hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 78189873.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|78189873|ref|YP_380211.1|
Accession: [none]
Description: hypothetical protein Cag_1920 [Chlorobium chlorochromatii CaD3]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
BNR BNR/Asp-box repeat 25.8 1.8e-06 5
HemolysinCabind Hemolysin-type calcium-binding repeat 23.7 5.1e-06 3
PKD PKD domain 9.3 0.025 4
Bac_export_3 Bacterial export proteins, family 3 9.8 0.034 1
Big_2 Bacterial Ig-like domain (group 2) 9.9 0.034 5
Rib Rib/alpha-like repeat 8.9 0.15 1
He_PIG Putative Ig domain 7.9 0.18 4
SHQ1 SHQ1 protein 4.4 0.21 1
SPDY Domain of unknown function (DUF317) 7.7 0.23 2
A2M_N Alpha-2-macroglobulin family N-termin 4.7 0.36 1
FIST_C FIST C domain 6.2 0.38 2
Ubiq-assoc Ubiquitin-associated 6.8 0.4 1
Glucodextran_N Glucodextranase, domain N 2.4 0.41 1
ATP-gua_Ptrans ATP:guanido phosphotransferase, C-ter 5.1 0.48 1
Kinin Insect kinin peptide 6.0 0.52 1
BiPBP_C Penicillin-Binding Protein C-terminus 5.5 0.55 1
MucBP MucBP domain 6.3 0.59 2
RE_HindVP HindVP restriction endonuclease 4.2 0.68 2
Miro Miro-like protein 4.8 0.77 1
DUF2006 Proteins of unknown function (DUF2006 0.7 0.87 1
Dockerin_1 Dockerin type I repeat 6.1 0.96 2
Cadherin Cadherin domain 4.9 1.1 2
Glyco_hydro_61 Glycosyl hydrolase family 61 3.3 1.1 1
NPCBM_assoc NPCBM-associated, NEW3 domain of alph 4.8 1.2 2
Sigma70_r4 Sigma-70, region 4 5.9 1.3 2
3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD 3.3 1.4 1
Phage_Nu1 Phage DNA packaging protein Nu1 3.5 1.4 1
Corona_M Coronavirus M matrix/glycoprotein 2.4 1.4 1
Surf_Ag_VNR Surface antigen variable number repea 4.7 1.6 1
PTS_EIIA_1 phosphoenolpyruvate-dependent sugar p 3.4 1.7 1
AIG2 AIG2-like family 2.7 1.7 1
UPF0183 Uncharacterised protein family (UPF01 0.6 1.7 1
NUMOD1 NUMOD1 domain 5.7 1.8 1
Tymo_coat Tymovirus coat protein 3.4 1.9 1
Porin_2 Porin subfamily 2.0 2.1 2
TMP TMP repeat 5.9 2.4 2
MSA_2 Merozoite Surface Antigen 2 (MSA-2) f 1.0 2.4 1
DUF2134 Predicted membrane protein (DUF2134) 3.0 2.6 1
Transglut_C Transglutaminase family, C-terminal i 3.2 2.6 1
Phage_attach Phage Head-Tail Attachment 0.5 2.7 1
RTX_C RTX C-terminal domain 2.5 3.1 1
EspA EspA-like secreted protein 1.9 3.1 1
DUF162 Uncharacterised ACR, YkgG family COG1 3.6 3.1 1
YtxC YtxC-like family 1.7 3.2 1
Defensin_propep Defensin propeptide 3.5 3.3 1
CreA CreA protein 2.3 3.3 1
Poly_export Polysaccharide biosynthesis/export pr 3.5 3.4 1
H_lectin H-type lectin domain 4.0 3.4 1
Gp5_C Gp5 C-terminal repeat (3 copies) 4.2 3.6 1
Cu_amine_oxidN1 Copper amine oxidase N-terminal domai 2.9 3.6 1
Enterotoxin_b Heat-labile enterotoxin beta chain 1.6 3.6 1
Red1 Rec10 / Red1 -0.2 3.7 1
DUF1681 Protein of unknown function (DUF1681) 2.2 3.8 1
Glug The GLUG motif 3.3 4 2
RNA_capsid Calicivirus putative RNA polymerase/c -0.0 4.4 1
Hum_adeno_E3A Human adenovirus early E3A glycoprote 1.1 4.5 1
AmoC Ammonia monooxygenase/methane monooxy 1.0 4.7 1
EppA_BapA Exported protein precursor (EppA/BapA 0.4 4.8 1
Pou Pou domain - N-terminal to homeobox d 2.4 4.9 2
ClpB_D2-small C-terminal, D2-small domain, of ClpB 1.7 5 1
DUF1132 Protein of unknown function (DUF1132) 0.9 5.2 1
Thionin Plant thionin 2.8 5.3 1
Bac_DnaA_C Bacterial dnaA protein helix-turn-h 3.2 5.6 1
Pox_E8 Poxvirus E8 protein 1.0 5.8 1
TnsA_N TnsA endonuclease N terminal 1.5 5.9 1
DUF1781 Protein of unknown function (DUF1781) 1.3 6 1
Big_1 Bacterial Ig-like domain (group 1) 1.2 6 1
YolD YolD-like protein 1.8 6 1
Dopey_N Dopey, N-terminal 0.2 6 1
DUF106 Integral membrane protein DUF106 0.3 6.1 1
DUF1892 Protein of unknown function (DUF1892) 1.4 6.2 1
IgG_binding_B B domain 2.3 6.3 2
ATP-synt_8 ATP synthase protein 8 1.4 6.4 1
DUF512 Protein of unknown function (DUF512) 1.7 6.4 1
HYR HYR domain 1.8 6.4 1
Autophagy_Cterm Autophagocytosis associated protein, 4.1 6.4 1
Nif11 Nitrogen fixation protein of unknown 2.8 6.6 1
Egg_lysin Egg lysin (Sperm-lysin) 1.4 6.7 1
E3_binding e3 binding domain 3.6 6.9 2
DUF342 Protein of unknown function (DUF342) 0.0 7 1
OKR_DC_1_C Orn/Lys/Arg decarboxylase, C-terminal 0.9 7.2 1
PNPOx_C Pyridoxine 5'-phosphate oxidase C-ter 0.2 7.3 1
CobN-Mg_chel CobN/Magnesium Chelatase -1.7 7.3 1
DUF2328 Uncharacterized protein conserved in -0.0 7.4 1
Glyco_hydro_20b Glycosyl hydrolase family 20, domain 0.9 7.5 1
NAC NAC domain 2.8 7.6 1
Penicil_amidase Penicillin amidase -1.5 7.7 1
PRA-PH Phosphoribosyl-ATP pyrophosphohydrola 2.3 7.8 1
Ribosomal_S17 Ribosomal protein S17 2.2 7.8 2
DUF1888 Domain of unknown function (DUF1888) 1.2 7.9 1
FaeA FaeA-like protein 3.1 7.9 1
GPW_gp25 Gene 25-like lysozyme 1.4 8.3 1
DUF1921 Domain of unknown function (DUF1921) 0.6 8.3 1
Spheroidin Entomopoxvirus spheroidin protein -1.4 8.7 1
MTH865 MTH865-like family 1.8 8.9 1
Bact_transglu_N Bacterial transglutaminase-like N-ter 2.1 9.1 1
Benyvirus_P25 Benyvirus P25 protein -0.3 9.1 1
DUF1727 Domain of unknown function (DUF1727) -0.8 9.1 1
Herpes_ICP4_C Herpesvirus ICP4-like protein C-termi -1.4 9.2 1
Glyoxal_oxid_N Glyoxal oxidase N-terminus -2.0 9.4 1
PrmA Ribosomal protein L11 methyltransfera -0.4 9.4 1
WAC_Acf1_DNA_bd ATP-utilising chromatin assembly and 1.6 9.5 1
MEA1 Male enhanced antigen 1 (MEA1) -1.0 9.6 1
HtaA Htaa -0.0 9.6 1
CP12 CP12 domain 1.2 9.7 1
Fimbrial Fimbrial protein 0.4 9.8 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
Thionin 1/1 19 26 .. 1 8 [. 2.8 5.3
Red1 1/1 44 59 .. 202 217 .. -0.2 3.7
Spheroidin 1/1 69 77 .. 1013 1021 .] -1.4 8.7
DUF1921 1/1 143 153 .. 1 11 [. 0.6 8.3
HtaA 1/1 216 229 .. 183 196 .] -0.0 9.6
Kinin 1/1 241 248 .. 1 8 [] 6.0 0.52
RNA_capsid 1/1 258 273 .. 1 18 [. -0.0 4.4
Glug 1/2 261 278 .. 8 38 .] 2.4 7.3
CreA 1/1 330 340 .. 146 156 .] 2.3 3.3
WAC_Acf1_DNA_bd 1/1 350 356 .. 96 102 .] 1.6 9.5
DUF106 1/1 380 391 .. 1 12 [. 0.3 6.1
He_PIG 1/4 407 431 .. 35 61 .] 0.8 19
DUF2006 1/1 455 471 .. 375 395 .] 0.7 0.87
DUF1888 1/1 484 495 .. 95 106 .. 1.2 7.9
E3_binding 1/2 562 573 .. 28 39 .] 0.7 42
Ribosomal_S17 1/2 564 577 .. 1 14 [. 1.7 10
RE_HindVP 1/2 626 636 .. 1 11 [. 3.0 1.4
ATP-gua_Ptrans 1/1 646 661 .. 1 16 [. 5.1 0.48
PKD 1/4 688 724 .. 1 38 [. 2.4 3.5
A2M_N 1/1 739 789 .. 214 269 .. 4.7 0.36
Cadherin 1/2 755 777 .. 1 23 [. 2.0 7.2
Glyco_hydro_61 1/1 757 771 .. 174 188 .. 3.3 1.1
NPCBM_assoc 1/2 758 777 .. 61 86 .] 4.2 1.8
He_PIG 2/4 760 779 .. 41 61 .] 0.7 21
PRA-PH 1/1 762 776 .. 14 28 .. 2.3 7.8
3HCDH_N 1/1 828 850 .. 12 34 .. 3.3 1.4
Ribosomal_S17 2/2 916 925 .. 1 10 [. 0.4 24
AmoC 1/1 925 936 .. 245 256 .] 1.0 4.7
DUF1892 1/1 936 957 .. 94 117 .] 1.4 6.2
Dockerin_1 1/2 966 972 .. 1 7 [. 1.6 24
HemolysinCabind 1/3 974 985 .. 7 18 .] 3.5 7
RE_HindVP 2/2 979 989 .. 1 11 [. 1.2 4.3
DUF162 1/1 1047 1065 .. 1 21 [. 3.6 3.1
HemolysinCabind 2/3 1159 1176 .. 1 18 [] 14.9 0.0024
Benyvirus_P25 1/1 1174 1195 .. 200 219 .] -0.3 9.1
HemolysinCabind 3/3 1177 1190 .. 1 14 [. 5.4 1.8
ATP-synt_8 1/1 1206 1210 .. 1 5 [. 1.4 6.4
Poly_export 1/1 1234 1259 .. 1 26 [. 3.5 3.4
PNPOx_C 1/1 1236 1242 .. 51 57 .] 0.2 7.3
MEA1 1/1 1289 1312 .. 151 174 .] -1.0 9.6
Gp5_C 1/1 1360 1384 .. 1 24 [] 4.2 3.6
SHQ1 1/1 1372 1392 .. 1 25 [. 4.4 0.21
Dopey_N 1/1 1376 1386 .. 308 318 .] 0.2 6
CP12 1/1 1398 1408 .. 32 42 .. 1.2 9.7
Bac_export_3 1/1 1426 1438 .. 64 76 .] 9.8 0.034
FaeA 1/1 1441 1448 .. 1 8 [. 3.1 7.9
RTX_C 1/1 1463 1503 .. 99 145 .. 2.5 3.1
Sigma70_r4 1/2 1466 1483 .. 24 41 .. 1.9 17
MucBP 1/2 1472 1487 .. 1 16 [. 0.3 25
Big_2 1/5 1508 1527 .. 70 90 .] 1.8 7.7
ClpB_D2-small 1/1 1513 1536 .. 71 95 .] 1.7 5
MTH865 1/1 1521 1536 .. 65 81 .] 1.8 8.9
IgG_binding_B 1/2 1549 1564 .. 41 56 .] 0.3 23
Herpes_ICP4_C 1/1 1551 1587 .. 413 451 .] -1.4 9.2
CobN-Mg_chel 1/1 1639 1647 .. 1225 1234 .] -1.7 7.3
Glyoxal_oxid_N 1/1 1691 1707 .. 204 223 .. -2.0 9.4
Enterotoxin_b 1/1 1781 1801 .. 1 22 [. 1.6 3.6
NUMOD1 1/1 1792 1815 .. 1 22 [. 5.7 1.8
FIST_C 1/2 1801 1821 .. 53 73 .. 4.1 1.4
DUF1681 1/1 1814 1834 .. 168 179 .] 2.2 3.8
PrmA 1/1 1901 1910 .. 303 312 .] -0.4 9.4
DUF1132 1/1 1941 1950 .. 91 100 .] 0.9 5.2
Glyco_hydro_20b 1/1 1947 1986 .. 42 85 .. 0.9 7.5
Penicil_amidase 1/1 1954 1969 .. 868 883 .] -1.5 7.7
Pox_E8 1/1 1959 1980 .. 112 133 .. 1.0 5.8
Big_1 1/1 2009 2029 .. 55 76 .. 1.2 6
TnsA_N 1/1 2034 2048 .. 94 108 .] 1.5 5.9
Ubiq-assoc 1/1 2066 2076 .. 24 34 .. 6.8 0.4
BNR 1/5 2136 2147 .. 1 12 [] 8.5 0.3
TMP 1/2 2145 2155 .. 1 11 [] 1.8 37
DUF2328 1/1 2151 2171 .. 168 188 .] -0.0 7.4
Nif11 1/1 2151 2165 .. 36 50 .] 2.8 6.6
Cu_amine_oxidN1 1/1 2164 2182 .. 76 94 .] 2.9 3.6
GPW_gp25 1/1 2167 2184 .. 97 114 .] 1.4 8.3
BNR 2/5 2172 2180 .. 1 9 [. 1.6 38
Big_2 2/5 2190 2223 .. 1 33 [. 1.7 8.2
FIST_C 2/2 2195 2224 .. 51 81 .. 2.1 5.2
PKD 2/4 2204 2231 .. 1 39 [. 1.0 9.3
EspA 1/1 2213 2234 .. 257 278 .] 1.9 3.1
UPF0183 1/1 2293 2303 .. 403 413 .] 0.6 1.7
Big_2 3/5 2294 2312 .. 71 90 .] 2.5 4.7
BNR 3/5 2327 2338 .. 1 12 [] 0.9 61
Porin_2 1/2 2362 2392 .. 468 505 .] 1.4 3.1
E3_binding 2/2 2394 2408 .. 22 36 .. 2.9 11
He_PIG 3/4 2404 2463 .. 1 61 [] 6.2 0.58
Glucodextran_N 1/1 2414 2445 .. 97 122 .. 2.4 0.41
NPCBM_assoc 2/2 2446 2472 .. 1 27 [. 0.6 20
Pou 1/2 2538 2548 .. 25 35 .. 0.3 18
He_PIG 4/4 2539 2558 .. 42 61 .] 0.2 28
Egg_lysin 1/1 2541 2585 .. 119 163 .] 1.4 6.7
MucBP 2/2 2576 2594 .. 1 19 [. 6.0 0.7
AIG2 1/1 2611 2628 .. 101 119 .] 2.7 1.7
Bac_DnaA_C 1/1 2630 2649 .. 1 20 [. 3.2 5.6
Phage_Nu1 1/1 2640 2658 .. 148 166 .] 3.5 1.4
Sigma70_r4 2/2 2640 2655 .. 16 36 .. 4.1 4.2
Pou 2/2 2644 2656 .. 25 37 .. 2.0 6.1
Transglut_C 1/1 2684 2703 .. 1 21 [. 3.2 2.6
DUF512 1/1 2746 2761 .. 198 213 .] 1.7 6.4
Porin_2 2/2 2752 2786 .. 464 505 .] 0.6 5
Surf_Ag_VNR 1/1 2758 2796 .. 52 84 .] 4.7 1.6
MSA_2 1/1 2772 2808 .. 1 39 [. 1.0 2.4
Tymo_coat 1/1 2782 2794 .. 164 176 .] 3.4 1.9
Big_2 4/5 2784 2803 .. 70 90 .] 2.8 3.8
DUF342 1/1 2785 2806 .. 206 227 .. 0.0 7
Fimbrial 1/1 2785 2795 .. 1 11 [. 0.4 9.8
PKD 3/4 2787 2836 .. 1 59 [. 4.7 0.64
Rib 1/1 2791 2821 .. 1 33 [. 8.9 0.15
Big_2 5/5 2879 2897 .. 71 90 .] 1.0 13
NAC 1/1 2880 2891 .. 50 61 .] 2.8 7.6
BNR 4/5 2913 2924 .. 1 12 [] 10.8 0.062
Glug 2/2 2955 2970 .. 21 38 .] 0.9 21
Miro 1/1 2979 2991 .. 1 13 [. 4.8 0.77
BNR 5/5 3012 3023 .. 1 12 [] 4.0 7.1
DUF1727 1/1 3015 3050 .. 81 114 .. -0.8 9.1
YtxC 1/1 3055 3066 .. 212 223 .] 1.7 3.2
PTS_EIIA_1 1/1 3154 3171 .. 40 57 .. 3.4 1.7
DUF2134 1/1 3174 3234 .. 1 78 [. 3.0 2.6
Hum_adeno_E3A 1/1 3177 3200 .. 1 24 [. 1.1 4.5
EppA_BapA 1/1 3226 3231 .. 165 170 .] 0.4 4.8
YolD 1/1 3237 3245 .. 85 93 .] 1.8 6
Phage_attach 1/1 3238 3253 .. 1 18 [. 0.5 2.7
Defensin_propep 1/1 3244 3255 .. 43 54 .] 3.5 3.3
SPDY 1/2 3260 3278 .. 53 71 .] 1.0 17
Bact_transglu_N 1/1 3265 3289 .. 57 81 .] 2.1 9.1
IgG_binding_B 2/2 3397 3417 .. 1 21 [. 2.0 7.7
OKR_DC_1_C 1/1 3405 3421 .. 91 107 .. 0.9 7.2
SPDY 2/2 3408 3427 .. 52 71 .] 6.6 0.45
Autophagy_Cterm 1/1 3505 3514 .. 16 25 .] 4.1 6.4
H_lectin 1/1 3523 3548 .. 24 54 .. 4.0 3.4
Cadherin 2/2 3561 3587 .. 75 107 .] 2.9 4.1
Corona_M 1/1 3577 3593 .. 1 19 [. 2.4 1.4
PKD 4/4 3642 3656 .. 77 92 .] 1.2 7.7
TMP 2/2 3642 3652 .. 1 11 [] 4.0 8.3
BiPBP_C 1/1 3654 3670 .. 79 94 .] 5.5 0.55
HYR 1/1 3656 3672 .. 69 86 .] 1.8 6.4
DUF1781 1/1 3678 3689 .. 120 131 .] 1.3 6
Dockerin_1 2/2 3761 3781 .. 1 21 [] 4.6 2.9
Alignments of top-scoring domains:
Thionin: domain 1 of 1, from 19 to 26: score 2.8, E = 5.3
CS -EEBSSHH
*->KSCCpsTt<-*
KSCC +++
gi|7818987 19 KSCCENIA 26
Red1: domain 1 of 1, from 44 to 59: score -0.2, E = 3.7
*->rdvtpFekcvlsphek<-*
+++tpF+++vl++he+
gi|7818987 44 TSLTPFTDIVLVTHEA 59
Spheroidin: domain 1 of 1, from 69 to 77: score -1.4, E = 8.7
*->WAnGYrksH<-*
+A GY+++H
gi|7818987 69 FAAGYEHIH 77
DUF1921: domain 1 of 1, from 143 to 153: score 0.6, E = 8.3
CS TTSSSEEEEEE
*->sGfsGLvatvs<-*
+ fsGLv+ s
gi|7818987 143 TAFSGLVGAAS 153
HtaA: domain 1 of 1, from 216 to 229: score -0.0, E = 9.6
*->AGtaLDPvslsltl<-*
AGt+ ++v+++l+
gi|7818987 216 AGTTINAVDFTLAY 229
Kinin: domain 1 of 1, from 241 to 248: score 6.0, E = 0.52
*->sPaFnsWG<-*
+PaF+sW
gi|7818987 241 HPAFSSWT 248
RNA_capsid: domain 1 of 1, from 258 to 273: score -0.0, E = 4.4
*->MAgAfigglAadalgsal<-*
g +i+glA+d+ s++
gi|7818987 258 --GVIIAGLAGDITNSSV 273
Glug: domain 1 of 2, from 261 to 278: score 2.4, E = 7.3
*->LvGgaegggrGeqenpgsienctatgnvtvt<-*
++G a g+i+n+++ + + t
gi|7818987 261 IAGLA-----------GDITNSSVYN--SFT 278
CreA: domain 1 of 1, from 330 to 340: score 2.3, E = 3.3
*->vsTVPLygqqv<-*
+sTVP+++++
gi|7818987 330 LSTVPVWNTDL 340
WAC_Acf1_DNA_bd: domain 1 of 1, from 350 to 356: score 1.6, E = 9.5
*->FFpGEeV<-*
+ pGE+V
gi|7818987 350 YAPGETV 356
DUF106: domain 1 of 1, from 380 to 391: score 0.3, E = 6.1
*->ggaldvvlgPli<-*
g+++d+v+ Pl+
gi|7818987 380 GQVVDNVFQPLS 391
He_PIG: domain 1 of 4, from 407 to 431: score 0.8, E = 19
*->GritGtPtptvqpGsytftvtatdgsg<-*
G++t ++++ + Gsy +++ a d +g
gi|7818987 407 GSFT--VPSIAPVGSYVVRLLADDHAG 431
DUF2006: domain 1 of 1, from 455 to 471: score 0.7, E = 0.87
*->g.tGshvsG.pVsGrGYlElTGY<-*
+++G+ G+pV+G+GY Y
gi|7818987 455 NtSGTI-DGsPVAGEGY-----Y 471
DUF1888: domain 1 of 1, from 484 to 495: score 1.2, E = 7.9
*->ipGtTkFqfVLs<-*
i G+T+FqfV +
gi|7818987 484 IAGDTGFQFVIT 495
E3_binding: domain 1 of 2, from 562 to 573: score 0.7, E = 42
CS TCCBBHHHHHHH
*->pgGRItkeDVea<-*
p+G I+++D ++
gi|7818987 562 PDGIIVRDDMDN 573
Ribosomal_S17: domain 1 of 2, from 564 to 577: score 1.7, E = 10
CS S-SS-SSSS-----
*->GvVvsdkMeKTvvV<-*
G v+d+M++ v+V
gi|7818987 564 GIIVRDDMDNQVAV 577
RE_HindVP: domain 1 of 2, from 626 to 636: score 3.0, E = 1.4
*->aWGKNQFNsSF<-*
WG QFN SF
gi|7818987 626 NWGDEQFNDSF 636
ATP-gua_Ptrans: domain 1 of 1, from 646 to 661: score 5.1, E = 0.48
CS ---TTTEEEEEEEEEE
*->dpdgkyVlSsRVRtGR<-*
+pd+ +V+S+++R GR
gi|7818987 646 QPDEWMVTSTKIRAGR 661
PKD: domain 1 of 4, from 688 to 724: score 2.4, E = 3.5
CS EESS.....SSSEBTTEEEEEEECT.B.TT . SSECEEE
*->vsasaveegpsvvalgetVtFtassSydpd.....p.Gspvsys<-*
v+ + p ++ +g++++F++ + +d ++p+G++++ys
gi|7818987 688 VQLP-----PLMFTQGQNINFSDYA--LADlyatdPnGDAITYS 724
A2M_N: domain 1 of 1, from 739 to 789: score 4.7, E = 0.36
CS -EEEEEEEE-.T...TTTTEEEEEEE--SS---EEEEEEEEET T-T
*->nrvrqwllvkatetgnefGifsgsfpLpeeaplGtWtieveyd.pdg
+++++ +++ +e + + +gsf++p +ap+G++ +++ +d+++g
gi|7818987 739 QEFSELPVW--MEEA----GLQGSFTIPTNAPTGSYVLRLLADdHAG 779
CS TSEEEEEEEE
gslgsasFrV<-*
++++ + V
gi|7818987 780 DTYAGTALDV 789
Cadherin: domain 1 of 2, from 755 to 777: score 2.0, E = 7.2
CS --EEE-SS...S---EEEEE---
*->ysasvpEnapvGtevltvtAtDa<-*
s+++p nap+G+ vl++ A D+
gi|7818987 755 GSFTIPTNAPTGSYVLRLLADDH 777
Glyco_hydro_61: domain 1 of 1, from 757 to 771: score 3.3, E = 1.1
*->vkiPddLpSGaYlvR<-*
++iP++ p G Y++R
gi|7818987 757 FTIPTNAPTGSYVLR 771
NPCBM_assoc: domain 1 of 2, from 758 to 777: score 4.2, E = 1.8
*->tpPadAaAGdPYHPYtltasAsYtvs<-*
t+P++A++G+ Y l++ A ++
gi|7818987 758 TIPTNAPTGS----YVLRLLAD--DH 777
He_PIG: domain 2 of 4, from 760 to 779: score 0.7, E = 21
*->PtptvqpGsytftvtatdgsg<-*
Pt + ++Gsy ++ a d +g
gi|7818987 760 PTNA-PTGSYVLRLLADDHAG 779
PRA-PH: domain 1 of 1, from 762 to 776: score 2.3, E = 7.8
*->aaPegSYTakLfadD<-*
+aP+gSY+ +L+adD
gi|7818987 762 NAPTGSYVLRLLADD 776
3HCDH_N: domain 1 of 1, from 828 to 850: score 3.3, E = 1.4
CS HHHHHHHHTT.SEEEEE-S-HHH
*->aGIAqvfAraGleVvlvDiseea<-*
+GIA+vf +G++V+l++++ +a
gi|7818987 828 TGIAAVFGDSGFQVNLFEVASDA 850
Ribosomal_S17: domain 2 of 2, from 916 to 925: score 0.4, E = 24
CS S-SS-SSSS-
*->GvVvsdkMeK<-*
G Vv d+M++
gi|7818987 916 GIVVEDDMDN 925
AmoC: domain 1 of 1, from 925 to 936: score 1.0, E = 4.7
*->nLvdvewnkqlr<-*
nLvdv++n q r
gi|7818987 925 NLVDVDLNWQTR 936
DUF1892: domain 1 of 1, from 936 to 957: score 1.4, E = 6.2
CS .HHHHHHHHHHHHHH........-
*->reevvkkvkdFveqneldeeeeed<-*
r+ev + + +F+ +++++ed
gi|7818987 936 RDEVTGAIATFSTTV--KNKDNED 957
Dockerin_1: domain 1 of 2, from 966 to 972: score 1.6, E = 24
CS -TT-SS-
*->DvNgDGk<-*
D+N+DG+
gi|7818987 966 DINNDGV 972
HemolysinCabind: domain 1 of 3, from 974 to 985: score 3.5, E = 7
CS -EEEEESSCGEE
*->DtLyGgaGnDtl<-*
D+ G+ GnD++
gi|7818987 974 DRVVGNWGNDQF 985
RE_HindVP: domain 2 of 2, from 979 to 989: score 1.2, E = 4.3
*->aWGKNQFNsSF<-*
WG QFN +F
gi|7818987 979 NWGNDQFNDAF 989
DUF162: domain 1 of 1, from 1047 to 1065: score 3.6, E = 3.1
*->dadvGItgAnfaiAETGtlvL<-*
+ d+GItgA +AETG++v+
gi|7818987 1047 TYDIGITGAS--LAETGAIVV 1065
HemolysinCabind: domain 2 of 3, from 1159 to 1176: score 14.9, E = 0.0024
CS E--SSS-EEEEESSCGEE
*->yGGaGnDtLyGgaGnDtl<-*
G+ nD++ gaG+D+l
gi|7818987 1159 LGTSNNDSIAAGAGDDVL 1176
Benyvirus_P25: domain 1 of 1, from 1174 to 1195: score -0.3, E = 9.1
*->DvLD..vDnnviqAPDGvDDdd<-*
DvLD +v n i A DG D +
gi|7818987 1174 DVLDwsVGNDTIDAGDGYDHQY 1195
HemolysinCabind: domain 3 of 3, from 1177 to 1190: score 5.4, E = 1.8
CS E--SSS-EEEEESS
*->yGGaGnDtLyGgaG<-*
+ GnDt++ g+G
gi|7818987 1177 DWSVGNDTIDAGDG 1190
ATP-synt_8: domain 1 of 1, from 1206 to 1210: score 1.4, E = 6.4
*->MPQLn<-*
MPQL+
gi|7818987 1206 MPQLD 1210
Poly_export: domain 1 of 1, from 1234 to 1259: score 3.5, E = 3.4
*->aplaavavspeYrlGpGDklrVtVfg<-*
++ + ++ eYr++ +D + VtV++
gi|7818987 1234 VYRITRLAPSEYRIDSMDSIGVTVVQ 1259
PNPOx_C: domain 1 of 1, from 1236 to 1242: score 0.2, E = 7.3
*->sieRLaP<-*
+i+RLaP
gi|7818987 1236 RITRLAP 1242
MEA1: domain 1 of 1, from 1289 to 1312: score -1.0, E = 9.6
*->isDAqWEDvvqKALqARqAsPAWK<-*
+s W+Dv+ Lq AsP
gi|7818987 1289 VSGTAWDDVISVDLQSFIASPFTS 1312
Gp5_C: domain 1 of 1, from 1360 to 1384: score 4.2, E = 3.6
CS S-EEEEESS-EEEEES SEEEEEES
*->GnesltVkGnrtvtVg.GnqTtsVg<-*
G++++t G +t+tVg+G+ + sV+
gi|7818987 1360 GQLQVTSTGYVTLTVGsGDTALSVS 1384
SHQ1: domain 1 of 1, from 1372 to 1392: score 4.4, E = 0.21
*->LeWYvssekenqeqllefsdEerkq<-*
L+ v s+ ++ +++s++e++q
gi|7818987 1372 LT--VGSGDTAL--SVSLSNIEKYQ 1392
Dopey_N: domain 1 of 1, from 1376 to 1386: score 0.2, E = 6
*->skdTelvvsdS<-*
s+dT l+vs+S
gi|7818987 1376 SGDTALSVSLS 1386
CP12: domain 1 of 1, from 1398 to 1408: score 1.2, E = 9.7
*->VVEELsAeAaH<-*
VVEEL+ +A+H
gi|7818987 1398 VVEELDVAASH 1408
Bac_export_3: domain 1 of 1, from 1426 to 1438: score 9.8, E = 0.034
*->pWMlqtlldFtre<-*
+WMl+ lldFt e
gi|7818987 1426 GWMLNALLDFTDE 1438
FaeA: domain 1 of 1, from 1441 to 1448: score 3.1, E = 7.9
*->MKeeILef<-*
M+++I+++
gi|7818987 1441 MSNSIITY 1448
RTX_C: domain 1 of 1, from 1463 to 1503: score 2.5, E = 3.1
*->tsselekQNESNLSSLKTELGKii....yvadnyglakqgnnkhlsa
+s+el++ TELGK ++ + +++d+yg n+++++a
gi|7818987 1463 SSYELTQ----------TELGKQLsvtvSYVDDYGGHESVNSLATTA 1499
lans<-*
+ ns
gi|7818987 1500 IQNS 1503
Sigma70_r4: domain 1 of 2, from 1466 to 1483: score 1.9, E = 17
CS T--HHHHHHHHTS-HHHH
*->elTLeEIGerLGiSreRV<-*
elT+ E+G+ L ++ + V
gi|7818987 1466 ELTQTELGKQLSVTVSYV 1483
MucBP: domain 1 of 2, from 1472 to 1487: score 0.3, E = 25
*->ltktvtvTvhYvDedG<-*
l k+ +vTv YvD G
gi|7818987 1472 LGKQLSVTVSYVDDYG 1487
Big_2: domain 1 of 5, from 1508 to 1527: score 1.8, E = 7.7
CS SS-EEEEEEETT.TEEEEEEE
*->kGtatItatsgdgnksasvtv<-*
+G+ tIt t+ +k+ +v v
gi|7818987 1508 EGKPTITGTAAQ-GKTLTVDV 1527
ClpB_D2-small: domain 1 of 1, from 1513 to 1536: score 1.7, E = 5
CS HHSSS-TT-EEEEEE-.....SSSE
*->LsGelkeGdtvrvdvddgeggelvf<-*
+ G+ + G+t++vdv g ++e+ +
gi|7818987 1513 ITGTAAQGKTLTVDVS-GITDEDGL 1536
MTH865: domain 1 of 1, from 1521 to 1536: score 1.8, E = 8.9
CS HHHHHHHH....HHH--
*->edlAdklvAGLKdkagL<-*
++l ++++ G+ d++gL
gi|7818987 1521 KTLTVDVS-GITDEDGL 1536
IgG_binding_B: domain 1 of 2, from 1549 to 1564: score 0.3, E = 23
*->Gewlydtatktftvte<-*
G + dt tft +e
gi|7818987 1549 GMPIDDTTASTFTLQE 1564
Herpes_ICP4_C: domain 1 of 1, from 1551 to 1587: score -1.4, E = 9.2
*->nppegtsaalyslaeamvAhpriPsvtWdsgfGgsaeTv<-*
++++ t+++ ++l e v h + +v +fG+ +eTv
gi|7818987 1551 PIDDTTAST-FTLQETQVWHQISVAVSYTDDFGQ-EETV 1587
CobN-Mg_chel: domain 1 of 1, from 1639 to 1647: score -1.7, E = 7.3
RF xxxxxxxxxx
*->Wkpadeetle<-*
Wk ad +++e
gi|7818987 1639 WK-ADGAIIE 1647
Glyoxal_oxid_N: domain 1 of 1, from 1691 to 1707: score -2.0, E = 9.4
*->FVfLLPDDDGGNLFIFANnR<-*
+V+ LPD G +FI+ N +
gi|7818987 1691 RVNNLPD---GYVFIVGNQQ 1707
Enterotoxin_b: domain 1 of 1, from 1781 to 1801: score 1.6, E = 3.6
CS --SSHHHHHTTSTTEEEEEEEE
*->aPqniteLCaEYhntqiytlnD<-*
P n te + Y iy lnD
gi|7818987 1781 -PHNTTESLSSYYSVFIYNLND 1801
NUMOD1: domain 1 of 1, from 1792 to 1815: score 5.7, E = 1.8
*->kpVyvYDlngnligk..iFsSire<-*
+ V++Y+ln++ +g+ +i+ +i+e
gi|7818987 1792 YSVFIYNLNDEPTGEitIYGTIKE 1815
FIST_C: domain 1 of 2, from 1801 to 1821: score 4.1, E = 1.4
*->dpedGsltfagdvpeGeelql<-*
d+ +G +t++g ++eGe+l++
gi|7818987 1801 DEPTGEITIYGTIKEGETLTV 1821
DUF1681: domain 1 of 1, from 1814 to 1834: score 2.2, E = 3.8
*->KeGETIsIn.........Lgg<-*
KeGET+++n+++ + ++Lg+
gi|7818987 1814 KEGETLTVNtstladadgLGE 1834
PrmA: domain 1 of 1, from 1901 to 1910: score -0.4, E = 9.4
*->eWvcIvgkkk<-*
+Wv+I+g+ +
gi|7818987 1901 GWVTISGTAT 1910
DUF1132: domain 1 of 1, from 1941 to 1950: score 0.9, E = 5.2
*->DninfddvFe<-*
D in dd+F+
gi|7818987 1941 DGINWDDIFG 1950
Glyco_hydro_20b: domain 1 of 1, from 1947 to 1986: score 0.9, E = 7.5
CS .----------------..B--EEEEEE-S-.--TTS---TT--
*->DgFkaeqfpsvnfraetlgviksvlVsvvvtvspcdslqsLgsd<-*
D F+a+q+++ +a + +k +V+++ t ++++ l +++sd
gi|7818987 1947 DIFGATQRSYKLTQADV---DKHITVEISYT-DDANHLNTISSD 1986
Penicil_amidase: domain 1 of 1, from 1954 to 1969: score -1.5, E = 7.7
CS EE---SHHHHHHHEEE
*->kpllftpadikahaqs<-*
+++ +t+ad+++h+++
gi|7818987 1954 RSYKLTQADVDKHITV 1969
Pox_E8: domain 1 of 1, from 1959 to 1980: score 1.0, E = 5.8
*->TrFditKHTLFskvYTdnakHv<-*
T+ d++KH YTd a+H+
gi|7818987 1959 TQADVDKHITVEISYTDDANHL 1980
Big_1: domain 1 of 1, from 2009 to 2029: score 1.2, E = 6
CS ESSSEES-S.E.EEE-TTSEEE
*->sssgtlsngntkatTdanGkAt<-*
++ +tl+ + t+a+Tda+G+A+
gi|7818987 2009 TEDQTLTIV-TSAITDADGIAQ 2029
TnsA_N: domain 1 of 1, from 2034 to 2048: score 1.5, E = 5.9
CS HHHHHCT--EEEE-G
*->rywqqkGidfrivTE<-*
++wq+ G+ f + TE
gi|7818987 2034 YQWQADGVTFAWTTE 2048
Ubiq-assoc: domain 1 of 1, from 2066 to 2076: score 6.8, E = 0.4
CS HHHHHHH-SSH
*->seYYerGitYE<-*
++YY++G+tYE
gi|7818987 2066 VSYYDNGGTYE 2076
BNR: domain 1 of 5, from 2136 to 2147: score 8.5, E = 0.3
CS EEESSTTSSEEE
*->yyStDgGkTWsk<-*
+ StD+G +W+
gi|7818987 2136 QSSTDDGVNWND 2147
TMP: domain 1 of 2, from 2145 to 2155: score 1.8, E = 37
*->WngIkgffsga<-*
Wn+I g++++
gi|7818987 2145 WNDIIGATESG 2155
DUF2328: domain 1 of 1, from 2151 to 2171: score -0.0, E = 7.4
*->AreaGgtisveiteeavvlsa<-*
A e+G +++++++e +++ +
gi|7818987 2151 ATESGYDVTLDESGEKIRVQV 2171
Nif11: domain 1 of 1, from 2151 to 2165: score 2.8, E = 6.6
*->AkeaGfeisgdeLla<-*
A e G++++ de+++
gi|7818987 2151 ATESGYDVTLDESGE 2165
Cu_amine_oxidN1: domain 1 of 1, from 2164 to 2182: score 2.9, E = 3.6
CS HHHHTSSS-.....TSEE-
*->aEalgakVkwdsetktvqi<-*
+E ++++V++++ ++++++
gi|7818987 2164 GEKIRVQVTYTDNGGKTEV 2182
GPW_gp25: domain 1 of 1, from 2167 to 2184: score 1.4, E = 8.3
*->feIeaslrdenapeqlsf<-*
++++ +++d+++++++++
gi|7818987 2167 IRVQVTYTDNGGKTEVVY 2184
BNR: domain 2 of 5, from 2172 to 2180: score 1.6, E = 38
CS EEESSTTSS
*->yyStDgGkT<-*
y+++gGkT
gi|7818987 2172 TYTDNGGKT 2180
Big_2: domain 2 of 5, from 2190 to 2223: score 1.7, E = 8.2
CS EEEEEEETTT. TEEES--SEEETTSEEEEEEES
*->avtsvtvsptg...ntaslakGatlqlkatvtpsda<-*
av+s++++p+g+ t + ++G+tl atvt++d+
gi|7818987 2190 AVVSNAIDPNGtiaITGTFKQGETL--NATVTDADG 2223
FIST_C: domain 2 of 2, from 2195 to 2224: score 2.1, E = 5.2
*->gvdpedGsltfagdvpeGeelqlmlrdaddl<-*
++dp +G++++ g +++Ge+l ++dad +
gi|7818987 2195 AIDP-NGTIAITGTFKQGETLNATVTDADGM 2224
PKD: domain 2 of 4, from 2204 to 2231: score 1.0, E = 9.3
CS EESS.....SSSEBTTEEEEEEECT.B.TT.SSECEEEE
*->vsasaveegpsvvalgetVtFtassSydpdpGspvsysW<-*
++++ +++get + t ++ d+ G vsy+W
gi|7818987 2204 ITGT--------FKQGETLNATVTD-ADGM-G-TVSYQW 2231
EspA: domain 1 of 1, from 2213 to 2234: score 1.9, E = 3.1
*->tyNvlvsllnslQsllaemnks<-*
t+N++v+ + ++ + ++ +s
gi|7818987 2213 TLNATVTDADGMGTVSYQWQSS 2234
UPF0183: domain 1 of 1, from 2293 to 2303: score 0.6, E = 1.7
*->iaSVTLYdgAp<-*
i SVT+ ++A+
gi|7818987 2293 IGSVTITGTAK 2303
Big_2: domain 3 of 5, from 2294 to 2312: score 2.5, E = 4.7
CS S-EEEEEEETT.TEEEEEEE
*->GtatItatsgdgnksasvtv<-*
G++tIt t++ + ++++
gi|7818987 2294 GSVTITGTAKQ-GEALTAKN 2312
BNR: domain 3 of 5, from 2327 to 2338: score 0.9, E = 61
CS EEESSTTSSEEE
*->yyStDgGkTWsk<-*
+ S +G +Ws+
gi|7818987 2327 WQSSSDGTNWSA 2338
Porin_2: domain 1 of 2, from 2362 to 2392: score 1.4, E = 3.1
*->vnYtdldqkystvasvrgsdakpgteyeakkqDsvsGi<-*
+nYtd +++ s a+++t + a+++D+ +G
gi|7818987 2362 ANYTD-GHNTP------ESKASVATVAVANTNDAPTGT 2392
E3_binding: domain 2 of 2, from 2394 to 2408: score 2.9, E = 11
CS CS--SSTCCBBHHHH
*->qVkGTGpgGRItkeD<-*
+++G+G +G I+ +D
gi|7818987 2394 KITGSGQQGAILAAD 2408
He_PIG: domain 3 of 4, from 2404 to 2463: score 6.2, E = 0.58
*->tytlTkpsdgslasysttpggggLPsGLtL..........dsstGri
++ +st+ ++ gLP+ L + ++ + +++G++
gi|7818987 2404 ILAA---------DTSTLADADGLPTTLAYqwyaggviitGATNGTY 2441
tGtPtptvqpG.sytftvtatdgsg<-*
+ t++ + G++ t+ v++tdg+g
gi|7818987 2442 Q--LTKN-EVGkAITVKVSYTDGGG 2463
Glucodextran_N: domain 1 of 1, from 2414 to 2445: score 2.4, E = 0.41
CS .....TTSS-E EEEEE-TTSSEEEEE
*->DakGRplslAY......kivNtDkqGRYrIeK<-*
Da+G p++lAY+ +++i++ ++ G Y+++K
gi|7818987 2414 DADGLPTTLAYqwyaggVIITGATNGTYQLTK 2445
NPCBM_assoc: domain 2 of 2, from 2446 to 2472: score 0.6, E = 20
*->vvaGrtvtvtatftndgttaatgVsva<-*
+ G++ tv+++ t++g+t+ +++s+a
gi|7818987 2446 NEVGKAITVKVSYTDGGGTPESVTSLA 2472
Pou: domain 1 of 2, from 2538 to 2548: score 0.3, E = 18
*->yTQadVGlALg<-*
+TQa+VG+A++
gi|7818987 2538 LTQAEVGKAIT 2548
He_PIG: domain 4 of 4, from 2539 to 2558: score 0.2, E = 28
*->tptvqpG.sytftvtatdgsg<-*
t++ + G++ t+ vt+td g
gi|7818987 2539 TQA-EVGkAITVKVTYTDLQG 2558
Egg_lysin: domain 1 of 1, from 2541 to 2585: score 1.4, E = 6.7
CS HHHHHHTHCHHHHHHHHHHHCT ------HHHHHHHCS-GGGS--T
*->aeiGrrnriplevfYsflvrrn..lipkwrpymakllakrpaDiPvr
ae+G+ i ++v+Y +l + + ++ +a+ ++++ ++i+++
gi|7818987 2541 AEVGK--AITVKVTYTDLQGTTeaVTSDATASVANVNDTPTGTITIS 2585
CS
<-*
gi|7818987 - -
MucBP: domain 2 of 2, from 2576 to 2594: score 6.0, E = 0.7
*->ltktvtvTvhYvDedGnel<-*
+t t+t+T+ +D dGn++
gi|7818987 2576 DTPTGTITISKIDDDGNKV 2594
AIG2: domain 1 of 1, from 2611 to 2628: score 2.7, E = 1.7
CS EEE----SEE.EEEEEEES
*->eVelgdgeevveAwvYvya<-*
++++gdg+ A +Y+++
gi|7818987 2611 TLVDGDGPPA-LAVTYQWQ 2628
Bac_DnaA_C: domain 1 of 1, from 2630 to 2649: score 3.2, E = 5.6
*->tienIqeiVAeyynitvedl<-*
+ ++I +V++y+ +t++++
gi|7818987 2630 NGADINGAVGRYFEVTQAEV 2649
Phage_Nu1: domain 1 of 1, from 2640 to 2658: score 3.5, E = 1.4
CS XXXXXXXXXXXXXXXXXXX
*->rHidvLkreIikAmnkaAa<-*
r+ +v e+ k+m++ A+
gi|7818987 2640 RYFEVTQAEVGKTMGVVAS 2658
Sigma70_r4: domain 2 of 2, from 2640 to 2655: score 4.1, E = 4.2
CS HCTTTTTST--HHHHHHHHTS
*->RfGLddgeelTLeEIGerLGi<-*
R+ +e T++E+G+ +G+
gi|7818987 2640 RY----FEV-TQAEVGKTMGV 2655
Pou: domain 2 of 2, from 2644 to 2656: score 2.0, E = 6.1
*->yTQadVGlALgal<-*
+TQa+VG+++g +
gi|7818987 2644 VTQAEVGKTMGVV 2656
Transglut_C: domain 1 of 1, from 2684 to 2703: score 3.2, E = 2.6
CS EEEEEEEESEEBBTTSEEEEE
*->pelkikvlgeavvvGqdfdvs<-*
p ++ ++g++ +Gq+++++
gi|7818987 2684 PTGSVTISGNPT-QGQELTAI 2703
DUF512: domain 1 of 1, from 2746 to 2761: score 1.7, E = 6.4
*->eeaLgvpvivvrgpge<-*
+ea++v ++vv ++++
gi|7818987 2746 SEADKVIRVVVSYTDK 2761
Porin_2: domain 2 of 2, from 2752 to 2786: score 0.6, E = 5
*->itaevnYtdldqkystvasvrgsdakpgteyeakkqDsvsGi<-*
i++ v+Ytd ++ + s+++ +t+ +++D+ +G
gi|7818987 2752 IRVVVSYTDKGNTDE-------SVNSKATRSVTNDNDAPTGT 2786
Surf_Ag_VNR: domain 1 of 1, from 2758 to 2796: score 4.7, E = 1.6
*->YlnlGYafadV.....svepe.dpekdggVdltfnVkEg<-*
Y ++G +++V+++ ++ ++++++ +g+V++t ++kEg
gi|7818987 2758 YTDKGNTDESVnskatRSVTNdNDAPTGTVTITGTIKEG 2796
MSA_2: domain 1 of 1, from 2772 to 2808: score 1.0, E = 2.4
*->tatTtTTNdaEasTsTssENsNHnaAeTntkgesevqsP<-*
at + TNd a T T + + T t+ +s+v P
gi|7818987 2772 -ATRSVTNDNDAPTGTVTITGTIKEGQTLTASNSIVD-P 2808
Tymo_coat: domain 1 of 1, from 2782 to 2794: score 3.4, E = 1.9
CS S-SEEEEEEEEEE
*->tpTAsitIsGklr<-*
+pT ++tI+G++
gi|7818987 2782 APTGTVTITGTIK 2794
Big_2: domain 4 of 5, from 2784 to 2803: score 2.8, E = 3.8
CS SS-EEEEEEETT.TEEEEEEE
*->kGtatItatsgdgnksasvtv<-*
+Gt+tIt t ++ +++ ++ +
gi|7818987 2784 TGTVTITGTIKE-GQTLTASN 2803
DUF342: domain 1 of 1, from 2785 to 2806: score 0.0, E = 7
*->GsViIrGdVkdGfkVkAsGDIt<-*
G+V+I+G +k+G + +As +I+
gi|7818987 2785 GTVTITGTIKEGQTLTASNSIV 2806
Fimbrial: domain 1 of 1, from 2785 to 2795: score 0.4, E = 9.8
*->GtvtFkGeVVd<-*
Gtvt++G++ +
gi|7818987 2785 GTVTITGTIKE 2795
PKD: domain 3 of 4, from 2787 to 2836: score 4.7, E = 0.64
CS EESS.....SSSEBTTEEEEEEECT.B.TT . SSECEEEEE-SS.
*->vsasaveegpsvvalgetVtFtassSydpd..p.GspvsysWdFGDg
v+ + +++++g+t t + s dpd+ p G++ +y+W +D
gi|7818987 2787 VTIT------GTIKEGQTLTASNSI-VDPDgiPaGTI-TYQWKAND- 2824
CS SSSEEEECSSEEEEE
gspgttstepnvtHt<-*
++ + + +t+t
gi|7818987 2825 ---ENIYGATYATYT 2836
Rib: domain 1 of 1, from 2791 to 2821: score 8.9, E = 0.15
*->vtVkvGetPdatdgIkNksdLPdGTkgvdytWk<-*
t k G t++a+ +I + + +P+GT y Wk
gi|7818987 2791 GTIKEGQTLTASNSIVDPDGIPAGTI--TYQWK 2821
Big_2: domain 5 of 5, from 2879 to 2897: score 1.0, E = 13
CS S-EEEEEEETT.TEEEEEEE
*->GtatItatsgdgnksasvtv<-*
Gt tIt t+++ +++ ++ +
gi|7818987 2879 GTITITGTAKE-KSTLTFVN 2897
NAC: domain 1 of 1, from 2880 to 2891: score 2.8, E = 7.6
*->TyvVtGeAkekn<-*
T ++tG Akek+
gi|7818987 2880 TITITGTAKEKS 2891
BNR: domain 4 of 5, from 2913 to 2924: score 10.8, E = 0.062
CS EEESSTTSSEEE
*->yyStDgGkTWsk<-*
+ StD+G TWs
gi|7818987 2913 QSSTDNGSTWSN 2924
Glug: domain 2 of 2, from 2955 to 2970: score 0.9, E = 21
*->enpgsienctatgnvtvt<-*
+np +++ ++at +v
gi|7818987 2955 GNPETVRSSNATS--KVK 2970
Miro: domain 1 of 1, from 2979 to 2991: score 4.8, E = 0.77
*->KvvviGdkgvGKS<-*
K+ ++G+ ++GK+
gi|7818987 2979 KLTIVGNAKAGKT 2991
BNR: domain 5 of 5, from 3012 to 3023: score 4.0, E = 7.1
CS EEESSTTSSEEE
*->yyStDgGkTWsk<-*
+ StD+G W+
gi|7818987 3012 QSSTDNGSIWND 3023
DUF1727: domain 1 of 1, from 3015 to 3050: score -0.8, E = 9.1
*->eekiivepDleqaldaileatspget..lyiLaTYT<-*
+++ ++ D+++a+d++ +t+++ +++ ++aTYT
gi|7818987 3015 TDNGSIWNDIDDATDSFYTLTKDDVGnnIRVVATYT 3050
YtxC: domain 1 of 1, from 3055 to 3066: score 1.7, E = 3.2
*->TIknVFqeRVei<-*
T++nVF e+ +
gi|7818987 3055 TVENVFSEKTAT 3066
PTS_EIIA_1: domain 1 of 1, from 3154 to 3171: score 3.4, E = 1.7
CS SSEEE-SSSEEEEEE-TT
*->dGkVvAPVdGtIvqiFpT<-*
dG ++AP+d+t++++ +T
gi|7818987 3154 DGSFFAPADATVISALTT 3171
DUF2134: domain 1 of 1, from 3174 to 3234: score 3.0, E = 2.6
*->AAAqrlsdgsaaaanssaaaaaaAaaaaarngfgggdlalslsvecG
AAA++ + ++a aa++ a+ ++ + + +++++
gi|7818987 3174 AAAMDSTTNAA-------AAETKVETALGLDAA--TL---GATLSLT 3208
ywnatdaaadspprftagaaagpvnAVrVta<-*
+++ a ++ ++t++aa +nAV+V+a
gi|7818987 3209 SYDP---LAEASKTSTTDAA--KINAVKVHA 3234
Hum_adeno_E3A: domain 1 of 1, from 3177 to 3200: score 1.1, E = 4.5
*->mtdttnapttdyrnatAtGLtstl<-*
m ttna +++ + tA GL +++
gi|7818987 3177 MDSTTNAAAAETKVETALGLDAAT 3200
EppA_BapA: domain 1 of 1, from 3226 to 3231: score 0.4, E = 4.8
*->KInaVK<-*
KInaVK
gi|7818987 3226 KINAVK 3231
YolD: domain 1 of 1, from 3237 to 3245: score 1.8, E = 6
*->lkledIidi<-*
++l++I+d+
gi|7818987 3237 IQLNNIMDV 3245
Phage_attach: domain 1 of 1, from 3238 to 3253: score 0.5, E = 2.7
*->MadfdNLFDeAisrADda<-*
+ +N D Ais AD a
gi|7818987 3238 --QLNNIMDVAISVADAA 3253
Defensin_propep: domain 1 of 1, from 3244 to 3255: score 3.5, E = 3.3
*->DvsISFagdess<-*
Dv+IS+a+ ++s
gi|7818987 3244 DVAISVADAAGS 3255
SPDY: domain 1 of 2, from 3260 to 3278: score 1.0, E = 17
*->aeLVaaftaaLastapvhr<-*
a +V +++++L+++a++++
gi|7818987 3260 AQIVENVSDSLLAQAGTDT 3278
Bact_transglu_N: domain 1 of 1, from 3265 to 3289: score 2.1, E = 9.1
*->NavarfvfpgphdeLtIeaesvVet<-*
N+ +++ ++ +d++ +++++v+e+
gi|7818987 3265 NVSDSLLAQAGTDTVDVTSDAVIEV 3289
IgG_binding_B: domain 2 of 2, from 3397 to 3417: score 2.0, E = 7.7
*->TYkLilnGkTLkGETtTeAVD<-*
T ++nG+ + GE T A D
gi|7818987 3397 TGSVVINGVVMPGEILTAATD 3417
OKR_DC_1_C: domain 1 of 1, from 3405 to 3421: score 0.9, E = 7.2
CS S-TTEE--...HHHHHH
*->lvvPGErwteesrpvld<-*
+v+PGE++t ++ ++ d
gi|7818987 3405 VVMPGEILTAATDSIAD 3421
SPDY: domain 2 of 2, from 3408 to 3427: score 6.6, E = 0.45
*->PaeLVaaftaaLastapvhr<-*
P e+++a+t++ a++++v
gi|7818987 3408 PGEILTAATDSIADNQGVGA 3427
Autophagy_Cterm: domain 1 of 1, from 3505 to 3514: score 4.1, E = 6.4
*->iPTIEyDyTt<-*
+PT+E+D T+
gi|7818987 3505 TPTVEVDLTN 3514
H_lectin: domain 1 of 1, from 3523 to 3548: score 4.0, E = 3.4
*->itsldsdnnsqnirfkvqasnvtttgFtiPv<-*
i+ +ds++++ ++++ +tttg t+ +
gi|7818987 3523 IQIIDSNHGN----AVLYTETITTTGITL-K 3548
Cadherin: domain 2 of 2, from 3561 to 3587: score 2.9, E = 4.1
CS B--EEE----.........S---EEEE--EEE-
*->YeLtveAtDadpllasgggpplsstatvtitVl<-*
+ L v+++D++ g +l s ++ titV
gi|7818987 3561 HALQVRLVDSA------GNEGLASNGVTTITVD 3587
Corona_M: domain 1 of 1, from 3577 to 3593: score 2.4, E = 1.4
*->mTNsapvcTldadeviqhL<-*
+N+ v+T+++d i hL
gi|7818987 3577 ASNG--VTTITVDTTISHL 3593
PKD: domain 4 of 4, from 3642 to 3656: score 1.2, E = 7.7
CS EETTCEEEEEEEEEEE
*->sngvgsasattttvtV<-*
++gvgs++++ + ++V
gi|7818987 3642 WDGVGSNATK-IDLKV 3656
TMP: domain 2 of 2, from 3642 to 3652: score 4.0, E = 8.3
*->WngIkgffsga<-*
W+g+ + ++++
gi|7818987 3642 WDGVGSNATKI 3652
BiPBP_C: domain 1 of 1, from 3654 to 3670: score 5.5, E = 0.55
*->LtVvDadGrsdrv.Vrf<-*
L V+D++G++d+ V++
gi|7818987 3654 LKVQDEAGNTDTEaVTI 3670
HYR: domain 1 of 1, from 3656 to 3672: score 1.8, E = 6.4
*->atDnaGNeAdsCtFtVtV<-*
++D+aGN++ + +t+ V
gi|7818987 3656 VQDEAGNTD-TEAVTIPV 3672
DUF1781: domain 1 of 1, from 3678 to 3689: score 1.3, E = 6
CS EEE-STTTSSS-
*->vTIhdhLWqkKk<-*
+TIh ++W k
gi|7818987 3678 LTIHTAYWKDSK 3689
Dockerin_1: domain 2 of 2, from 3761 to 3781: score 4.6, E = 2.9
CS -TT-SS--SHHHHHHHHHHH-
*->DvNgDGkVnalDlallkkyll<-*
D +g GkV lD++ + kyl
gi|7818987 3761 DYDGSGKVGLLDAVGVLKYLV 3781
//