain 3 of 31, from 2122 to 2139: score 21.6, E = 2.2e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GGaG DtL+ g GnD+l
  gi|7818626  2122    SGGAGADTLDAGLGNDVL    2139

HemolysinCabind: domain 4 of 31, from 2140 to 2157: score 17.3, E = 0.00045
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       GG G D+L Gg+G+D++
  gi|7818626  2140    AGGTGADSLLGGDGDDVF    2157

HemolysinCabind: domain 5 of 31, from 2176 to 2187: score 10.6, E = 0.047
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D+++GgaG Dt+
  gi|7818626  2176    DSISGGAGTDTI    2187

Gly_reductase: domain 1 of 1, from 2252 to 2275: score 2.8, E = 0.45
                   *->MkLelGnifIkDvkFGektkvedgv<-*
                        L+ G i+I   +FG+ +++++g+
  gi|7818626  2252    -SLTQGTINITGYEFGDNSEFNGGT    2275

DFF-C: domain 1 of 1, from 2435 to 2441: score 1.2, E = 6.7
                CS    XXXXXXX
                   *->DGGTAWl<-*
                      DGGTA +
  gi|7818626  2435    DGGTAYM    2441

XylR_N: domain 1 of 1, from 2447 to 2472: score 1.5, E = 8.3
                   *->GPqLHaLEGmVkVeplrfd.LNiDie<-*
                      G++ ++L+G  +V+   ++ LN D +
  gi|7818626  2447    GGRAFTLTGDFRVTGTYLEvLNLDPA    2472

QLQ: domain 1 of 1, from 2490 to 2502: score 3.6, E = 4.4
                   *->spFTpaQlqeLka<-*
                      +++Tp+Q++ Lk+
  gi|7818626  2490    AALTPTQIATLKS    2502

MucBP: domain 2 of 2, from 2564 to 2598: score 2.0, E = 8.3
                   *->kGYadktkvag.itVvgqvTptlkdtlpvnvtYtfngtiqtV<-*
                      +GYa  t+va ++t        +++t   + tYt +g+i+
  gi|7818626  2564    TGYALATNVAKsVTL------ADVNT-SNTTTYTISGQIIDG    2598

HemolysinCabind: domain 6 of 31, from 2597 to 2609: score 6.8, E = 0.7
                CS    E--SSS-EEEEES
                   *->yGGaGnDtLyGga<-*
                      +G aGnD+++G++
  gi|7818626  2597    DGLAGNDRISGTS    2609

HemolysinCabind: domain 7 of 31, from 2620 to 2631: score 5.6, E = 1.6
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D L Gg+G D l
  gi|7818626  2620    DYLIGGEGHDYL    2631

HemolysinCabind: domain 8 of 31, from 2633 to 2648: score 7.7, E = 0.37
                CS    -SSS-EEEEESSCGEE
                   *->GaGnDtLyGgaGnDtl<-*
                      G+G D L G+aG+D++
  gi|7818626  2633    GGGTDLLQGDAGDDIY    2648

Transposase_34: domain 1 of 1, from 2643 to 2656: score 1.6, E = 8
                   *->agvkIwLatgptDM<-*
                      ag+ I+++tg  D+
  gi|7818626  2643    AGDDIYIVTGANDF    2656

SH3_5: domain 1 of 1, from 2667 to 2693: score 4.6, E = 2.8
                CS    EEEEEEEEE..EESC-EEEESSSS-TTS
                   *->sykpesGtykftkttpIvlRknaPslsa<-*
                      ++ +  Gty+ t + +I lR+++++++a
  gi|7818626  2667    EVRTSLGTYTLTDDVDI-LRYTGTTVNA    2693

HemolysinCabind: domain 9 of 31, from 2707 to 2724: score 25.0, E = 2.1e-06
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      yGGa nDtL+GgaG+D+l
  gi|7818626  2707    YGGAYNDTLTGGAGDDVL    2724

HemolysinCabind: domain 10 of 31, from 2725 to 2742: score 24.4, E = 3.2e-06
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +GGaG DtL+Gg GnDt+
  gi|7818626  2725    WGGAGADTLSGGIGNDTI    2742

HemolysinCabind: domain 11 of 31, from 2775 to 2786: score 4.5, E = 3.3
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D+ +GgaG Dtl
  gi|7818626  2775    DSVDGGAGIDTL    2786

UPF0565: domain 1 of 1, from 2808 to 2817: score -0.8, E = 9.3
                   *->clsvhsvpGy<-*
                      +++v+++pGy
  gi|7818626  2808    VFKVVNIPGY    2817

Pox_G7: domain 1 of 1, from 2809 to 2817: score -0.1, E = 4.8
                   *->FKiITVPgl<-*
                      FK++++Pg
  gi|7818626  2809    FKVVNIPGY    2817

FmdA_AmdA: domain 1 of 1, from 2816 to 2850: score 0.1, E = 5.7
                CS    HHHHHH-EEEEEESSSSS..........EEEEEEEEG.GGT---
                   *->GYareqaylllSvapveghlSGiVDiPNatatariPKtdIfeed<-*
                      GY++++++l +S + +           N+ +t  +P + ++ ++
  gi|7818626  2816    GYTSYALDLDASALSDDS--------DNFAVTFNTP-GSVVSGV    2850

HemolysinCabind: domain 12 of 31, from 2882 to 2899: score 8.8, E = 0.17
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G a  D++ Gg+G+D l
  gi|7818626  2882    KGSAYSDVILGGEGADGL    2899

HemolysinCabind: domain 13 of 31, from 2900 to 2917: score 19.9, E = 7.1e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      yG +GnD ++G +GnD++
  gi|7818626  2900    YGQGGNDYIFGEGGNDQI    2917

HemolysinCabind: domain 14 of 31, from 2918 to 2934: score 15.9, E = 0.0012
                CS    E--SSS-EEEEESSCGE
                   *->yGGaGnDtLyGgaGnDt<-*
                      +GGaG+D++ Gg G+D+
  gi|7818626  2918    FGGAGDDVIVGGTGDDR    2934

G6PD_N: domain 1 of 1, from 2925 to 2932: score 0.2, E = 5.3
                CS    EETTTSHH
                   *->VIFGAsGD<-*
                      VI G++GD
  gi|7818626  2925    VIVGGTGD    2932

HemolysinCabind: domain 15 of 31, from 2936 to 2953: score 13.9, E = 0.0047
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+ G D+  GgaGnD +
  gi|7818626  2936    FGDLGSDIFIGGAGNDYF    2953

SBP56: domain 1 of 1, from 2937 to 2945: score -1.1, E = 8.3
                   *->GDCtSDIWi<-*
                      GD  SDI+i
  gi|7818626  2937    GDLGSDIFI    2945

YopE: domain 1 of 1, from 2955 to 2965: score 2.7, E = 5.6
                   *->GGaaselVasA<-*
                      G++ase+V+s
  gi|7818626  2955    GSKASEYVDSS    2965

Fil_haemagg: domain 1 of 5, from 2983 to 3031: score 3.6, E = 2.6
                CS    EEESSEEEETTTT--EE-SEEEEEE-STT-EEEE-S-EE ESSE...
                   *->vaaGaltlnaaalggldlnnggtlsagggltltaaglln.nggtlia
                       ++G+ + +a+        ++ t+ ++++ t t  g+     g+
  gi|7818626  2983    YLSGDARFEAT--------ASVTVTSNADGTDTYEGVEVvSKGG--- 3018

                CS ................EEEEESS-EEEEE
                   ggdlllaagalrnggdltltaaGdLdnsg<-*
                                   ++  ++G++++sg
  gi|7818626  3019 ----------------AVTVSSGAVTVSG    3031

Chlam_PMP: domain 1 of 1, from 2995 to 3023: score 4.1, E = 8.2
                   *->ditFsgNsa..........aggGGAiyas<-*
                      ++t ++N+ ++++ ++ +  ++GGA+  s
  gi|7818626  2995    SVTVTSNADgtdtyegvevVSKGGAVTVS    3023

DUF1034: domain 1 of 1, from 2996 to 3029: score 6.1, E = 0.43
                   *->RtlTdvvdeketylihaktlkgasltvspwvtVngeaskiTv<-*
                      +t+T+ +d+++ty+  +++ kg ++tvs          ++Tv
  gi|7818626  2996    VTVTSNADGTDTYEGVEVVSKGGAVTVSS--------GAVTV    3029

HIM: domain 1 of 2, from 3018 to 3035: score 2.1, E = 17
                CS    EEEEEE--S...-EETT-T
                   *->qqItNVasGeitvtktDAv<-*
                      +++t V sG++tv  ++Av
  gi|7818626  3018    GAVT-VSSGAVTVSGGTAV    3035

DUF2523: domain 1 of 1, from 3041 to 3069: score 3.3, E = 4.4
                   *->grvLtaLGlglvtytGldalvdgalsyfq<-*
                      +r+++++G +l ty+++da++++a s+++
  gi|7818626  3041    FRLIASTGELLSTYSSFDAALAAARSAAA    3069

DUF2134: domain 1 of 1, from 3062 to 3142: score 3.9, E = 1.3
                   *->AAAqrlsdgsaaaanssaaaaaaAaaaaarngf............gg
                      AAA++++++++     + + a a  aa+ ++g +++  ++ +  ++g
  gi|7818626  3062    AAARSAAATNT-----GLTIAVADGAAVVLDGSgeglvsgltiigSG 3103

                   gdlalslsvecGywnat.daaadspprftagaaagpvnAVrVtat<-*
                   +d   ++++ +G +++++++ ++++ rf + +   +v AV+V+a+
  gi|7818626  3104 TD---DAATFTGALTIDqSNVTLQGVRFETVG---DVAAVTVSAS    3142

DUF920: domain 1 of 1, from 3068 to 3089: score 1.3, E = 6.2
                   *->StddagrWVsIedgravplVgs<-*
                      +++++g  ++++dg av+l gs
  gi|7818626  3068    AATNTGLTIAVADGAAVVLDGS    3089

Peptidase_S6: domain 1 of 1, from 3104 to 3133: score -0.1, E = 4.5
                   *->nnNaaLvigsaFtgGiaagdgnvsvtlkahslftlsgs<-*
                      ++ aa      Ftg ++  ++n  vtl + + f ++g+
  gi|7818626  3104    TDDAA-----TFTGALTIDQSN--VTL-QGVRFETVGD    3133

ThiS: domain 1 of 1, from 3121 to 3149: score 0.0, E = 9.2
                CS    EEETTECCHHHT SCEEEEESSTSBHHHH
                   *->vllfaelrelag.eeeeielpegaTvaeL<-*
                      v+l +   e +g++  +++ ++gaT+a++
  gi|7818626  3121    VTLQGVRFETVGdVAAVTVSASGATIADV    3149

DUF427: domain 1 of 1, from 3137 to 3148: score 2.4, E = 4.1
                   *->VrVrvgGeviAd<-*
                      V+V   G +iAd
  gi|7818626  3137    VTVSASGATIAD    3148

CAP160: domain 1 of 2, from 3139 to 3165: score 3.3, E = 6.9
                   *->lssatavvadkavaAknvvaskLGygg<-*
                      +s+  a +ad     +nv +s++G +
  gi|7818626  3139    VSASGATIADVSFTGTNVATSSVGVAV    3165

Phage_attach: domain 1 of 1, from 3176 to 3189: score 2.3, E = 0.61
                   *->MadfdNLFDeAisrAD<-*
                       +df NL D+Ai+ AD
  gi|7818626  3176    -SDFTNL-DTAIALAD    3189

CAP160: domain 2 of 2, from 3229 to 3248: score 0.5, E = 42
                   *->lssatavvadkavaAknvvas<-*
                       s+ ta++ dka    n+ as
  gi|7818626  3229    -SNDTALLLDKASTDYNAAAS    3248

CBM_15: domain 1 of 1, from 3340 to 3347: score 3.3, E = 0.64
                CS    EE--SSSS
                   *->lelDMasG<-*
                      l+lDM+sG
  gi|7818626  3340    LTLDMTSG    3347

HemolysinCabind: domain 16 of 31, from 3383 to 3400: score 5.8, E = 1.4
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G+a  D+++G a +++l
  gi|7818626  3383    TGTAQGDSITGSADANVL    3400

DUF1522: domain 1 of 3, from 3390 to 3397: score 1.7, E = 5.8
                   *->sItGtgdl<-*
                      sItG +d+
  gi|7818626  3390    SITGSADA    3397

HemolysinCabind: domain 17 of 31, from 3401 to 3418: score 20.7, E = 4.1e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G +G D+L+GgaGnDt+
  gi|7818626  3401    SGLEGMDVLSGGAGNDTI    3418

HemolysinCabind: domain 18 of 31, from 3419 to 3436: score 22.4, E = 1.3e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      yGGa +D +yGg+GnD+l
  gi|7818626  3419    YGGADDDLIYGGDGNDIL    3436

HemolysinCabind: domain 19 of 31, from 3447 to 3464: score 20.8, E = 3.8e-05
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                        G G+D+LyGgaG+Dt+
  gi|7818626  3447    VQGVGDDVLYGGAGDDTY    3464

Tautomerase: domain 1 of 1, from 3468 to 3484: score 2.9, E = 6.6
                CS    EEGGGGEECTTEEHHHT
                   *->EvpeenwgvgGeslgdr<-*
                      Ev+++n++vgG +  ++
  gi|7818626  3468    EVADQNYFVGGDGEDTA    3484

DUF1522: domain 2 of 3, from 3585 to 3595: score 3.6, E = 1.6
                   *->ADLsItGtgdl<-*
                      +DL I+G +d+
  gi|7818626  3585    SDLAISGLADA    3595

Fe_hyd_lg_C: domain 1 of 1, from 3620 to 3625: score -1.8, E = 8.6
                CS    GTTTS-
                   *->gGGGQP<-*
                      +GGG+P
  gi|7818626  3620    NGGGSP    3625

HemolysinCabind: domain 20 of 31, from 3635 to 3652: score 11.9, E = 0.019
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G    Dt+ Gg+G+D+
  gi|7818626  3635    LGSLKADTIIGGDGADVV    3652

HemolysinCabind: domain 21 of 31, from 3653 to 3670: score 19.1, E = 0.00012
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G aG+D ++Gg G Dtl
  gi|7818626  3653    FGLAGDDKITGGLGVDTL    3670

EF_assoc_2: domain 1 of 1, from 3792 to 3824: score 3.2, E = 3.3
                   *->nkpLdpsdlediksvvqeYaklPdgttvnekGlTldG<-*
                      +++L+ + + ++ +vv    +  dg  + e+ ++ +G
  gi|7818626  3792    DTTLTATNVVGVEAVVLD--TWTDG--SEENRIDAAG    3824

PilM: domain 1 of 1, from 3822 to 3834: score 4.1, E = 1.9
                   *->PaavPegAiVlin<-*
                      +a++++ AiV++
  gi|7818626  3822    AAGITTDAIVYVR    3834

GumN: domain 1 of 1, from 3848 to 3859: score 1.6, E = 4.3
                   *->eGvldlLRarGy<-*
                      ++++++ Ra Gy
  gi|7818626  3848    DNLVADIRADGY    3859

Gp5_C: domain 4 of 7, from 3954 to 3978: score 3.1, E = 8
                CS    S-EEEEESS-EEEEES SEEEEEES
                   *->GnesltVkGnrtvtVg.GnqTtsVg<-*
                      G +s+t k+ + +++ +G++Tt+V
  gi|7818626  3954    GTLSVTTKNYADIDILtGTNTTTVT    3978

CsgG: domain 1 of 1, from 3986 to 4001: score 0.8, E = 7.4
                   *->nkavnlivsgvaksan<-*
                      + a+ l++++va+++n
  gi|7818626  3986    VDATELLDDKVAGQYN    4001

SEA: domain 1 of 1, from 3993 to 4035: score 1.5, E = 8.8
                   *->ngsvvvdfdviFr.ptteesavdkteiseeleaalrsqsgnlkidss
                      ++ v  ++++i++++++    v++te++ + +a+l+s++  +++ ++
  gi|7818626  3993    DDKVAGQYNLILKgSSS----VTVTELQGDVNASLSSGAMDITTATT 4035

                   <-*

  gi|7818626     -     -

RtxA: domain 2 of 4, from 3996 to 4012: score 0.3, E = 69
                   *->GaGgaNvitkvGdggdlaf<-*
                       aG++N i k +   ++++
  gi|7818626  3996    VAGQYNLILKGS--SSVTV    4012

Ribosomal_S11: domain 1 of 1, from 4010 to 4032: score 0.3, E = 8.7
                   *->iTiTDvkGrvvlwsSAGscGfKg<-*
                      +T+T ++G v ++ S+G++ +++
  gi|7818626  4010    VTVTELQGDVNASLSSGAMDITT    4032

CGGC: domain 1 of 2, from 4043 to 4051: score 1.5, E = 3.1
                   *->eikVVeGTH<-*
                      +++++ GTH
  gi|7818626  4043    NVDIITGTH    4051

PAAR_motif: domain 1 of 5, from 4046 to 4057: score 1.0, E = 36
                   *->iieGspnvkvnG<-*
                      ii+G +++k+ G
  gi|7818626  4046    IITGTHDTKITG    4057

FTP: domain 1 of 1, from 4098 to 4116: score 2.7, E = 6.9
                   *->liVhvskdGkvksvsGdfs<-*
                      ++V +++dG   +++G+++
  gi|7818626  4098    VTVDADGDGSGAALQGTLV    4116

PDE8: domain 1 of 1, from 4106 to 4124: score 2.7, E = 3.6
                   *->GtAAaLhG.LFvktDAAea<-*
                      G+ AaL+G+L + tDAA
  gi|7818626  4106    GSGAALQGtLVIDTDAAAK    4124

DUF592: domain 1 of 1, from 4123 to 4130: score 0.0, E = 4.7
                   *->AkKILVLT<-*
                      Ak +LVLT
  gi|7818626  4123    AKDVLVLT    4130

RtxA: domain 3 of 4, from 4131 to 4149: score 1.5, E = 31
                   *->GaGgaNvitkvGdggdlaf<-*
                      G +++ + t+++ gg++++
  gi|7818626  4131    GVAATTINTQSSLGGTVTV    4149

Halo_GVPC: domain 1 of 2, from 4170 to 4179: score 1.4, E = 31
                   *->VsaLlaaIae<-*
                      V++L+ +I++
  gi|7818626  4170    VNDLVGDIDA    4179

DUF1112: domain 1 of 1, from 4185 to 4198: score 1.0, E = 5.1
                   *->gtaMTvddvVtKTg<-*
                      +t MT +d ++KT+
  gi|7818626  4185    TTGMTAGDLIVKTA    4198

DUF811: domain 1 of 1, from 4234 to 4245: score 0.9, E = 5.4
                   *->iflrdVDFrivG<-*
                      + +rd+D++i G
  gi|7818626  4234    MMARDTDMYIGG    4245

Haemagg_act: domain 1 of 2, from 4272 to 4286: score 1.2, E = 7.6
                CS    EEEEEE-SEEEEETT
                   *->gglfvtTgaisikff<-*
                      g+l+vtTga+++  +
  gi|7818626  4272    GSLTVTTGALTNGGG    4286

CbbQ_C: domain 1 of 1, from 4300 to 4313: score 1.7, E = 8.4
                   *->EaeIVakESGvdaet<-*
                       +++Va+ESG da t
  gi|7818626  4300    -TTVVANESGTDATT    4313

Flagellin_D3: domain 2 of 3, from 4312 to 4344: score 6.6, E = 0.55
                CS    EEEEE.-BG.GGSTTT-GGG..-SSEEEE-SSEEE-TTT-
                   *->atldlTaldldaaiktgvgGagttgtaaikDGkvyfddtd<-*
                      +t+dl  +d ++a+++ + +  + gta i+   v + +t+
  gi|7818626  4312    TTTDL-VID-ATALTANTLT--LRGTAEIE---VDHVSTN    4344

HpaB: domain 1 of 1, from 4402 to 4415: score 1.2, E = 3.6
                CS    HHHHHHHHHHHHHH
                   *->kNAvvmttgagdef<-*
                      +NAvv++++a++e+
  gi|7818626  4402    INAVVSGAKADAEL    4415

FG-GAP: domain 2 of 3, from 4419 to 4431: score 2.6, E = 9.1
                CS    CCSCEEEC-TTSS
                   *->fgssvaagDlnGD<-*
                      ++ +v++ DlnGD
  gi|7818626  4419    GTGTVRVNDLNGD    4431

SLH: domain 1 of 1, from 4448 to 4480: score 4.6, E = 2
                   *->sFsDvpkthWakdaInaLvklGiikGypdgtFrPdk<-*
                      + sD+++t+  +d+   L++l+i++G +d++  +++
  gi|7818626  4448    NVSDLSGTGDGADS---LAALEIVTGSTDTNITGND    4480

DUF490: domain 1 of 1, from 4492 to 4565: score 4.4, E = 0.51
                   *->ldglsatglgggGtltasGtldl...aadlpadLtikgvadnlrlid
                      +dg +  g + g +l++sGt+ +  +++  +  Lt+    d   l+d
  gi|7818626  4492    VDGSALAG-QAGERLKLSGTAEYvveNNTDNQKLTL----DVYDLLD 4533

                   ppllratvsGdltltgtppsllkgltlsGdvtv<-*
                    ++++++  Gd +ltgt  +  ++ +l+Gd+tv
  gi|7818626  4534 NNEVTLQGVGDFELTGT-SADVDASDLTGDITV    4565

CRAM_rpt: domain 1 of 1, from 4542 to 4564: score 2.4, E = 2.2
                   *->eaDDCnitGDCnEtDDCditGDCn<-*
                         D  +tG   + D  d+tGD
  gi|7818626  4542    -VGDFELTGTSADVDASDLTGDIT    4564

Flavodoxin_NdrI: domain 1 of 1, from 4542 to 4554: score 2.9, E = 2.7
                CS    EEEEETT--HHHH
                   *->LykFELlGTneDV<-*
                      + +FEL GT++DV
  gi|7818626  4542    VGDFELTGTSADV    4554

Bul1_N: domain 1 of 1, from 4550 to 4563: score 1.6, E = 1.6
                   *->tneDihgtDlSGti<-*
                      t++D+++ Dl+G+i
  gi|7818626  4550    TSADVDASDLTGDI    4563

DnaD: domain 1 of 1, from 4584 to 4594: score 2.3, E = 8.4
                   *->nGikTledVea<-*
                      +Gi+T+++Ve
  gi|7818626  4584    SGITTVDAVES    4594

G-gamma: domain 1 of 1, from 4656 to 4667: score 4.0, E = 2.2
                   *->tGpppskNPFie<-*
                      +G+++s+NP i+
  gi|7818626  4656    VGVDASENPYID    4667

Rep_trans: domain 1 of 1, from 4709 to 4737: score 3.1, E = 1.9
                   *->dltdlikdtlregekalqkklnlapdsyk<-*
                      d t +++d+++eg+k + + l+ a+d+y
  gi|7818626  4709    DATSFLVDLVNEGAKIDARGLDGALDVYT    4737

DUF1522: domain 3 of 3, from 4820 to 4829: score 0.4, E = 13
                   *->LsIt.Gtgdl<-*
                      L+It+Gtg++
  gi|7818626  4820    LTITtGTGNM    4829

PAAR_motif: domain 2 of 5, from 4822 to 4833: score 0.7, E = 46
                   *->iieGspnvkvnG<-*
                      i++G +n +vnG
  gi|7818626  4822    ITTGTGNMTVNG    4833

PKD: domain 10 of 10, from 4823 to 4848: score 0.2, E = 15
                CS    S....SEEEEEEEEEEETTCEEEEEEEEEEE
                   *->kgsVtpGtYtVtLtvsngvgsasattttvtV<-*
                      +    +Gt + t++  +++ s++   + +tV
  gi|7818626  4823    T----TGTGNMTVNGDDSNDSDTGI-LDITV    4848

NIF3: domain 1 of 1, from 4853 to 4871: score 2.6, E = 2.3
                   *->ieeAaaegvDafITGeish<-*
                      i++A + +vD+++TG+ ++
  gi|7818626  4853    IADASTTEVDLYLTGDAEY    4871

DUF2021: domain 1 of 1, from 4935 to 4946: score 0.6, E = 9.8
                   *->GLsevskiitvt<-*
                      G + v+ iitvt
  gi|7818626  4935    GGTAVANIITVT    4946

RtxA: domain 4 of 4, from 4936 to 4944: score 1.2, E = 36
                   *->GaGgaNvit<-*
                      G ++aN+it
  gi|7818626  4936    GTAVANIIT    4944

Flagellin_IN: domain 8 of 9, from 4940 to 4958: score 2.1, E = 10
                   *->Asvdadtng.grLvltstt<-*
                      A++ ++t g+g+L++++t+
  gi|7818626  4940    ANIITVTAGsGQLGVKATD    4958

Big_4: domain 2 of 2, from 4986 to 5006: score 3.1, E = 5.9
                   *->tWdavdvdqyakaGtfeVtGtVeGt<-*
                      tW+  +++   +aGt+ V+G ++++
  gi|7818626  4986    TWE-LTAE---GAGTVVVNGLAADL    5006

PhageMaj_Tail: domain 1 of 3, from 4986 to 4999: score 6.2, E = 0.49
                   *->tyelsLeSaGaLtf<-*
                      t+el+ e+aG ++
  gi|7818626  4986    TWELTAEGAGTVVV    4999

PAAR_motif: domain 3 of 5, from 4990 to 5004: score 2.7, E = 12
                   *->iieGspnvkvnGkPA<-*
                       +eG ++v vnG++A
  gi|7818626  4990    TAEGAGTVVVNGLAA    5004

PPC: domain 1 of 2, from 5012 to 5073: score 1.3, E = 12
                CS    TCEEEEEEECTSSS...S...CCEEEEE EECCCSESSSSTTCE-..
                   *->ggtlsisldggsslrslsgnGdadtlLy.wlldgdpslsaydaystT
                      gg+l++sl++ +          ad   + wl dgd s+ + d ++
  gi|7818626  5012    GGELTVSLGDVT---------PAD--VDiWLNDGD-STINTDSSG-- 5044

                CS ...ECCTTEEEEE   ECC.-SEE EEEEEEE
                   rdvdnggsdelis...ftapeaGt.YyirVyg<-*
                       + + ++l++++ +t++eaG  Y +  ++
  gi|7818626  5045 ---VTLNASQLGTddvVTLTEAGAvYLFNADA    5073

Vps26: domain 1 of 1, from 5023 to 5036: score -1.1, E = 9
                   *->FGppidIeIkldneee<-*
                        +p+d++I l+++++
  gi|7818626  5023    --TPADVDIWLNDGDS    5036

FG-GAP: domain 3 of 3, from 5053 to 5069: score 5.0, E = 1.8
                CS    SSSEEEEEETCCCSCC TSEEEEE
                   *->GrpDlvvgaPgadggt.dgsvyll<-*
                      G +D+v+        t++g+vyl+
  gi|7818626  5053    GTDDVVT-------LTeAGAVYLF    5069

DNA_gyraseA_C: domain 1 of 1, from 5054 to 5072: score 4.6, E = 3
                CS    TCEEEEEETTSEEEEEEGG
                   *->eddlllvTsnGyvkRtpls<-*
                      +dd++++T++G v+ ++++
  gi|7818626  5054    TDDVVTLTEAGAVYLFNAD    5072

FabA: domain 1 of 1, from 5070 to 5086: score 1.3, E = 9.3
                   *->iadgralVDGklvyeAe<-*
                      +ad+ ++VD k+v++++
  gi|7818626  5070    NADAGMKVDAKTVVSGQ    5086

PEP-utilizers: domain 2 of 5, from 5093 to 5114: score 0.2, E = 25
                CS    EEEETTEEESTTEEEEE.CTSEE
                   *->vleiateklkdGdiitvCDGstG<-*
                      +l++at +l +G+ + v D  ++
  gi|7818626  5093    LLTVATAALSTGEKVFV-DTGSN    5114

PAAR_motif: domain 4 of 5, from 5139 to 5151: score 3.9, E = 5.2
                   *->iieGspnvkvnGk<-*
                      ii+Gs+ v+v G+
  gi|7818626  5139    IIQGSSVVTVTGL    5151

Gp5_C: domain 5 of 7, from 5202 to 5226: score 5.9, E = 1.1
                CS    S-EEEEES S-EEEEESSEEEEEES
                   *->GnesltVk.GnrtvtVgGnqTtsVg<-*
                      +++s +Vk++++ +tV+G  + +++
  gi|7818626  5202    ASMSRSVKdADADITVDGSAKFTLS    5226

Myosin_N: domain 2 of 2, from 5245 to 5260: score 1.6, E = 17
                CS    EECTTEEEEEETTT.TEE
                   *->srkGdkVtVktedtSGkt<-*
                      s++++k tV+t+d  G t
  gi|7818626  5245    STDDGKLTVTTKD--GAT    5260

PAAR_motif: domain 5 of 5, from 5264 to 5274: score 1.7, E = 23
                   *->iieGspnvkvn<-*
                      i++G+++++vn
  gi|7818626  5264    ITTGNAQTTVN    5274

Reovirus_M2: domain 1 of 1, from 5267 to 5275: score -0.5, E = 2.5
                CS    XXXXXXXXB
                   *->GtvssiVnT<-*
                      G++++ VnT
  gi|7818626  5267    GNAQTTVNT    5275

Ribosomal_L44: domain 1 of 1, from 5276 to 5287: score 2.8, E = 3.9
                CS    ..-B-S--EEE-
                   *->GsfRakrfElge<-*
                      Gs++a+r+E ++
  gi|7818626  5276    GSSTAGRVEVQA    5287

YbbR: domain 1 of 1, from 5298 to 5345: score 1.4, E = 9.4
                   *->l...dkidavkatvpiDlsglkeGehsvsvtvsl.lapdgnvevevn
                      l+++++++ ++++ +iD sgl     s +++v+   + d +++ +
  gi|7818626  5298    LngsSQVNVFDVIGDIDASGL-----SNTLYVKTaDNEDAVGSSS-- 5337

                   vtiPstvtVti<-*
                       + v+Vt+
  gi|7818626  5338 ---LEDVKVTL    5345

Fibritin_C: domain 1 of 1, from 5331 to 5354: score 1.4, E = 5.1
                   *->vnqltnsvqDVvqvevGnnnSGLkg<-*
                          ++s+ D v v +Gn++ G++g
  gi|7818626  5331    DAVGSSSLED-VKVTLGNASAGIVG    5354

DUF607: domain 1 of 1, from 5353 to 5375: score 1.6, E = 4.5
                   *->vGiFLqdlrnedrGidvAavLdddGvvi<-*
                      vG+     +++dr+  vA++++++G v+
  gi|7818626  5353    VGV-----GSDDRIDVVANAMTTNGRVL    5375

RCC1: domain 1 of 1, from 5371 to 5395: score 2.0, E = 7.5
                CS    TSEEEEE EEEEETTSTTSSSTTSCEE
                   *->dGrVYsl.GcFRgenGqLGlgeevees<-*
                       GrV+sl G   +++++ Gl e+++++
  gi|7818626  5371    NGRVLSLaGA--SDVYVTGLFENLDAN    5395

Haemagg_act: domain 2 of 2, from 5408 to 5423: score 0.5, E = 12
                CS    EEEEEEE-SEEEEETT
                   *->vgglfvtTgaisikff<-*
                      +g+lfvtTg ++ + +
  gi|7818626  5408    TGDLFVTTGELTSDSQ    5423

Secretin: domain 1 of 1, from 5434 to 5470: score 2.1, E = 3.2
                   *->lIearIvEvslsdlqeLGvnWgaanggggggtgggsg<-*
                       I+a  v+++++dl++L v+ ga ++g+   t + +g
  gi|7818626  5434    FINADKVDTDTNDLEDLTVDAGAMSSGVAEATLTLTG    5470

CGGC: domain 2 of 2, from 5511 to 5519: score 2.5, E = 1.4
                   *->eikVVeGTH<-*
                      ++++V GTH
  gi|7818626  5511    NFDIVTGTH    5519

PUA: domain 1 of 1, from 5609 to 5629: score 2.8, E = 6.8
                CS    CEEEETTTTHHHHHTTTHCEEGGGE
                   *->grvvvDdGAveAilngGasLlapGV<-*
                        v v++GA++A      +L+a GV
  gi|7818626  5609    AAVMVNAGAIDA----NYNLYARGV    5629

RhgB_N: domain 1 of 1, from 5632 to 5645: score 0.4, E = 7.5
                   *->FGiTtsGdnyVvDa<-*
                      F  T  G+++V+Da
  gi|7818626  5632    FSVTSVGNSVVIDA    5645

Apo-CIII: domain 1 of 1, from 5649 to 5665: score 2.5, E = 3.3
                   *->stfkgkftgFwDstpes<-*
                      st ++k+tg +D t+ s
  gi|7818626  5649    STYTDKLTGSLDVTTAS    5665

Avidin: domain 2 of 2, from 5674 to 5689: score 0.3, E = 15
                CS    EEEEEESTTSSCCCEE
                   *->TGTYitavanaagegs<-*
                      TGTY+t v+++ g ++
  gi|7818626  5674    TGTYTTTVEGNLGSIA    5689

Gp5_C: domain 6 of 7, from 5675 to 5684: score 0.8, E = 40
                CS    S-EEEEESSE
                   *->GnrtvtVgGn<-*
                      G++t+tV+Gn
  gi|7818626  5675    GTYTTTVEGN    5684

DUF853: domain 1 of 1, from 5694 to 5705: score -1.6, E = 9.6
                   *->qpiDReSAYEvL<-*
                      + +DReS YE+L
  gi|7818626  5694    ELLDRESTYEML    5705

PhageMaj_Tail: domain 2 of 3, from 5697 to 5714: score 5.4, E = 0.82
                   *->dgEatyelsLeSaGaLtf<-*
                      d E tye+ Le++ a t
  gi|7818626  5697    DRESTYEMLLEGSSAMTV    5714

Flagellin_N: domain 1 of 1, from 5740 to 5770: score 6.0, E = 0.47
                CS    TB-TTTS-...EEEEEE-SSSTT-EEEEEE---ST
                   *->NGqklLdggttfknvsfqvganagetikvdlgsvs<-*
                      NG+ +L g+ ++++v+   ++ a +t+++d+ +
  gi|7818626  5740    NGISILTGS-GAMSVT---DSAASDTVSIDATKLN    5770

DUF847: domain 1 of 1, from 5791 to 5797: score 2.4, E = 6.9
                   *->DaaVNsG<-*
                      Da+VNsG
  gi|7818626  5791    DAVVNSG    5797

Fil_haemagg: domain 2 of 5, from 5794 to 5844: score 7.5, E = 0.2
                CS    EEESSEEEETTTT--EE-SEEEEEE-STT-EEEE-S-EEESSE....
                   *->vaaGaltlnaaalggldlnnggtlsagggltltaagllnnggtliag
                      v +G++  +a+    l+++ + t+++++++t++aa+l + +
  gi|7818626  5794    VNSGTGLFTAT----LADAPDVTIDTDRTTTVNAAALAAGHT----- 5831

                CS ...............EEEEESS-EEEEE
                   gdlllaagalrnggdltltaaGdLdnsg<-*
                                  l lt +G++++sg
  gi|7818626  5832 ---------------LELTGSGNVTLSG    5844

DUF769: domain 1 of 1, from 5858 to 5879: score 0.1, E = 5.4
                   *->dsGyyitvhvnfieserqkntE<-*
                      +sG+  t+++n++ s rq++ E
  gi|7818626  5858    NSGSELTGTLNITTSVRQTDGE    5879

gp12-short_mid: domain 1 of 1, from 5865 to 5880: score 1.3, E = 7.5
                CS    S-EEEEEEEEEEEEEE
                   *->GiasitGtvkntdqyv<-*
                      G  +it  v+ td+ v
  gi|7818626  5865    GTLNITTSVRQTDGEV    5880

Eeig1: domain 1 of 1, from 5866 to 5879: score 0.7, E = 7.8
                   *->iLkvsIkmkqlrGd<-*
                      +L+++ +++q++G+
  gi|7818626  5866    TLNITTSVRQTDGE    5879

SBP_bac_5: domain 1 of 1, from 5868 to 5919: score 3.1, E = 1
                CS    .EEEEEEEE-HHHHHTTT--...............HHHHHH.H.HHH
                   *->likvelktleptfsdadwatyvatptdsdpevrdladdlldaepvle
                      +i+ +++++                          +    ++  v+
  gi|7818626  5868    NITTSVRQT--------------------------DGEVTSGG-VTG 5887

                CS TT-SEEEEEEE-TTSCTH HHHHCCSCT C T
                   gdfdlallgwgadypdpp.fldpflsat.g.g<-*
                    + d al+ w++  +++++++d+ ++++++ +
  gi|7818626  5888 DGTDPALTIWTGSNSTTVtGYDATANESsIlD    5919

Fil_haemagg: domain 3 of 5, from 5994 to 6077: score 0.7, E = 17
                CS    EEESSEEEETTTT--EE-SEEEEEE-STT-EEEE-S-EEESSE....
                   *->vaaGaltlnaaalggldlnnggtlsagggltltaagllnnggtliag
                      +a G lt++              +++  ++ +ta+  +   ++  ag
  gi|7818626  5994    IAEGPLTVTTR------------VASVDDIIVTAGTNILTVDAVNAG 6028

                CS ..............                     .EEEEESS-EEEEE
                   gdlllaagalrngg.....................dltltaaGdLdnsg<
                    ++ + a+ l+++ ++++++++ ++++++++ ++  lt   aGd+++s
  gi|7818626  6029 DTVAIVAANLTDDMddndrtgtvskdpdsdgvdtfELTTKGAGDITVSD  6077

                CS
                   -*

  gi|7818626     -    -

ADH_zinc_N: domain 1 of 1, from 6027 to 6036: score 2.2, E = 3.7
                CS    TTSEEEEEST
                   *->pGdtVlVhGa<-*
                      +GdtV++++a
  gi|7818626  6027    AGDTVAIVAA    6036

PhageMaj_Tail: domain 3 of 3, from 6062 to 6075: score 1.5, E = 9
                   *->tyelsLeSaGaLtf<-*
                      t+el+  +aG++t
  gi|7818626  6062    TFELTTKGAGDITV    6075

PEP-utilizers: domain 3 of 5, from 6158 to 6165: score 0.6, E = 19
                CS    EEE.CTSEE
                   *->itvCDGstG<-*
                      +tv D++tG
  gi|7818626  6158    VTV-DAKTG    6165

PepSY: domain 1 of 1, from 6158 to 6171: score 3.1, E = 5.9
                   *->vyvDaytGevlgve<-*
                      v vDa+tG v+gv
  gi|7818626  6158    VTVDAKTGVVVGVT    6171

PPC: domain 2 of 2, from 6173 to 6229: score 1.0, E = 14
                CS    ESTTCEEEEEEECTSSS...S...CCEEEEEEECCCS ESSSSTTCE
                   *->vpaggtlsisldggsslrslsgnGdadtlLywlldgd.pslsayday
                      v+++g l+i++d +s+              + +l+g++p++  ++++
  gi|7818626  6173    VNSTGILEIYTDVLST--------GEQ--VQ-VLTGEgPTTIVSTGS 6208

                CS -.....ECCTTEEEEEECC     .-SEEE
                   stTrdvdnggsdelisfta.....peaGtY<-*
                   +          d+ i+++a+  +++++G+Y
  gi|7818626  6209 A---------ADSKITVDAdflkqATTGDY    6229

DUF814: domain 1 of 1, from 6222 to 6232: score 5.7, E = 0.46
                   *->KTatsgkyLkK<-*
                      K+at+g yLkK
  gi|7818626  6222    KQATTGDYLKK    6232

PvlArgDC: domain 1 of 1, from 6240 to 6254: score 1.2, E = 5.4
                CS    SE..EEEEEEEEEXX
                   *->sGewttavAAaVfvi<-*
                      +++w ta++A+V+ +
  gi|7818626  6240    TAFWVTALGASVYAT    6254

Big_2: domain 2 of 3, from 6293 to 6320: score 1.7, E = 8.4
                CS    TEEEEE-SSS-EEEEEEETT.TEEEEEEE
                   *->tGlVtalakGtatItatsgdgnksasvtv<-*
                      t +V a a G+++I  + g+ ++     v
  gi|7818626  6293    TIQVDAAASGSGDIITVDGS-SDVIISNV    6320

PEP-utilizers: domain 4 of 5, from 6304 to 6314: score 3.2, E = 3.5
                CS    TEEEEE.CTSEE
                   *->GdiitvCDGstG<-*
                      Gdiitv DGs+
  gi|7818626  6304    GDIITV-DGSSD    6314

DUF2345: domain 1 of 1, from 6335 to 6358: score 1.7, E = 6.5
                   *->sDdiellAkkdvkitSttgrIvis<-*
                      +++++l+   +v +tSt ++++i+
  gi|7818626  6335    TGSTALTGELTVSLTSTADSVDIW    6358

Fil_haemagg: domain 4 of 5, from 6339 to 6402: score 5.8, E = 0.61
                CS    EEESSEEEETT         TT--EE-SEEEEEE-STT-EEEE-S-E
                   *->vaaGaltlnaa.........alggldlnnggtlsagggltltaagll
                      +++G lt++ +++ ++ +  +++  ++ ++ + +ag g+++ aa+l
  gi|7818626  6339    ALTGELTVSLTstadsvdiwTGTKNTTVHTNISNAGHGVSIVAAALE 6385

                CS EESSE...................EEEEESS-EEEEE
                   nnggtliaggdlllaagalrnggdltltaaGdLdnsg<-*
                    n+                     ltl+ a ++ ++g
  gi|7818626  6386 DNQQ--------------------LTLDGAANVVVTG    6402

Reg_prop: domain 1 of 1, from 6339 to 6363: score 5.3, E = 5.6
                   *->slpgg.vtfalledsdG.rlWigt.n<-*
                       l+g+  + +l  ++d  ++W gt+n
  gi|7818626  6339    ALTGElTV-SLTSTADSvDIWTGTkN    6363

PEP-utilizers: domain 5 of 5, from 6376 to 6397: score 1.3, E = 12
                CS    BTTTEEECTCEEEETTEEESTTEEEEE.CTSEE
                   *->GtgnirvdakvleiateklkdGdiitvCDGstG<-*
                      G++              +l+d + +t+ DG ++
  gi|7818626  6376    GVSI----------VAAALEDNQQLTL-DGAAN    6397

DUF2125: domain 1 of 1, from 6405 to 6432: score 0.9, E = 1.5
                   *->GelrlaalsGeLsvDadGrpdGeLsLrv<-*
                      G  ++++l+G+L+v+ +G  dG++s+++
  gi|7818626  6405    GNITATSLTGSLTVTTAGAADGQISIAL    6432

DUF2328: domain 1 of 1, from 6416 to 6441: score 0.3, E = 5.7
                   *->ylllLAreaGgtisveiteeavvlsa<-*
                      ++   A +a g+is++ + ++++++a
  gi|7818626  6416    LTVTTAGAADGQISIALGSGTTTVTA    6441

Big_1: domain 1 of 1, from 6422 to 6457: score 2.5, E = 2.3
                CS    XGGEEEEECCEEEES-SEEESSSS--EEEEEEEEETT
                   *->ivdqltAsitsiiadkttavAngndaiTlTAtVkDan<-*
                      ++++ ++si++   ++tt++A++ d++T+ At +D+n
  gi|7818626  6422    GAADGQISIALGS-GTTTVTADALDTVTIDATQQDGN    6457

Flagellin_D3: domain 3 of 3, from 6429 to 6453: score 1.1, E = 16
                CS    EEESTT-S--TTSS-TT--EEESEEE
                   *->kVtlaagattttaatPagateVTkvq<-*
                      +++l++g ttt++a++ +++++ ++q
  gi|7818626  6429    SIALGSG-TTTVTADALDTVTIDATQ    6453

Big_2: domain 3 of 3, from 6431 to 6453: score 1.0, E = 13
                CS    E-SSS-EEEEEEETT.TEEEEEEE
                   *->alakGtatItatsgdgnksasvtv<-*
                      al+ Gt+t+ta++ d + + ++t
  gi|7818626  6431    ALGSGTTTVTADALD-TVTIDATQ    6453

HIM: domain 2 of 2, from 6467 to 6480: score 2.0, E = 18
                CS    ..-EETT-TT--CC
                   *->itvtktDAvnvsQL<-*
                      it++ ++A++v+ L
  gi|7818626  6467    ITLNGNGAFVVNNL    6480

DUF2207: domain 1 of 1, from 6474 to 6493: score 0.0, E = 5.6
                   *->dysIenydvdvtvqedGslt<-*
                       + ++n  +d++ ++dG++t
  gi|7818626  6474    AFVVNNLKADIDAAADGDAT    6493

Halo_GVPC: domain 2 of 2, from 6477 to 6489: score 2.7, E = 13
                   *->VsaLlaaIaelra<-*
                      V+ L a+I++  +
  gi|7818626  6477    VNNLKADIDAAAD    6489

Phage_Capsid_P3: domain 1 of 1, from 6515 to 6529: score -0.8, E = 6.2
                CS    ESB-----------X
                   *->tsRtELvnAGtistt<-*
                      t Rt Lv AG +  t
  gi|7818626  6515    TDRTTLVKAGELDGT    6529

Gp5_C: domain 7 of 7, from 6529 to 6544: score 0.1, E = 67
                CS    S-EEEEESS-EEEEES
                   *->GnesltVkGnrtvtVg<-*
                       ++ lt kG++ +tVg
  gi|7818626  6529    TDDVLTLKGDGDITVG    6544

Mito_carr: domain 1 of 1, from 6572 to 6592: score 2.3, E = 4.9
                CS    HHHHHHHHHHHHHHHHHHCHH
                   *->sflasllaGgiAGaiaatvty<-*
                       ++ s++aG+++G++ ++ ++
  gi|7818626  6572    EVYTSAIAGATSGTTQHLTAT    6592

HemolysinCabind: domain 22 of 31, from 6714 to 6731: score 4.2, E = 4.2
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      +G++  +t   g+G+Dt+
  gi|7818626  6714    TGTDAANTFLLGGGDDTI    6731

Peptidase_C47: domain 1 of 1, from 6728 to 6734: score 1.2, E = 4.1
                CS    EEEEE--
                   *->dssiyGY<-*
                      d++iyGY
  gi|7818626  6728    DDTIYGY    6734

HemolysinCabind: domain 23 of 31, from 6732 to 6749: score 16.7, E = 0.0007
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      yG +G+D L+Gg+G+D++
  gi|7818626  6732    YGYGGDDYLRGGDGDDII    6749

Viral_Rep_C: domain 1 of 1, from 6739 to 6752: score 2.1, E = 4.2
                   *->YtrGGKtqDilyqY<-*
                      Y+rGG  +Di y+
  gi|7818626  6739    YLRGGDGDDIIYAG    6752

HemolysinCabind: domain 24 of 31, from 6750 to 6767: score 23.3, E = 6.8e-06
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      y G G+Dt+yGg+G+D l
  gi|7818626  6750    YAGMGDDTIYGGDGDDFL    6767

HemolysinCabind: domain 25 of 31, from 6771 to 6787: score 8.5, E = 0.2
                CS    E--SSS-EEEEESSCGE
                   *->yGGaGnDtLyGgaGnDt<-*
                      +G +G D ++Gg+G Dt
  gi|7818626  6771    SGRDGSDFISGGDGVDT    6787

Tenui_NS3: domain 1 of 1, from 6800 to 6808: score 0.3, E = 5.2
                   *->akYvkYvdS<-*
                      a+Yv Y dS
  gi|7818626  6800    ARYVLYLDS    6808

CW_binding_1: domain 1 of 1, from 6805 to 6812: score 4.2, E = 3.2
                CS    EEETTSCB
                   *->YfdsdGkm<-*
                      Y+dsdG m
  gi|7818626  6805    YLDSDGNM    6812

ImpE: domain 1 of 1, from 6871 to 6879: score 0.5, E = 9.5
                CS    GGG--EEEE
                   *->LlDlqslqf<-*
                      L+D+++lqf
  gi|7818626  6871    LSDVENLQF    6879

DUF1980: domain 1 of 1, from 6890 to 6898: score 1.2, E = 5.7
                   *->nypgeFkGK<-*
                      ++p++F+GK
  gi|7818626  6890    LNPDDFVGK    6898

Fil_haemagg: domain 5 of 5, from 6951 to 6984: score 0.9, E = 16
                CS    .................   .EEEEESS-EEEEE
                   *->iaggdlllaagalrngg...dltltaaGdLdnsg<-*
                      ++g +l+la++ l++++ + ++ + +  d++ +g
  gi|7818626  6951    ASGVTLTLANDYLDHTEyelAIKVMSEEDITING    6984

Flagellin_IN: domain 9 of 9, from 6979 to 7000: score 6.2, E = 0.68
                   *->tltinggggkensvadgvdislsagdsla<-*
                      ++ting+gg+++       i++ + ++la
  gi|7818626  6979    DITINGNGGDNT-------ITILDYSDLA    7000

HemolysinCabind: domain 26 of 31, from 6981 to 6991: score 4.6, E = 3.2
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      t++G++G++t+
  gi|7818626  6981    TINGNGGDNTI    6991

DUF1772: domain 1 of 1, from 7008 to 7035: score 2.7, E = 3.6
                   *->PTNnaLfalakaeaevgevvageevrsLlrkW<-*
                      +TN+ L+++ ++e    + +a+ e+ +L+  W
  gi|7818626  7008    GTNSGLHEIDTNE----DGSADTEAFELIGGW    7035

Glutaredoxin: domain 1 of 1, from 7014 to 7049: score 4.1, E = 1.8
                CS    EETTTCTTH...HHHHHHHHHC..........SSCS SEEEEE.ETT
                   *->idvdeddgpdGseireelkelsgakgraakegGwrT.VPqvfasInG
                      +++d++  +dGs+  e+   +           Gw+T VP v    +G
  gi|7818626  7014    HEIDTN--EDGSADTEAFELIG----------GWSTaVPSVR--GDG 7046

                CS EEE
                   ehi<-*
                   e i
  gi|7818626  7047 EEI    7049

SecA_DEAD: domain 1 of 1, from 7024 to 7032: score 2.7, E = 1.6
                CS    -GGGHHHHH
                RF    xxxxxxxxx
                   *->AkTEeeEFr<-*
                      A+TE++E++
  gi|7818626  7024    ADTEAFELI    7032

HemolysinCabind: domain 27 of 31, from 7062 to 7072: score 3.6, E = 6.5
                CS    EEEEESSCGEE
                   *->tLyGgaGnDtl<-*
                      t++G +G+D++
  gi|7818626  7062    TINGLDGDDVI    7072

HemolysinCabind: domain 28 of 31, from 7085 to 7102: score 15.7, E = 0.0014
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                      yGG G+D L+ g+G  +l
  gi|7818626  7085    YGGSGDDFLSAGQGTEWL    7102

DUF1900: domain 1 of 1, from 7100 to 7114: score 1.7, E = 7.5
                CS    HHHTT------EE-S
                   *->eWfsGknaaPlliSL<-*
                      eW++G +++ +l+SL
  gi|7818626  7100    EWLDGGSGNDILVSL    7114

HemolysinCabind: domain 29 of 31, from 7103 to 7111: score 5.1, E = 2.2
                CS    EEESSCGEE
                   *->yGgaGnDtl<-*
                      +Gg+GnD+l
  gi|7818626  7103    DGGSGNDIL    7111

HemolysinCabind: domain 30 of 31, from 7112 to 7129: score 12.1, E = 0.017
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                         +G+D++ Gg+G+D++
  gi|7818626  7112    VSLGGDDRMLGGSGDDLI    7129

HemolysinCabind: domain 31 of 31, from 7156 to 7162: score 0.0, E = 77
                CS    ESSCGEE
                   *->gaGnDtl<-*
                      g+G+D++
  gi|7818626  7156    GGGDDQI    7162

Colipase_C: domain 1 of 1, from 7158 to 7176: score 1.8, E = 9.1
                CS    ESSSHHHHHHTC-EEEEEE
                   *->GDksivGaitntnyGiChD<-*
                      GD  iv a+    yGi  D
  gi|7818626  7158    GDDQIVAAVLDPDYGIDID    7176

//