hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            78214028.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|78214028|ref|YP_382807.1|
Accession:      [none]
Description:    VCBS [Synechococcus sp. CC9605]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
PQQ             PQQ enzyme repeat                        11.9      0.012   1
NHL             NHL repeat                                9.6        0.2   1
DUF1711         Fungal protein of unknown function (D     4.3       0.46   1
Fil_haemagg     Haemagluttinin repeat                     5.8        0.6   3
SBBP            Beta-propeller repeat                     5.4        1.2   3
AHS2            Allophanate hydrolase subunit 2           2.4        1.5   1
HIM             Haemagglutinin                            5.4        1.6   1
HemolysinCabind Hemolysin-type calcium-binding repeat     5.4        1.8   1
NifT            NifT/FixU protein                         3.9        1.8   2
DUF2510         Protein of unknown function (DUF2510)     3.8        2.1   1
Terminase_5     Putative ATPase subunit of terminase      4.3        2.3   1
PKD             PKD domain                                2.6          3   1
DUF843          Baculovirus protein of unknown functi     0.7        4.1   2
FG-GAP          FG-GAP repeat                             3.8        4.2   1
PyrI            Aspartate carbamoyltransferase regula     2.8        4.3   1
DUF1493         Protein of unknown function (DUF1493)     1.2        4.7   1
Glyco_hydro_53  Glycosyl hydrolase family 53              1.1        4.7   1
Chlam_PMP       Chlamydia polymorphic membrane protei     4.8        5.3   2
Fork_head_N     Forkhead N-terminal region               -2.1        5.4   1
Peptidase_M14   Zinc carboxypeptidase                    -0.1        8.5   1
Fn_bind         Fibronectin binding repeat                2.9        8.9   2
HutD            HutD                                      0.3        9.9   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Peptidase_M14     1/1      29    50 ..    43    64 ..    -0.1      8.5
Terminase_5       1/1      34    53 ..    40    60 .]     4.3      2.3
SBBP              1/3     190   217 ..     6    30 ..     2.1       11
NHL               1/1     200   217 ..     1    19 [.     9.6      0.2
AHS2              1/1     267   281 ..   278   292 .]     2.4      1.5
FG-GAP            1/1     269   284 ..     1    16 [.     3.8      4.2
PQQ               1/1     282   301 ..     1    20 [.    11.9    0.012
SBBP              2/3     304   334 ..     1    30 [.     2.7      7.6
HutD              1/1     329   345 ..   182   200 .]     0.3      9.9
Fork_head_N       1/1     344   367 ..     1    25 [.    -2.1      5.4
Fil_haemagg       1/3     435   501 ..     1    75 []     0.1       27
Fn_bind           1/2     455   471 ..     1    18 [.     1.4       23
NifT              1/2     480   493 ..    55    68 .]     1.9      6.8
Chlam_PMP         1/2     500   518 ..     1    19 []     2.4       24
DUF843            1/2     502   510 ..    76    83 .]     0.3      5.6
HIM               1/1     544   564 ..     3    24 .]     5.4      1.6
Fil_haemagg       2/3     559   625 ..     1    75 []     0.1       27
Fn_bind           2/2     579   595 ..     1    18 [.     1.4       23
NifT              2/2     604   617 ..    55    68 .]     1.9      6.8
Chlam_PMP         2/2     624   642 ..     1    19 []     2.4       24
DUF843            2/2     626   634 ..    76    83 .]     0.3      5.6
SBBP              3/3     659   685 ..    12    39 .]     0.5       33
Fil_haemagg       3/3     679   750 ..     1    75 []     5.6     0.69
Glyco_hydro_53    1/1     780  1117 ..     6    29 ..     1.1      4.7
PKD               1/1     900   918 ..    73    92 .]     2.6        3
DUF2510           1/1     921   938 ..    34    51 .]     3.8      2.1
DUF1711           1/1     952   971 ..   273   292 .]     4.3     0.46
HemolysinCabind   1/1    1022  1039 ..     1    18 []     5.4      1.8
DUF1493           1/1    1039  1059 ..    80   103 ..     1.2      4.7
PyrI              1/1    1076  1086 ..     1    11 [.     2.8      4.3

Alignments of top-scoring domains:
Peptidase_M14: domain 1 of 1, from 29 to 50: score -0.1, E = 8.5
                CS    SEEEEEE-SSTT-HHHHHHHHH
                   *->pavlidagiHarEwigpataly<-*
                      p+ ++ ag+H+ E+++ a+ ++
  gi|7821402    29    PVLWLKAGQHPLETVTAALEMR    50

Terminase_5: domain 1 of 1, from 34 to 53: score 4.3, E = 2.3
                   *->WddllpvmervesaieaRlvq<-*
                      ++++ p+ e+v+ a+e R +q
  gi|7821402    34    KAGQHPL-ETVTAALEMRRQQ    53

SBBP: domain 1 of 3, from 190 to 217: score 2.1, E = 11
                   *->lGP...gpgasifgngIavDsnGNiYvt<-*
                      lG+ ++g+++ + + g+a+  +GN+Yvt
  gi|7821402   190    LGNfndGTDNLTRVWGLAFSQDGNLYVT    217

NHL: domain 1 of 1, from 200 to 217: score 9.6, E = 0.2
                CS    BSSEEEEEE-TTTS-EEEE
                   *->lnrPhGvavdpsdGrvyVa<-*
                      l+r +G+a +  dG++yV+
  gi|7821402   200    LTRVWGLAFS-QDGNLYVT    217

AHS2: domain 1 of 1, from 267 to 281: score 2.4, E = 1.5
                   *->PGdkvRFvpvsleeA<-*
                      PG +++F++v+++
  gi|7821402   267    PGGPIQFHAVDVDSD    281

FG-GAP: domain 1 of 1, from 269 to 284: score 3.8, E = 4.2
                CS    CCSCEEEC-TTSSSSS
                   *->fgssvaagDlnGDGrp<-*
                      ++ + +a+D++ DG++
  gi|7821402   269    GPIQFHAVDVDSDGLM    284

PQQ: domain 1 of 1, from 282 to 301: score 11.9, E = 0.012
                CS    TEEEEETTTSEEEEEETTTT
                   *->gvvyvgtadGylyAlDakTG<-*
                      g +y+ + +Gy+y +D++TG
  gi|7821402   282    GLMYALDLRGYIYSIDITTG    301

SBBP: domain 2 of 3, from 304 to 334: score 2.7, E = 7.6
                   *->qWstqlGP.gpgasifgngIavDsnGNiYvt<-*
                       ++++ + +++++ +++ +Ia+D++GN++ +
  gi|7821402   304    TYVAETSKsDNSKITSAMDIAFDIEGNLFAV    334

HutD: domain 1 of 1, from 329 to 345: score 0.3, E = 9.9
                CS    EEEE.EEEEE.EEEEEEEE
                   *->dalllpltgdrgrlllvsl<-*
                      ++l+ +++gd g+l+ +sl
  gi|7821402   329    GNLF-AVDGD-GALYQISL    345

Fork_head_N: domain 1 of 1, from 344 to 367: score -2.1, E = 5.4
                   *->syYpeamsesYSsvsaGsmsmnagl<-*
                      s+++++ +  ++   ++s+sm +gl
  gi|7821402   344    SLDGTT-TAGATQLGSTSTSMLMGL    367

Fil_haemagg: domain 1 of 3, from 435 to 501: score 0.1, E = 27
                CS    EEESSEEEETT      TT--EE-SEEEEEE-STT-EEEE-S-EEES
                   *->vaaGaltlnaa......alggldlnnggtlsagggltltaagllnng
                      +++Galt++  + +  +++++  +    tl  +gg t t ++++
  gi|7821402   435    ASTGALTVTGIdlpaysGATNDIDISKLTLTGEGGATYTLTSDDV-- 479

                CS SE...................EEEEESS-EEEEE
                   gtliaggdlllaagalrnggdltltaaGdLdnsg<-*
                     l+++               +tl+aa++L+++g
  gi|7821402   480 -ELTSSTEFS-----------ITLNAADQLQLAG    501

Fn_bind: domain 1 of 2, from 455 to 471: score 1.4, E = 23
                CS    XXXXX--..---------
                   *->eviDitEPDTqpgmSGqs<-*
                      + iDi++  T++g+ G +
  gi|7821402   455    NDIDISK-LTLTGEGGAT    471

NifT: domain 1 of 2, from 480 to 493: score 1.9, E = 6.8
                   *->plpadtrLPiTveA<-*
                      +l + t++ iT++A
  gi|7821402   480    ELTSSTEFSITLNA    493

Chlam_PMP: domain 1 of 2, from 500 to 518: score 2.4, E = 24
                   *->ditFsgNsaaggGGAiyas<-*
                      +  +++N++++gGG +y+
  gi|7821402   500    AGLLNKNGTSSGGGTTYNI    518

DUF843: domain 1 of 2, from 502 to 510: score 0.3, E = 5.6
                   *->ILNKN.nSS<-*
                      +LNKN++SS
  gi|7821402   502    LLNKNgTSS    510

HIM: domain 1 of 1, from 544 to 564: score 5.4, E = 1.6
                CS    EEEE--S...-EETT-TT--CC
                   *->ItNVasGeitvtktDAvnvsQL<-*
                      ++NVa+ ++t  + DA+++ +L
  gi|7821402   544    VSNVAAPTLTSASYDASTG-AL    564

Fil_haemagg: domain 2 of 3, from 559 to 625: score 0.1, E = 27
                CS    EEESSEEEETT      TT--EE-SEEEEEE-STT-EEEE-S-EEES
                   *->vaaGaltlnaa......alggldlnnggtlsagggltltaagllnng
                      +++Galt++  + +  +++++  +    tl  +gg t t ++++
  gi|7821402   559    ASTGALTVTGIdlpaysGATNDIDISKLTLTGEGGATYTLTSDDV-- 603

                CS SE...................EEEEESS-EEEEE
                   gtliaggdlllaagalrnggdltltaaGdLdnsg<-*
                     l+++               +tl+aa++L+++g
  gi|7821402   604 -ELTSSTEFS-----------ITLNAADQLQLAG    625

Fn_bind: domain 2 of 2, from 579 to 595: score 1.4, E = 23
                CS    XXXXX--..---------
                   *->eviDitEPDTqpgmSGqs<-*
                      + iDi++  T++g+ G +
  gi|7821402   579    NDIDISK-LTLTGEGGAT    595

NifT: domain 2 of 2, from 604 to 617: score 1.9, E = 6.8
                   *->plpadtrLPiTveA<-*
                      +l + t++ iT++A
  gi|7821402   604    ELTSSTEFSITLNA    617

Chlam_PMP: domain 2 of 2, from 624 to 642: score 2.4, E = 24
                   *->ditFsgNsaaggGGAiyas<-*
                      +  +++N++++gGG +y+
  gi|7821402   624    AGLLNKNGTSSGGGTTYNI    642

DUF843: domain 2 of 2, from 626 to 634: score 0.3, E = 5.6
                   *->ILNKN.nSS<-*
                      +LNKN++SS
  gi|7821402   626    LLNKNgTSS    634

SBBP: domain 3 of 3, from 659 to 685: score 0.5, E = 33
                   *->asifgngIavDsnGNiYvtGstngnnfe<-*
                      a+ +gn I+v  + N+ vtGs+ g  +
  gi|7821402   659    ADLTGNAITVSNFNNAPVTGSASG-TLA    685

Fil_haemagg: domain 3 of 3, from 679 to 750: score 5.6, E = 0.69
                CS    EEESSEEEETTTT--EE-SEEEEEE-STT-EEEE-S-EEESSE....
                   *->vaaGaltlnaaalggldlnnggtlsagggltltaagllnnggtliag
                       a+G+l  + + +g++  + + t+  + ++++ +a +    g ++a
  gi|7821402   679    SASGTLAFTEG-DGATVIDPSLTITDDDDTNIESATITISSGYQSAE 724

                CS ...............EEEEESS-EEEEE
                   gdlllaagalrnggdltltaaGdLdnsg<-*
                     l  + +++++g     t++G L+++g
  gi|7821402   725 DVLAFSDTSAITG--SWNTSTGVLTLTG    750

Glyco_hydro_53: domain 1 of 1, from 780 to 1117: score 1.1, E = 4.7
                CS    -TTHHH
                   *->vSslne.........................................
                      +S+++++++++++  +++ + +  ++ +  ++++ ++  ++ +++++
  gi|7821402   780    ISWVVNdgtdsssavtsrvtitavndapvlttptagsiaetagssdn 826

                CS
                   ..................................................
                   ++++ +++ + ++ ++++ +   ++++++++ ++  ++ ++ + +++++
  gi|7821402   827 ttsgltgtlsasdadgdtltyainggsttdgvstlagsygslslntstga 876

                CS
                   ..................................................
                      +++++  +  +++++  ++ + + ++++++++ + + + ++ +++++
  gi|7821402   877 yaytpdssavkalddgdsaadsftltasdstdttsatytvnltgadeptp 926

                CS
                   ..................................................
                   ++++++++++++++++++++++++++++++++++++++++++ + ++ ++
  gi|7821402   927 sptptpsptptpspspdpstsptpspspdpstsptpsskssnvklpsidd 976

                CS
                   ..................................................
                    ++++++++ +  ++++ ++++ ++   +++++++ +++++++   + ++
  gi|7821402   977 attqqetstfelinptkvrekeinsiivgtekkekitgtssgeiiagmsg 1026

                CS
                   ..................................................
                   +++ ++++++++   +++++ +++++++  + +++++++   +++  + +
  gi|7821402  1027 kdeikgsggsdgflfqdpnnfgkkerdtildftpkegdsllidkdvfdfg 1076

                CS                          .HHHTT--..-B-TTS-B
                   .........................YlEaaGvsyiykneNGqt<-*
                   ++ + +  +++++ +++++++ +  Y+E  G    ++neNG++
  gi|7821402  1077 nnlkvkaiknkkeakkqddskadfiYEEKKGLL--WYNENGKK    1117

PKD: domain 1 of 1, from 900 to 918: score 2.6, E = 3
                CS    EEEEEETTCEEEEEEEEEEE
                   *->tLtvsngvgsasattttvtV<-*
                      tLt+s++  ++sat  tv
  gi|7821402   900    TLTASDSTDTTSAT-YTVNL    918

DUF2510: domain 1 of 1, from 921 to 938: score 3.8, E = 2.1
                   *->avqpaaaappaPaaapqP<-*
                      a+ p++++ p+P+++p+P
  gi|7821402   921    ADEPTPSPTPTPSPTPTP    938

DUF1711: domain 1 of 1, from 952 to 971: score 4.3, E = 0.46
                   *->nspgssTAPvsAseesatkv<-*
                      +sp +sT+P ++s  s +k+
  gi|7821402   952    PSPDPSTSPTPSSKSSNVKL    971

HemolysinCabind: domain 1 of 1, from 1022 to 1039: score 5.4, E = 1.8
                CS    E--SSS-EEEEESSCGEE
                   *->yGGaGnDtLyGgaGnDtl<-*
                       G  G D + G +G D +
  gi|7821402  1022    AGMSGKDEIKGSGGSDGF    1039

DUF1493: domain 1 of 1, from 1039 to 1059: score 1.2, E = 4.7
                   *->sllsnPeyFKkkrdlepepvppLt<-*
                      +l+  P  F+kk   e +++ ++t
  gi|7821402  1039    FLFQDPNNFGKK---ERDTILDFT    1059

PyrI: domain 1 of 1, from 1076 to 1086: score 2.8, E = 4.3
                CS    -----B---SS
                   *->mneLqVkaIkN<-*
                       n L+VkaIkN
  gi|7821402  1076    GNNLKVKAIKN    1086

//