hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            78189873.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|78189873|ref|YP_380211.1|
Accession:      [none]
Description:    hypothetical protein Cag_1920 [Chlorobium chlorochromatii CaD3]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
BNR             BNR/Asp-box repeat                       25.8    1.8e-06   5
HemolysinCabind Hemolysin-type calcium-binding repeat    23.7    5.1e-06   3
PKD             PKD domain                                9.3      0.025   4
Bac_export_3    Bacterial export proteins, family 3       9.8      0.034   1
Big_2           Bacterial Ig-like domain (group 2)        9.9      0.034   5
Rib             Rib/alpha-like repeat                     8.9       0.15   1
He_PIG          Putative Ig domain                        7.9       0.18   4
SHQ1            SHQ1 protein                              4.4       0.21   1
SPDY            Domain of unknown function (DUF317)       7.7       0.23   2
A2M_N           Alpha-2-macroglobulin family N-termin     4.7       0.36   1
FIST_C          FIST C domain                             6.2       0.38   2
Ubiq-assoc      Ubiquitin-associated                      6.8        0.4   1
Glucodextran_N  Glucodextranase, domain N                 2.4       0.41   1
ATP-gua_Ptrans  ATP:guanido phosphotransferase, C-ter     5.1       0.48   1
Kinin           Insect kinin peptide                      6.0       0.52   1
BiPBP_C         Penicillin-Binding Protein C-terminus     5.5       0.55   1
MucBP           MucBP domain                              6.3       0.59   2
RE_HindVP       HindVP restriction endonuclease           4.2       0.68   2
Miro            Miro-like protein                         4.8       0.77   1
DUF2006         Proteins of unknown function (DUF2006     0.7       0.87   1
Dockerin_1      Dockerin type I repeat                    6.1       0.96   2
Cadherin        Cadherin domain                           4.9        1.1   2
Glyco_hydro_61  Glycosyl hydrolase family 61              3.3        1.1   1
NPCBM_assoc     NPCBM-associated, NEW3 domain of alph     4.8        1.2   2
Sigma70_r4      Sigma-70, region 4                        5.9        1.3   2
3HCDH_N         3-hydroxyacyl-CoA dehydrogenase, NAD      3.3        1.4   1
Phage_Nu1       Phage DNA packaging protein Nu1           3.5        1.4   1
Corona_M        Coronavirus M matrix/glycoprotein         2.4        1.4   1
Surf_Ag_VNR     Surface antigen variable number repea     4.7        1.6   1
PTS_EIIA_1      phosphoenolpyruvate-dependent sugar p     3.4        1.7   1
AIG2            AIG2-like family                          2.7        1.7   1
UPF0183         Uncharacterised protein family (UPF01     0.6        1.7   1
NUMOD1          NUMOD1 domain                             5.7        1.8   1
Tymo_coat       Tymovirus coat protein                    3.4        1.9   1
Porin_2         Porin subfamily                           2.0        2.1   2
TMP             TMP repeat                                5.9        2.4   2
MSA_2           Merozoite Surface Antigen 2 (MSA-2) f     1.0        2.4   1
DUF2134         Predicted membrane protein (DUF2134)      3.0        2.6   1
Transglut_C     Transglutaminase family, C-terminal i     3.2        2.6   1
Phage_attach    Phage Head-Tail Attachment                0.5        2.7   1
RTX_C           RTX C-terminal domain                     2.5        3.1   1
EspA            EspA-like secreted protein                1.9        3.1   1
DUF162          Uncharacterised ACR, YkgG family COG1     3.6        3.1   1
YtxC            YtxC-like family                          1.7        3.2   1
Defensin_propep Defensin propeptide                       3.5        3.3   1
CreA            CreA protein                              2.3        3.3   1
Poly_export     Polysaccharide biosynthesis/export pr     3.5        3.4   1
H_lectin        H-type lectin domain                      4.0        3.4   1
Gp5_C           Gp5 C-terminal repeat (3 copies)          4.2        3.6   1
Cu_amine_oxidN1 Copper amine oxidase N-terminal domai     2.9        3.6   1
Enterotoxin_b   Heat-labile enterotoxin beta chain        1.6        3.6   1
Red1            Rec10 / Red1                             -0.2        3.7   1
DUF1681         Protein of unknown function (DUF1681)     2.2        3.8   1
Glug            The GLUG motif                            3.3          4   2
RNA_capsid      Calicivirus putative RNA polymerase/c    -0.0        4.4   1
Hum_adeno_E3A   Human adenovirus early E3A glycoprote     1.1        4.5   1
AmoC            Ammonia monooxygenase/methane monooxy     1.0        4.7   1
EppA_BapA       Exported protein precursor (EppA/BapA     0.4        4.8   1
Pou             Pou domain - N-terminal to homeobox d     2.4        4.9   2
ClpB_D2-small   C-terminal, D2-small domain, of ClpB      1.7          5   1
DUF1132         Protein of unknown function (DUF1132)     0.9        5.2   1
Thionin         Plant thionin                             2.8        5.3   1
Bac_DnaA_C      Bacterial  dnaA  protein helix-turn-h     3.2        5.6   1
Pox_E8          Poxvirus E8 protein                       1.0        5.8   1
TnsA_N          TnsA endonuclease N terminal              1.5        5.9   1
DUF1781         Protein of unknown function (DUF1781)     1.3          6   1
Big_1           Bacterial Ig-like domain (group 1)        1.2          6   1
YolD            YolD-like protein                         1.8          6   1
Dopey_N         Dopey, N-terminal                         0.2          6   1
DUF106          Integral membrane protein DUF106          0.3        6.1   1
DUF1892         Protein of unknown function (DUF1892)     1.4        6.2   1
IgG_binding_B   B domain                                  2.3        6.3   2
ATP-synt_8      ATP synthase protein 8                    1.4        6.4   1
DUF512          Protein of unknown function (DUF512)      1.7        6.4   1
HYR             HYR domain                                1.8        6.4   1
Autophagy_Cterm Autophagocytosis associated protein,      4.1        6.4   1
Nif11           Nitrogen fixation protein of unknown      2.8        6.6   1
Egg_lysin       Egg lysin (Sperm-lysin)                   1.4        6.7   1
E3_binding      e3 binding domain                         3.6        6.9   2
DUF342          Protein of unknown function (DUF342)      0.0          7   1
OKR_DC_1_C      Orn/Lys/Arg decarboxylase, C-terminal     0.9        7.2   1
PNPOx_C         Pyridoxine 5'-phosphate oxidase C-ter     0.2        7.3   1
CobN-Mg_chel    CobN/Magnesium Chelatase                 -1.7        7.3   1
DUF2328         Uncharacterized protein conserved in     -0.0        7.4   1
Glyco_hydro_20b Glycosyl hydrolase family 20, domain      0.9        7.5   1
NAC             NAC domain                                2.8        7.6   1
Penicil_amidase Penicillin amidase                       -1.5        7.7   1
PRA-PH          Phosphoribosyl-ATP pyrophosphohydrola     2.3        7.8   1
Ribosomal_S17   Ribosomal protein S17                     2.2        7.8   2
DUF1888         Domain of unknown function (DUF1888)      1.2        7.9   1
FaeA            FaeA-like protein                         3.1        7.9   1
GPW_gp25        Gene 25-like lysozyme                     1.4        8.3   1
DUF1921         Domain of unknown function (DUF1921)      0.6        8.3   1
Spheroidin      Entomopoxvirus spheroidin protein        -1.4        8.7   1
MTH865          MTH865-like family                        1.8        8.9   1
Bact_transglu_N Bacterial transglutaminase-like N-ter     2.1        9.1   1
Benyvirus_P25   Benyvirus P25 protein                    -0.3        9.1   1
DUF1727         Domain of unknown function (DUF1727)     -0.8        9.1   1
Herpes_ICP4_C   Herpesvirus ICP4-like protein C-termi    -1.4        9.2   1
Glyoxal_oxid_N  Glyoxal oxidase N-terminus               -2.0        9.4   1
PrmA            Ribosomal protein L11 methyltransfera    -0.4        9.4   1
WAC_Acf1_DNA_bd ATP-utilising chromatin assembly and      1.6        9.5   1
MEA1            Male enhanced antigen 1 (MEA1)           -1.0        9.6   1
HtaA            Htaa                                     -0.0        9.6   1
CP12            CP12 domain                               1.2        9.7   1
Fimbrial        Fimbrial protein                          0.4        9.8   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Thionin           1/1      19    26 ..     1     8 [.     2.8      5.3
Red1              1/1      44    59 ..   202   217 ..    -0.2      3.7
Spheroidin        1/1      69    77 ..  1013  1021 .]    -1.4      8.7
DUF1921           1/1     143   153 ..     1    11 [.     0.6      8.3
HtaA              1/1     216   229 ..   183   196 .]    -0.0      9.6
Kinin             1/1     241   248 ..     1     8 []     6.0     0.52
RNA_capsid        1/1     258   273 ..     1    18 [.    -0.0      4.4
Glug              1/2     261   278 ..     8    38 .]     2.4      7.3
CreA              1/1     330   340 ..   146   156 .]     2.3      3.3
WAC_Acf1_DNA_bd   1/1     350   356 ..    96   102 .]     1.6      9.5
DUF106            1/1     380   391 ..     1    12 [.     0.3      6.1
He_PIG            1/4     407   431 ..    35    61 .]     0.8       19
DUF2006           1/1     455   471 ..   375   395 .]     0.7     0.87
DUF1888           1/1     484   495 ..    95   106 ..     1.2      7.9
E3_binding        1/2     562   573 ..    28    39 .]     0.7       42
Ribosomal_S17     1/2     564   577 ..     1    14 [.     1.7       10
RE_HindVP         1/2     626   636 ..     1    11 [.     3.0      1.4
ATP-gua_Ptrans    1/1     646   661 ..     1    16 [.     5.1     0.48
PKD               1/4     688   724 ..     1    38 [.     2.4      3.5
A2M_N             1/1     739   789 ..   214   269 ..     4.7     0.36
Cadherin          1/2     755   777 ..     1    23 [.     2.0      7.2
Glyco_hydro_61    1/1     757   771 ..   174   188 ..     3.3      1.1
NPCBM_assoc       1/2     758   777 ..    61    86 .]     4.2      1.8
He_PIG            2/4     760   779 ..    41    61 .]     0.7       21
PRA-PH            1/1     762   776 ..    14    28 ..     2.3      7.8
3HCDH_N           1/1     828   850 ..    12    34 ..     3.3      1.4
Ribosomal_S17     2/2     916   925 ..     1    10 [.     0.4       24
AmoC              1/1     925   936 ..   245   256 .]     1.0      4.7
DUF1892           1/1     936   957 ..    94   117 .]     1.4      6.2
Dockerin_1        1/2     966   972 ..     1     7 [.     1.6       24
HemolysinCabind   1/3     974   985 ..     7    18 .]     3.5        7
RE_HindVP         2/2     979   989 ..     1    11 [.     1.2      4.3
DUF162            1/1    1047  1065 ..     1    21 [.     3.6      3.1
HemolysinCabind   2/3    1159  1176 ..     1    18 []    14.9   0.0024
Benyvirus_P25     1/1    1174  1195 ..   200   219 .]    -0.3      9.1
HemolysinCabind   3/3    1177  1190 ..     1    14 [.     5.4      1.8
ATP-synt_8        1/1    1206  1210 ..     1     5 [.     1.4      6.4
Poly_export       1/1    1234  1259 ..     1    26 [.     3.5      3.4
PNPOx_C           1/1    1236  1242 ..    51    57 .]     0.2      7.3
MEA1              1/1    1289  1312 ..   151   174 .]    -1.0      9.6
Gp5_C             1/1    1360  1384 ..     1    24 []     4.2      3.6
SHQ1              1/1    1372  1392 ..     1    25 [.     4.4     0.21
Dopey_N           1/1    1376  1386 ..   308   318 .]     0.2        6
CP12              1/1    1398  1408 ..    32    42 ..     1.2      9.7
Bac_export_3      1/1    1426  1438 ..    64    76 .]     9.8    0.034
FaeA              1/1    1441  1448 ..     1     8 [.     3.1      7.9
RTX_C             1/1    1463  1503 ..    99   145 ..     2.5      3.1
Sigma70_r4        1/2    1466  1483 ..    24    41 ..     1.9       17
MucBP             1/2    1472  1487 ..     1    16 [.     0.3       25
Big_2             1/5    1508  1527 ..    70    90 .]     1.8      7.7
ClpB_D2-small     1/1    1513  1536 ..    71    95 .]     1.7        5
MTH865            1/1    1521  1536 ..    65    81 .]     1.8      8.9
IgG_binding_B     1/2    1549  1564 ..    41    56 .]     0.3       23
Herpes_ICP4_C     1/1    1551  1587 ..   413   451 .]    -1.4      9.2
CobN-Mg_chel      1/1    1639  1647 ..  1225  1234 .]    -1.7      7.3
Glyoxal_oxid_N    1/1    1691  1707 ..   204   223 ..    -2.0      9.4
Enterotoxin_b     1/1    1781  1801 ..     1    22 [.     1.6      3.6
NUMOD1            1/1    1792  1815 ..     1    22 [.     5.7      1.8
FIST_C            1/2    1801  1821 ..    53    73 ..     4.1      1.4
DUF1681           1/1    1814  1834 ..   168   179 .]     2.2      3.8
PrmA              1/1    1901  1910 ..   303   312 .]    -0.4      9.4
DUF1132           1/1    1941  1950 ..    91   100 .]     0.9      5.2
Glyco_hydro_20b   1/1    1947  1986 ..    42    85 ..     0.9      7.5
Penicil_amidase   1/1    1954  1969 ..   868   883 .]    -1.5      7.7
Pox_E8            1/1    1959  1980 ..   112   133 ..     1.0      5.8
Big_1             1/1    2009  2029 ..    55    76 ..     1.2        6
TnsA_N            1/1    2034  2048 ..    94   108 .]     1.5      5.9
Ubiq-assoc        1/1    2066  2076 ..    24    34 ..     6.8      0.4
BNR               1/5    2136  2147 ..     1    12 []     8.5      0.3
TMP               1/2    2145  2155 ..     1    11 []     1.8       37
DUF2328           1/1    2151  2171 ..   168   188 .]    -0.0      7.4
Nif11             1/1    2151  2165 ..    36    50 .]     2.8      6.6
Cu_amine_oxidN1   1/1    2164  2182 ..    76    94 .]     2.9      3.6
GPW_gp25          1/1    2167  2184 ..    97   114 .]     1.4      8.3
BNR               2/5    2172  2180 ..     1     9 [.     1.6       38
Big_2             2/5    2190  2223 ..     1    33 [.     1.7      8.2
FIST_C            2/2    2195  2224 ..    51    81 ..     2.1      5.2
PKD               2/4    2204  2231 ..     1    39 [.     1.0      9.3
EspA              1/1    2213  2234 ..   257   278 .]     1.9      3.1
UPF0183           1/1    2293  2303 ..   403   413 .]     0.6      1.7
Big_2             3/5    2294  2312 ..    71    90 .]     2.5      4.7
BNR               3/5    2327  2338 ..     1    12 []     0.9       61
Porin_2           1/2    2362  2392 ..   468   505 .]     1.4      3.1
E3_binding        2/2    2394  2408 ..    22    36 ..     2.9       11
He_PIG            3/4    2404  2463 ..     1    61 []     6.2     0.58
Glucodextran_N    1/1    2414  2445 ..    97   122 ..     2.4     0.41
NPCBM_assoc       2/2    2446  2472 ..     1    27 [.     0.6       20
Pou               1/2    2538  2548 ..    25    35 ..     0.3       18
He_PIG            4/4    2539  2558 ..    42    61 .]     0.2       28
Egg_lysin         1/1    2541  2585 ..   119   163 .]     1.4      6.7
MucBP             2/2    2576  2594 ..     1    19 [.     6.0      0.7
AIG2              1/1    2611  2628 ..   101   119 .]     2.7      1.7
Bac_DnaA_C        1/1    2630  2649 ..     1    20 [.     3.2      5.6
Phage_Nu1         1/1    2640  2658 ..   148   166 .]     3.5      1.4
Sigma70_r4        2/2    2640  2655 ..    16    36 ..     4.1      4.2
Pou               2/2    2644  2656 ..    25    37 ..     2.0      6.1
Transglut_C       1/1    2684  2703 ..     1    21 [.     3.2      2.6
DUF512            1/1    2746  2761 ..   198   213 .]     1.7      6.4
Porin_2           2/2    2752  2786 ..   464   505 .]     0.6        5
Surf_Ag_VNR       1/1    2758  2796 ..    52    84 .]     4.7      1.6
MSA_2             1/1    2772  2808 ..     1    39 [.     1.0      2.4
Tymo_coat         1/1    2782  2794 ..   164   176 .]     3.4      1.9
Big_2             4/5    2784  2803 ..    70    90 .]     2.8      3.8
DUF342            1/1    2785  2806 ..   206   227 ..     0.0        7
Fimbrial          1/1    2785  2795 ..     1    11 [.     0.4      9.8
PKD               3/4    2787  2836 ..     1    59 [.     4.7     0.64
Rib               1/1    2791  2821 ..     1    33 [.     8.9     0.15
Big_2             5/5    2879  2897 ..    71    90 .]     1.0       13
NAC               1/1    2880  2891 ..    50    61 .]     2.8      7.6
BNR               4/5    2913  2924 ..     1    12 []    10.8    0.062
Glug              2/2    2955  2970 ..    21    38 .]     0.9       21
Miro              1/1    2979  2991 ..     1    13 [.     4.8     0.77
BNR               5/5    3012  3023 ..     1    12 []     4.0      7.1
DUF1727           1/1    3015  3050 ..    81   114 ..    -0.8      9.1
YtxC              1/1    3055  3066 ..   212   223 .]     1.7      3.2
PTS_EIIA_1        1/1    3154  3171 ..    40    57 ..     3.4      1.7
DUF2134           1/1    3174  3234 ..     1    78 [.     3.0      2.6
Hum_adeno_E3A     1/1    3177  3200 ..     1    24 [.     1.1      4.5
EppA_BapA         1/1    3226  3231 ..   165   170 .]     0.4      4.8
YolD              1/1    3237  3245 ..    85    93 .]     1.8        6
Phage_attach      1/1    3238  3253 ..     1    18 [.     0.5      2.7
Defensin_propep   1/1    3244  3255 ..    43    54 .]     3.5      3.3
SPDY              1/2    3260  3278 ..    53    71 .]     1.0       17
Bact_transglu_N   1/1    3265  3289 ..    57    81 .]     2.1      9.1
IgG_binding_B     2/2    3397  3417 ..     1    21 [.     2.0      7.7
OKR_DC_1_C        1/1    3405  3421 ..    91   107 ..     0.9      7.2
SPDY              2/2    3408  3427 ..    52    71 .]     6.6     0.45
Autophagy_Cterm   1/1    3505  3514 ..    16    25 .]     4.1      6.4
H_lectin          1/1    3523  3548 ..    24    54 ..     4.0      3.4
Cadherin          2/2    3561  3587 ..    75   107 .]     2.9      4.1
Corona_M          1/1    3577  3593 ..     1    19 [.     2.4      1.4
PKD               4/4    3642  3656 ..    77    92 .]     1.2      7.7
TMP               2/2    3642  3652 ..     1    11 []     4.0      8.3
BiPBP_C           1/1    3654  3670 ..    79    94 .]     5.5     0.55
HYR               1/1    3656  3672 ..    69    86 .]     1.8      6.4
DUF1781           1/1    3678  3689 ..   120   131 .]     1.3        6
Dockerin_1        2/2    3761  3781 ..     1    21 []     4.6      2.9

Alignments of top-scoring domains:
Thionin: domain 1 of 1, from 19 to 26: score 2.8, E = 5.3
                CS    -EEBSSHH
                   *->KSCCpsTt<-*
                      KSCC +++
  gi|7818987    19    KSCCENIA    26

Red1: domain 1 of 1, from 44 to 59: score -0.2, E = 3.7
                   *->rdvtpFekcvlsphek<-*
                      +++tpF+++vl++he+
  gi|7818987    44    TSLTPFTDIVLVTHEA    59

Spheroidin: domain 1 of 1, from 69 to 77: score -1.4, E = 8.7
                   *->WAnGYrksH<-*
                      +A GY+++H
  gi|7818987    69    FAAGYEHIH    77

DUF1921: domain 1 of 1, from 143 to 153: score 0.6, E = 8.3
                CS    TTSSSEEEEEE
                   *->sGfsGLvatvs<-*
                      + fsGLv+  s
  gi|7818987   143    TAFSGLVGAAS    153

HtaA: domain 1 of 1, from 216 to 229: score -0.0, E = 9.6
                   *->AGtaLDPvslsltl<-*
                      AGt+ ++v+++l+
  gi|7818987   216    AGTTINAVDFTLAY    229

Kinin: domain 1 of 1, from 241 to 248: score 6.0, E = 0.52
                   *->sPaFnsWG<-*
                      +PaF+sW
  gi|7818987   241    HPAFSSWT    248

RNA_capsid: domain 1 of 1, from 258 to 273: score -0.0, E = 4.4
                   *->MAgAfigglAadalgsal<-*
                        g +i+glA+d+  s++
  gi|7818987   258    --GVIIAGLAGDITNSSV    273

Glug: domain 1 of 2, from 261 to 278: score 2.4, E = 7.3
                   *->LvGgaegggrGeqenpgsienctatgnvtvt<-*
                      ++G a           g+i+n+++ +  + t
  gi|7818987   261    IAGLA-----------GDITNSSVYN--SFT    278

CreA: domain 1 of 1, from 330 to 340: score 2.3, E = 3.3
                   *->vsTVPLygqqv<-*
                      +sTVP+++++
  gi|7818987   330    LSTVPVWNTDL    340

WAC_Acf1_DNA_bd: domain 1 of 1, from 350 to 356: score 1.6, E = 9.5
                   *->FFpGEeV<-*
                      + pGE+V
  gi|7818987   350    YAPGETV    356

DUF106: domain 1 of 1, from 380 to 391: score 0.3, E = 6.1
                   *->ggaldvvlgPli<-*
                      g+++d+v+ Pl+
  gi|7818987   380    GQVVDNVFQPLS    391

He_PIG: domain 1 of 4, from 407 to 431: score 0.8, E = 19
                   *->GritGtPtptvqpGsytftvtatdgsg<-*
                      G++t  ++++ + Gsy +++ a d +g
  gi|7818987   407    GSFT--VPSIAPVGSYVVRLLADDHAG    431

DUF2006: domain 1 of 1, from 455 to 471: score 0.7, E = 0.87
                   *->g.tGshvsG.pVsGrGYlElTGY<-*
                      +++G+   G+pV+G+GY     Y
  gi|7818987   455    NtSGTI-DGsPVAGEGY-----Y    471

DUF1888: domain 1 of 1, from 484 to 495: score 1.2, E = 7.9
                   *->ipGtTkFqfVLs<-*
                      i G+T+FqfV +
  gi|7818987   484    IAGDTGFQFVIT    495

E3_binding: domain 1 of 2, from 562 to 573: score 0.7, E = 42
                CS    TCCBBHHHHHHH
                   *->pgGRItkeDVea<-*
                      p+G I+++D ++
  gi|7818987   562    PDGIIVRDDMDN    573

Ribosomal_S17: domain 1 of 2, from 564 to 577: score 1.7, E = 10
                CS    S-SS-SSSS-----
                   *->GvVvsdkMeKTvvV<-*
                      G  v+d+M++ v+V
  gi|7818987   564    GIIVRDDMDNQVAV    577

RE_HindVP: domain 1 of 2, from 626 to 636: score 3.0, E = 1.4
                   *->aWGKNQFNsSF<-*
                       WG  QFN SF
  gi|7818987   626    NWGDEQFNDSF    636

ATP-gua_Ptrans: domain 1 of 1, from 646 to 661: score 5.1, E = 0.48
                CS    ---TTTEEEEEEEEEE
                   *->dpdgkyVlSsRVRtGR<-*
                      +pd+ +V+S+++R GR
  gi|7818987   646    QPDEWMVTSTKIRAGR    661

PKD: domain 1 of 4, from 688 to 724: score 2.4, E = 3.5
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT     . SSECEEE
                   *->vsasaveegpsvvalgetVtFtassSydpd.....p.Gspvsys<-*
                      v+ +     p ++ +g++++F++ +   +d   ++p+G++++ys
  gi|7818987   688    VQLP-----PLMFTQGQNINFSDYA--LADlyatdPnGDAITYS    724

A2M_N: domain 1 of 1, from 739 to 789: score 4.7, E = 0.36
                CS    -EEEEEEEE-.T...TTTTEEEEEEE--SS---EEEEEEEEET T-T
                   *->nrvrqwllvkatetgnefGifsgsfpLpeeaplGtWtieveyd.pdg
                      +++++ +++  +e +    + +gsf++p +ap+G++ +++ +d+++g
  gi|7818987   739    QEFSELPVW--MEEA----GLQGSFTIPTNAPTGSYVLRLLADdHAG 779

                CS TSEEEEEEEE
                   gslgsasFrV<-*
                   ++++ +   V
  gi|7818987   780 DTYAGTALDV    789

Cadherin: domain 1 of 2, from 755 to 777: score 2.0, E = 7.2
                CS    --EEE-SS...S---EEEEE---
                   *->ysasvpEnapvGtevltvtAtDa<-*
                       s+++p nap+G+ vl++ A D+
  gi|7818987   755    GSFTIPTNAPTGSYVLRLLADDH    777

Glyco_hydro_61: domain 1 of 1, from 757 to 771: score 3.3, E = 1.1
                   *->vkiPddLpSGaYlvR<-*
                      ++iP++ p G Y++R
  gi|7818987   757    FTIPTNAPTGSYVLR    771

NPCBM_assoc: domain 1 of 2, from 758 to 777: score 4.2, E = 1.8
                   *->tpPadAaAGdPYHPYtltasAsYtvs<-*
                      t+P++A++G+    Y l++ A   ++
  gi|7818987   758    TIPTNAPTGS----YVLRLLAD--DH    777

He_PIG: domain 2 of 4, from 760 to 779: score 0.7, E = 21
                   *->PtptvqpGsytftvtatdgsg<-*
                      Pt + ++Gsy  ++ a d +g
  gi|7818987   760    PTNA-PTGSYVLRLLADDHAG    779

PRA-PH: domain 1 of 1, from 762 to 776: score 2.3, E = 7.8
                   *->aaPegSYTakLfadD<-*
                      +aP+gSY+ +L+adD
  gi|7818987   762    NAPTGSYVLRLLADD    776

3HCDH_N: domain 1 of 1, from 828 to 850: score 3.3, E = 1.4
                CS    HHHHHHHHTT.SEEEEE-S-HHH
                   *->aGIAqvfAraGleVvlvDiseea<-*
                      +GIA+vf  +G++V+l++++ +a
  gi|7818987   828    TGIAAVFGDSGFQVNLFEVASDA    850

Ribosomal_S17: domain 2 of 2, from 916 to 925: score 0.4, E = 24
                CS    S-SS-SSSS-
                   *->GvVvsdkMeK<-*
                      G Vv d+M++
  gi|7818987   916    GIVVEDDMDN    925

AmoC: domain 1 of 1, from 925 to 936: score 1.0, E = 4.7
                   *->nLvdvewnkqlr<-*
                      nLvdv++n q r
  gi|7818987   925    NLVDVDLNWQTR    936

DUF1892: domain 1 of 1, from 936 to 957: score 1.4, E = 6.2
                CS    .HHHHHHHHHHHHHH........-
                   *->reevvkkvkdFveqneldeeeeed<-*
                      r+ev + + +F+     +++++ed
  gi|7818987   936    RDEVTGAIATFSTTV--KNKDNED    957

Dockerin_1: domain 1 of 2, from 966 to 972: score 1.6, E = 24
                CS    -TT-SS-
                   *->DvNgDGk<-*
                      D+N+DG+
  gi|7818987   966    DINNDGV    972

HemolysinCabind: domain 1 of 3, from 974 to 985: score 3.5, E = 7
                CS    -EEEEESSCGEE
                   *->DtLyGgaGnDtl<-*
                      D+  G+ GnD++
  gi|7818987   974    DRVVGNWGNDQF    985

RE_HindVP: domain 2 of 2, from 979 to 989: score 1.2, E = 4.3
                   *->aWGKNQFNsSF<-*
                       WG  QFN +F
  gi|7818987   979    NWGNDQFNDAF    989

DUF162: domain 1 of 1, from 1047 to 1065: score 3.6, E = 3.1
                   *->dadvGItgAnfaiAETGtlvL<-*
                      + d+GItgA   +AETG++v+
  gi|7818987  1047    TYDIGITGAS--LAETGAIVV    1065

HemolysinCabind: domain 2 of 3, from 1159 to 1176: score 14.9, E = 0.0024
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G+  nD++  gaG+D+l
  gi|7818987  1159    LGTSNNDSIAAGAGDDVL    1176

Benyvirus_P25: domain 1 of 1, from 1174 to 1195: score -0.3, E = 9.1
                   *->DvLD..vDnnviqAPDGvDDdd<-*
                      DvLD +v n  i A DG D +
  gi|7818987  1174    DVLDwsVGNDTIDAGDGYDHQY    1195

HemolysinCabind: domain 3 of 3, from 1177 to 1190: score 5.4, E = 1.8
                CS    E--SSS-EEEEESS
                   *->yGGaGnDtLyGgaG<-*
                      +   GnDt++ g+G
  gi|7818987  1177    DWSVGNDTIDAGDG    1190

ATP-synt_8: domain 1 of 1, from 1206 to 1210: score 1.4, E = 6.4
                   *->MPQLn<-*
                      MPQL+
  gi|7818987  1206    MPQLD    1210

Poly_export: domain 1 of 1, from 1234 to 1259: score 3.5, E = 3.4
                   *->aplaavavspeYrlGpGDklrVtVfg<-*
                       ++ +  ++ eYr++ +D + VtV++
  gi|7818987  1234    VYRITRLAPSEYRIDSMDSIGVTVVQ    1259

PNPOx_C: domain 1 of 1, from 1236 to 1242: score 0.2, E = 7.3
                   *->sieRLaP<-*
                      +i+RLaP
  gi|7818987  1236    RITRLAP    1242

MEA1: domain 1 of 1, from 1289 to 1312: score -1.0, E = 9.6
                   *->isDAqWEDvvqKALqARqAsPAWK<-*
                      +s   W+Dv+   Lq   AsP
  gi|7818987  1289    VSGTAWDDVISVDLQSFIASPFTS    1312

Gp5_C: domain 1 of 1, from 1360 to 1384: score 4.2, E = 3.6
                CS    S-EEEEESS-EEEEES SEEEEEES
                   *->GnesltVkGnrtvtVg.GnqTtsVg<-*
                      G++++t  G +t+tVg+G+ + sV+
  gi|7818987  1360    GQLQVTSTGYVTLTVGsGDTALSVS    1384

SHQ1: domain 1 of 1, from 1372 to 1392: score 4.4, E = 0.21
                   *->LeWYvssekenqeqllefsdEerkq<-*
                      L+  v s+  ++   +++s++e++q
  gi|7818987  1372    LT--VGSGDTAL--SVSLSNIEKYQ    1392

Dopey_N: domain 1 of 1, from 1376 to 1386: score 0.2, E = 6
                   *->skdTelvvsdS<-*
                      s+dT l+vs+S
  gi|7818987  1376    SGDTALSVSLS    1386

CP12: domain 1 of 1, from 1398 to 1408: score 1.2, E = 9.7
                   *->VVEELsAeAaH<-*
                      VVEEL+ +A+H
  gi|7818987  1398    VVEELDVAASH    1408

Bac_export_3: domain 1 of 1, from 1426 to 1438: score 9.8, E = 0.034
                   *->pWMlqtlldFtre<-*
                      +WMl+ lldFt e
  gi|7818987  1426    GWMLNALLDFTDE    1438

FaeA: domain 1 of 1, from 1441 to 1448: score 3.1, E = 7.9
                   *->MKeeILef<-*
                      M+++I+++
  gi|7818987  1441    MSNSIITY    1448

RTX_C: domain 1 of 1, from 1463 to 1503: score 2.5, E = 3.1
                   *->tsselekQNESNLSSLKTELGKii....yvadnyglakqgnnkhlsa
                      +s+el++          TELGK ++ + +++d+yg     n+++++a
  gi|7818987  1463    SSYELTQ----------TELGKQLsvtvSYVDDYGGHESVNSLATTA 1499

                   lans<-*
                   + ns
  gi|7818987  1500 IQNS    1503

Sigma70_r4: domain 1 of 2, from 1466 to 1483: score 1.9, E = 17
                CS    T--HHHHHHHHTS-HHHH
                   *->elTLeEIGerLGiSreRV<-*
                      elT+ E+G+ L ++ + V
  gi|7818987  1466    ELTQTELGKQLSVTVSYV    1483

MucBP: domain 1 of 2, from 1472 to 1487: score 0.3, E = 25
                   *->ltktvtvTvhYvDedG<-*
                      l k+ +vTv YvD  G
  gi|7818987  1472    LGKQLSVTVSYVDDYG    1487

Big_2: domain 1 of 5, from 1508 to 1527: score 1.8, E = 7.7
                CS    SS-EEEEEEETT.TEEEEEEE
                   *->kGtatItatsgdgnksasvtv<-*
                      +G+ tIt t+   +k+ +v v
  gi|7818987  1508    EGKPTITGTAAQ-GKTLTVDV    1527

ClpB_D2-small: domain 1 of 1, from 1513 to 1536: score 1.7, E = 5
                CS    HHSSS-TT-EEEEEE-.....SSSE
                   *->LsGelkeGdtvrvdvddgeggelvf<-*
                      + G+ + G+t++vdv  g ++e+ +
  gi|7818987  1513    ITGTAAQGKTLTVDVS-GITDEDGL    1536

MTH865: domain 1 of 1, from 1521 to 1536: score 1.8, E = 8.9
                CS    HHHHHHHH....HHH--
                   *->edlAdklvAGLKdkagL<-*
                      ++l ++++ G+ d++gL
  gi|7818987  1521    KTLTVDVS-GITDEDGL    1536

IgG_binding_B: domain 1 of 2, from 1549 to 1564: score 0.3, E = 23
                   *->Gewlydtatktftvte<-*
                      G +  dt   tft +e
  gi|7818987  1549    GMPIDDTTASTFTLQE    1564

Herpes_ICP4_C: domain 1 of 1, from 1551 to 1587: score -1.4, E = 9.2
                   *->nppegtsaalyslaeamvAhpriPsvtWdsgfGgsaeTv<-*
                      ++++ t+++ ++l e  v h  + +v    +fG+ +eTv
  gi|7818987  1551    PIDDTTAST-FTLQETQVWHQISVAVSYTDDFGQ-EETV    1587

CobN-Mg_chel: domain 1 of 1, from 1639 to 1647: score -1.7, E = 7.3
                RF    xxxxxxxxxx
                   *->Wkpadeetle<-*
                      Wk ad +++e
  gi|7818987  1639    WK-ADGAIIE    1647

Glyoxal_oxid_N: domain 1 of 1, from 1691 to 1707: score -2.0, E = 9.4
                   *->FVfLLPDDDGGNLFIFANnR<-*
                      +V+ LPD   G +FI+ N +
  gi|7818987  1691    RVNNLPD---GYVFIVGNQQ    1707

Enterotoxin_b: domain 1 of 1, from 1781 to 1801: score 1.6, E = 3.6
                CS    --SSHHHHHTTSTTEEEEEEEE
                   *->aPqniteLCaEYhntqiytlnD<-*
                       P n te  + Y    iy lnD
  gi|7818987  1781    -PHNTTESLSSYYSVFIYNLND    1801

NUMOD1: domain 1 of 1, from 1792 to 1815: score 5.7, E = 1.8
                   *->kpVyvYDlngnligk..iFsSire<-*
                      + V++Y+ln++ +g+ +i+ +i+e
  gi|7818987  1792    YSVFIYNLNDEPTGEitIYGTIKE    1815

FIST_C: domain 1 of 2, from 1801 to 1821: score 4.1, E = 1.4
                   *->dpedGsltfagdvpeGeelql<-*
                      d+ +G +t++g ++eGe+l++
  gi|7818987  1801    DEPTGEITIYGTIKEGETLTV    1821

DUF1681: domain 1 of 1, from 1814 to 1834: score 2.2, E = 3.8
                   *->KeGETIsIn.........Lgg<-*
                      KeGET+++n+++  + ++Lg+
  gi|7818987  1814    KEGETLTVNtstladadgLGE    1834

PrmA: domain 1 of 1, from 1901 to 1910: score -0.4, E = 9.4
                   *->eWvcIvgkkk<-*
                      +Wv+I+g+ +
  gi|7818987  1901    GWVTISGTAT    1910

DUF1132: domain 1 of 1, from 1941 to 1950: score 0.9, E = 5.2
                   *->DninfddvFe<-*
                      D in dd+F+
  gi|7818987  1941    DGINWDDIFG    1950

Glyco_hydro_20b: domain 1 of 1, from 1947 to 1986: score 0.9, E = 7.5
                CS    .----------------..B--EEEEEE-S-.--TTS---TT--
                   *->DgFkaeqfpsvnfraetlgviksvlVsvvvtvspcdslqsLgsd<-*
                      D F+a+q+++   +a +   +k  +V+++ t ++++ l +++sd
  gi|7818987  1947    DIFGATQRSYKLTQADV---DKHITVEISYT-DDANHLNTISSD    1986

Penicil_amidase: domain 1 of 1, from 1954 to 1969: score -1.5, E = 7.7
                CS    EE---SHHHHHHHEEE
                   *->kpllftpadikahaqs<-*
                      +++ +t+ad+++h+++
  gi|7818987  1954    RSYKLTQADVDKHITV    1969

Pox_E8: domain 1 of 1, from 1959 to 1980: score 1.0, E = 5.8
                   *->TrFditKHTLFskvYTdnakHv<-*
                      T+ d++KH      YTd a+H+
  gi|7818987  1959    TQADVDKHITVEISYTDDANHL    1980

Big_1: domain 1 of 1, from 2009 to 2029: score 1.2, E = 6
                CS    ESSSEES-S.E.EEE-TTSEEE
                   *->sssgtlsngntkatTdanGkAt<-*
                      ++ +tl+ + t+a+Tda+G+A+
  gi|7818987  2009    TEDQTLTIV-TSAITDADGIAQ    2029

TnsA_N: domain 1 of 1, from 2034 to 2048: score 1.5, E = 5.9
                CS    HHHHHCT--EEEE-G
                   *->rywqqkGidfrivTE<-*
                      ++wq+ G+ f + TE
  gi|7818987  2034    YQWQADGVTFAWTTE    2048

Ubiq-assoc: domain 1 of 1, from 2066 to 2076: score 6.8, E = 0.4
                CS    HHHHHHH-SSH
                   *->seYYerGitYE<-*
                      ++YY++G+tYE
  gi|7818987  2066    VSYYDNGGTYE    2076

BNR: domain 1 of 5, from 2136 to 2147: score 8.5, E = 0.3
                CS    EEESSTTSSEEE
                   *->yyStDgGkTWsk<-*
                      + StD+G +W+
  gi|7818987  2136    QSSTDDGVNWND    2147

TMP: domain 1 of 2, from 2145 to 2155: score 1.8, E = 37
                   *->WngIkgffsga<-*
                      Wn+I g++++
  gi|7818987  2145    WNDIIGATESG    2155

DUF2328: domain 1 of 1, from 2151 to 2171: score -0.0, E = 7.4
                   *->AreaGgtisveiteeavvlsa<-*
                      A e+G  +++++++e +++ +
  gi|7818987  2151    ATESGYDVTLDESGEKIRVQV    2171

Nif11: domain 1 of 1, from 2151 to 2165: score 2.8, E = 6.6
                   *->AkeaGfeisgdeLla<-*
                      A e G++++ de+++
  gi|7818987  2151    ATESGYDVTLDESGE    2165

Cu_amine_oxidN1: domain 1 of 1, from 2164 to 2182: score 2.9, E = 3.6
                CS    HHHHTSSS-.....TSEE-
                   *->aEalgakVkwdsetktvqi<-*
                      +E ++++V++++ ++++++
  gi|7818987  2164    GEKIRVQVTYTDNGGKTEV    2182

GPW_gp25: domain 1 of 1, from 2167 to 2184: score 1.4, E = 8.3
                   *->feIeaslrdenapeqlsf<-*
                      ++++ +++d+++++++++
  gi|7818987  2167    IRVQVTYTDNGGKTEVVY    2184

BNR: domain 2 of 5, from 2172 to 2180: score 1.6, E = 38
                CS    EEESSTTSS
                   *->yyStDgGkT<-*
                       y+++gGkT
  gi|7818987  2172    TYTDNGGKT    2180

Big_2: domain 2 of 5, from 2190 to 2223: score 1.7, E = 8.2
                CS    EEEEEEETTT.   TEEES--SEEETTSEEEEEEES
                   *->avtsvtvsptg...ntaslakGatlqlkatvtpsda<-*
                      av+s++++p+g+   t + ++G+tl   atvt++d+
  gi|7818987  2190    AVVSNAIDPNGtiaITGTFKQGETL--NATVTDADG    2223

FIST_C: domain 2 of 2, from 2195 to 2224: score 2.1, E = 5.2
                   *->gvdpedGsltfagdvpeGeelqlmlrdaddl<-*
                      ++dp +G++++ g +++Ge+l   ++dad +
  gi|7818987  2195    AIDP-NGTIAITGTFKQGETLNATVTDADGM    2224

PKD: domain 2 of 4, from 2204 to 2231: score 1.0, E = 9.3
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEE
                   *->vsasaveegpsvvalgetVtFtassSydpdpGspvsysW<-*
                      ++++        +++get + t ++  d+  G  vsy+W
  gi|7818987  2204    ITGT--------FKQGETLNATVTD-ADGM-G-TVSYQW    2231

EspA: domain 1 of 1, from 2213 to 2234: score 1.9, E = 3.1
                   *->tyNvlvsllnslQsllaemnks<-*
                      t+N++v+ + ++ +  ++  +s
  gi|7818987  2213    TLNATVTDADGMGTVSYQWQSS    2234

UPF0183: domain 1 of 1, from 2293 to 2303: score 0.6, E = 1.7
                   *->iaSVTLYdgAp<-*
                      i SVT+ ++A+
  gi|7818987  2293    IGSVTITGTAK    2303

Big_2: domain 3 of 5, from 2294 to 2312: score 2.5, E = 4.7
                CS    S-EEEEEEETT.TEEEEEEE
                   *->GtatItatsgdgnksasvtv<-*
                      G++tIt t++  +   ++++
  gi|7818987  2294    GSVTITGTAKQ-GEALTAKN    2312

BNR: domain 3 of 5, from 2327 to 2338: score 0.9, E = 61
                CS    EEESSTTSSEEE
                   *->yyStDgGkTWsk<-*
                      + S  +G +Ws+
  gi|7818987  2327    WQSSSDGTNWSA    2338

Porin_2: domain 1 of 2, from 2362 to 2392: score 1.4, E = 3.1
                   *->vnYtdldqkystvasvrgsdakpgteyeakkqDsvsGi<-*
                      +nYtd +++         s a+++t + a+++D+ +G
  gi|7818987  2362    ANYTD-GHNTP------ESKASVATVAVANTNDAPTGT    2392

E3_binding: domain 2 of 2, from 2394 to 2408: score 2.9, E = 11
                CS    CS--SSTCCBBHHHH
                   *->qVkGTGpgGRItkeD<-*
                      +++G+G +G I+ +D
  gi|7818987  2394    KITGSGQQGAILAAD    2408

He_PIG: domain 3 of 4, from 2404 to 2463: score 6.2, E = 0.58
                   *->tytlTkpsdgslasysttpggggLPsGLtL..........dsstGri
                        ++          +st+ ++ gLP+ L  +   ++   + +++G++
  gi|7818987  2404    ILAA---------DTSTLADADGLPTTLAYqwyaggviitGATNGTY 2441

                   tGtPtptvqpG.sytftvtatdgsg<-*
                   +   t++ + G++ t+ v++tdg+g
  gi|7818987  2442 Q--LTKN-EVGkAITVKVSYTDGGG    2463

Glucodextran_N: domain 1 of 1, from 2414 to 2445: score 2.4, E = 0.41
                CS    .....TTSS-E      EEEEE-TTSSEEEEE
                   *->DakGRplslAY......kivNtDkqGRYrIeK<-*
                      Da+G p++lAY+   +++i++ ++ G Y+++K
  gi|7818987  2414    DADGLPTTLAYqwyaggVIITGATNGTYQLTK    2445

NPCBM_assoc: domain 2 of 2, from 2446 to 2472: score 0.6, E = 20
                   *->vvaGrtvtvtatftndgttaatgVsva<-*
                       + G++ tv+++ t++g+t+ +++s+a
  gi|7818987  2446    NEVGKAITVKVSYTDGGGTPESVTSLA    2472

Pou: domain 1 of 2, from 2538 to 2548: score 0.3, E = 18
                   *->yTQadVGlALg<-*
                      +TQa+VG+A++
  gi|7818987  2538    LTQAEVGKAIT    2548

He_PIG: domain 4 of 4, from 2539 to 2558: score 0.2, E = 28
                   *->tptvqpG.sytftvtatdgsg<-*
                      t++ + G++ t+ vt+td  g
  gi|7818987  2539    TQA-EVGkAITVKVTYTDLQG    2558

Egg_lysin: domain 1 of 1, from 2541 to 2585: score 1.4, E = 6.7
                CS    HHHHHHTHCHHHHHHHHHHHCT  ------HHHHHHHCS-GGGS--T
                   *->aeiGrrnriplevfYsflvrrn..lipkwrpymakllakrpaDiPvr
                      ae+G+   i ++v+Y +l +  +      ++ +a+ ++++ ++i+++
  gi|7818987  2541    AEVGK--AITVKVTYTDLQGTTeaVTSDATASVANVNDTPTGTITIS 2585

                CS
                   <-*

  gi|7818987     -     -

MucBP: domain 2 of 2, from 2576 to 2594: score 6.0, E = 0.7
                   *->ltktvtvTvhYvDedGnel<-*
                      +t t+t+T+  +D dGn++
  gi|7818987  2576    DTPTGTITISKIDDDGNKV    2594

AIG2: domain 1 of 1, from 2611 to 2628: score 2.7, E = 1.7
                CS    EEE----SEE.EEEEEEES
                   *->eVelgdgeevveAwvYvya<-*
                      ++++gdg+    A +Y+++
  gi|7818987  2611    TLVDGDGPPA-LAVTYQWQ    2628

Bac_DnaA_C: domain 1 of 1, from 2630 to 2649: score 3.2, E = 5.6
                   *->tienIqeiVAeyynitvedl<-*
                      + ++I  +V++y+ +t++++
  gi|7818987  2630    NGADINGAVGRYFEVTQAEV    2649

Phage_Nu1: domain 1 of 1, from 2640 to 2658: score 3.5, E = 1.4
                CS    XXXXXXXXXXXXXXXXXXX
                   *->rHidvLkreIikAmnkaAa<-*
                      r+ +v   e+ k+m++ A+
  gi|7818987  2640    RYFEVTQAEVGKTMGVVAS    2658

Sigma70_r4: domain 2 of 2, from 2640 to 2655: score 4.1, E = 4.2
                CS    HCTTTTTST--HHHHHHHHTS
                   *->RfGLddgeelTLeEIGerLGi<-*
                      R+    +e  T++E+G+ +G+
  gi|7818987  2640    RY----FEV-TQAEVGKTMGV    2655

Pou: domain 2 of 2, from 2644 to 2656: score 2.0, E = 6.1
                   *->yTQadVGlALgal<-*
                      +TQa+VG+++g +
  gi|7818987  2644    VTQAEVGKTMGVV    2656

Transglut_C: domain 1 of 1, from 2684 to 2703: score 3.2, E = 2.6
                CS    EEEEEEEESEEBBTTSEEEEE
                   *->pelkikvlgeavvvGqdfdvs<-*
                      p  ++ ++g++  +Gq+++++
  gi|7818987  2684    PTGSVTISGNPT-QGQELTAI    2703

DUF512: domain 1 of 1, from 2746 to 2761: score 1.7, E = 6.4
                   *->eeaLgvpvivvrgpge<-*
                      +ea++v ++vv ++++
  gi|7818987  2746    SEADKVIRVVVSYTDK    2761

Porin_2: domain 2 of 2, from 2752 to 2786: score 0.6, E = 5
                   *->itaevnYtdldqkystvasvrgsdakpgteyeakkqDsvsGi<-*
                      i++ v+Ytd ++ +        s+++ +t+   +++D+ +G
  gi|7818987  2752    IRVVVSYTDKGNTDE-------SVNSKATRSVTNDNDAPTGT    2786

Surf_Ag_VNR: domain 1 of 1, from 2758 to 2796: score 4.7, E = 1.6
                   *->YlnlGYafadV.....svepe.dpekdggVdltfnVkEg<-*
                      Y ++G  +++V+++ ++  ++++++ +g+V++t ++kEg
  gi|7818987  2758    YTDKGNTDESVnskatRSVTNdNDAPTGTVTITGTIKEG    2796

MSA_2: domain 1 of 1, from 2772 to 2808: score 1.0, E = 2.4
                   *->tatTtTTNdaEasTsTssENsNHnaAeTntkgesevqsP<-*
                       at + TNd  a T T +     +   T t+ +s+v  P
  gi|7818987  2772    -ATRSVTNDNDAPTGTVTITGTIKEGQTLTASNSIVD-P    2808

Tymo_coat: domain 1 of 1, from 2782 to 2794: score 3.4, E = 1.9
                CS    S-SEEEEEEEEEE
                   *->tpTAsitIsGklr<-*
                      +pT ++tI+G++
  gi|7818987  2782    APTGTVTITGTIK    2794

Big_2: domain 4 of 5, from 2784 to 2803: score 2.8, E = 3.8
                CS    SS-EEEEEEETT.TEEEEEEE
                   *->kGtatItatsgdgnksasvtv<-*
                      +Gt+tIt t ++ +++ ++ +
  gi|7818987  2784    TGTVTITGTIKE-GQTLTASN    2803

DUF342: domain 1 of 1, from 2785 to 2806: score 0.0, E = 7
                   *->GsViIrGdVkdGfkVkAsGDIt<-*
                      G+V+I+G +k+G + +As +I+
  gi|7818987  2785    GTVTITGTIKEGQTLTASNSIV    2806

Fimbrial: domain 1 of 1, from 2785 to 2795: score 0.4, E = 9.8
                   *->GtvtFkGeVVd<-*
                      Gtvt++G++ +
  gi|7818987  2785    GTVTITGTIKE    2795

PKD: domain 3 of 4, from 2787 to 2836: score 4.7, E = 0.64
                CS    EESS.....SSSEBTTEEEEEEECT.B.TT  . SSECEEEEE-SS.
                   *->vsasaveegpsvvalgetVtFtassSydpd..p.GspvsysWdFGDg
                      v+ +      +++++g+t t + s   dpd+ p G++ +y+W  +D
  gi|7818987  2787    VTIT------GTIKEGQTLTASNSI-VDPDgiPaGTI-TYQWKAND- 2824

                CS SSSEEEECSSEEEEE
                   gspgttstepnvtHt<-*
                       ++ + + +t+t
  gi|7818987  2825 ---ENIYGATYATYT    2836

Rib: domain 1 of 1, from 2791 to 2821: score 8.9, E = 0.15
                   *->vtVkvGetPdatdgIkNksdLPdGTkgvdytWk<-*
                       t k G t++a+ +I + + +P+GT    y Wk
  gi|7818987  2791    GTIKEGQTLTASNSIVDPDGIPAGTI--TYQWK    2821

Big_2: domain 5 of 5, from 2879 to 2897: score 1.0, E = 13
                CS    S-EEEEEEETT.TEEEEEEE
                   *->GtatItatsgdgnksasvtv<-*
                      Gt tIt t+++ +++ ++ +
  gi|7818987  2879    GTITITGTAKE-KSTLTFVN    2897

NAC: domain 1 of 1, from 2880 to 2891: score 2.8, E = 7.6
                   *->TyvVtGeAkekn<-*
                      T ++tG Akek+
  gi|7818987  2880    TITITGTAKEKS    2891

BNR: domain 4 of 5, from 2913 to 2924: score 10.8, E = 0.062
                CS    EEESSTTSSEEE
                   *->yyStDgGkTWsk<-*
                      + StD+G TWs
  gi|7818987  2913    QSSTDNGSTWSN    2924

Glug: domain 2 of 2, from 2955 to 2970: score 0.9, E = 21
                   *->enpgsienctatgnvtvt<-*
                      +np +++ ++at   +v
  gi|7818987  2955    GNPETVRSSNATS--KVK    2970

Miro: domain 1 of 1, from 2979 to 2991: score 4.8, E = 0.77
                   *->KvvviGdkgvGKS<-*
                      K+ ++G+ ++GK+
  gi|7818987  2979    KLTIVGNAKAGKT    2991

BNR: domain 5 of 5, from 3012 to 3023: score 4.0, E = 7.1
                CS    EEESSTTSSEEE
                   *->yyStDgGkTWsk<-*
                      + StD+G  W+
  gi|7818987  3012    QSSTDNGSIWND    3023

DUF1727: domain 1 of 1, from 3015 to 3050: score -0.8, E = 9.1
                   *->eekiivepDleqaldaileatspget..lyiLaTYT<-*
                      +++ ++  D+++a+d++  +t+++  +++ ++aTYT
  gi|7818987  3015    TDNGSIWNDIDDATDSFYTLTKDDVGnnIRVVATYT    3050

YtxC: domain 1 of 1, from 3055 to 3066: score 1.7, E = 3.2
                   *->TIknVFqeRVei<-*
                      T++nVF e+  +
  gi|7818987  3055    TVENVFSEKTAT    3066

PTS_EIIA_1: domain 1 of 1, from 3154 to 3171: score 3.4, E = 1.7
                CS    SSEEE-SSSEEEEEE-TT
                   *->dGkVvAPVdGtIvqiFpT<-*
                      dG ++AP+d+t++++ +T
  gi|7818987  3154    DGSFFAPADATVISALTT    3171

DUF2134: domain 1 of 1, from 3174 to 3234: score 3.0, E = 2.6
                   *->AAAqrlsdgsaaaanssaaaaaaAaaaaarngfgggdlalslsvecG
                      AAA++ + ++a       aa++    a+ ++ +  +     +++++
  gi|7818987  3174    AAAMDSTTNAA-------AAETKVETALGLDAA--TL---GATLSLT 3208

                   ywnatdaaadspprftagaaagpvnAVrVta<-*
                    +++    a ++ ++t++aa   +nAV+V+a
  gi|7818987  3209 SYDP---LAEASKTSTTDAA--KINAVKVHA    3234

Hum_adeno_E3A: domain 1 of 1, from 3177 to 3200: score 1.1, E = 4.5
                   *->mtdttnapttdyrnatAtGLtstl<-*
                      m  ttna +++ +  tA GL +++
  gi|7818987  3177    MDSTTNAAAAETKVETALGLDAAT    3200

EppA_BapA: domain 1 of 1, from 3226 to 3231: score 0.4, E = 4.8
                   *->KInaVK<-*
                      KInaVK
  gi|7818987  3226    KINAVK    3231

YolD: domain 1 of 1, from 3237 to 3245: score 1.8, E = 6
                   *->lkledIidi<-*
                      ++l++I+d+
  gi|7818987  3237    IQLNNIMDV    3245

Phage_attach: domain 1 of 1, from 3238 to 3253: score 0.5, E = 2.7
                   *->MadfdNLFDeAisrADda<-*
                        + +N  D Ais AD a
  gi|7818987  3238    --QLNNIMDVAISVADAA    3253

Defensin_propep: domain 1 of 1, from 3244 to 3255: score 3.5, E = 3.3
                   *->DvsISFagdess<-*
                      Dv+IS+a+ ++s
  gi|7818987  3244    DVAISVADAAGS    3255

SPDY: domain 1 of 2, from 3260 to 3278: score 1.0, E = 17
                   *->aeLVaaftaaLastapvhr<-*
                      a +V +++++L+++a++++
  gi|7818987  3260    AQIVENVSDSLLAQAGTDT    3278

Bact_transglu_N: domain 1 of 1, from 3265 to 3289: score 2.1, E = 9.1
                   *->NavarfvfpgphdeLtIeaesvVet<-*
                      N+ +++  ++ +d++ +++++v+e+
  gi|7818987  3265    NVSDSLLAQAGTDTVDVTSDAVIEV    3289

IgG_binding_B: domain 2 of 2, from 3397 to 3417: score 2.0, E = 7.7
                   *->TYkLilnGkTLkGETtTeAVD<-*
                      T   ++nG+ + GE  T A D
  gi|7818987  3397    TGSVVINGVVMPGEILTAATD    3417

OKR_DC_1_C: domain 1 of 1, from 3405 to 3421: score 0.9, E = 7.2
                CS    S-TTEE--...HHHHHH
                   *->lvvPGErwteesrpvld<-*
                      +v+PGE++t ++ ++ d
  gi|7818987  3405    VVMPGEILTAATDSIAD    3421

SPDY: domain 2 of 2, from 3408 to 3427: score 6.6, E = 0.45
                   *->PaeLVaaftaaLastapvhr<-*
                      P e+++a+t++ a++++v
  gi|7818987  3408    PGEILTAATDSIADNQGVGA    3427

Autophagy_Cterm: domain 1 of 1, from 3505 to 3514: score 4.1, E = 6.4
                   *->iPTIEyDyTt<-*
                      +PT+E+D T+
  gi|7818987  3505    TPTVEVDLTN    3514

H_lectin: domain 1 of 1, from 3523 to 3548: score 4.0, E = 3.4
                   *->itsldsdnnsqnirfkvqasnvtttgFtiPv<-*
                      i+ +ds++++      ++++ +tttg t+ +
  gi|7818987  3523    IQIIDSNHGN----AVLYTETITTTGITL-K    3548

Cadherin: domain 2 of 2, from 3561 to 3587: score 2.9, E = 4.1
                CS    B--EEE----.........S---EEEE--EEE-
                   *->YeLtveAtDadpllasgggpplsstatvtitVl<-*
                      + L v+++D++      g  +l s ++ titV
  gi|7818987  3561    HALQVRLVDSA------GNEGLASNGVTTITVD    3587

Corona_M: domain 1 of 1, from 3577 to 3593: score 2.4, E = 1.4
                   *->mTNsapvcTldadeviqhL<-*
                       +N+  v+T+++d  i hL
  gi|7818987  3577    ASNG--VTTITVDTTISHL    3593

PKD: domain 4 of 4, from 3642 to 3656: score 1.2, E = 7.7
                CS    EETTCEEEEEEEEEEE
                   *->sngvgsasattttvtV<-*
                      ++gvgs++++ + ++V
  gi|7818987  3642    WDGVGSNATK-IDLKV    3656

TMP: domain 2 of 2, from 3642 to 3652: score 4.0, E = 8.3
                   *->WngIkgffsga<-*
                      W+g+ + ++++
  gi|7818987  3642    WDGVGSNATKI    3652

BiPBP_C: domain 1 of 1, from 3654 to 3670: score 5.5, E = 0.55
                   *->LtVvDadGrsdrv.Vrf<-*
                      L V+D++G++d+  V++
  gi|7818987  3654    LKVQDEAGNTDTEaVTI    3670

HYR: domain 1 of 1, from 3656 to 3672: score 1.8, E = 6.4
                   *->atDnaGNeAdsCtFtVtV<-*
                      ++D+aGN++ +  +t+ V
  gi|7818987  3656    VQDEAGNTD-TEAVTIPV    3672

DUF1781: domain 1 of 1, from 3678 to 3689: score 1.3, E = 6
                CS    EEE-STTTSSS-
                   *->vTIhdhLWqkKk<-*
                      +TIh ++W   k
  gi|7818987  3678    LTIHTAYWKDSK    3689

Dockerin_1: domain 2 of 2, from 3761 to 3781: score 4.6, E = 2.9
                CS    -TT-SS--SHHHHHHHHHHH-
                   *->DvNgDGkVnalDlallkkyll<-*
                      D +g GkV  lD++ + kyl
  gi|7818987  3761    DYDGSGKVGLLDAVGVLKYLV    3781

//