hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            83312376.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|83312376|ref|YP_422640.1|
Accession:      [none]
Description:    RTX toxins and related Ca2+-binding protein [Magnetospirillum magneticum AMB-1]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
He_PIG          Putative Ig domain                       26.2    1.2e-06   2
DAG1            Dystroglycan (Dystrophin-associated g    12.0     0.0015   1
DUF1321         Protein of unknown function (DUF1321)     6.6      0.056   1
ChW             Clostridial hydrophobic W                 8.6       0.13   2
Peptidase_M6    Immune inhibitor A peptidase M6           2.3       0.56   1
PPC             Bacterial pre-peptidase C-terminal do     5.3       0.83   2
BiPBP_C         Penicillin-Binding Protein C-terminus     4.4        1.2   1
Secretin_N_2    Secretin N-terminal domain                3.2          2   1
GSPII_G         Bacterial type II secretion system pr     2.8        2.7   1
Lamprin         Lamprin                                   1.5        3.1   1
RTC_insert      RNA 3'-terminal phosphate cyclase (RT     2.4        3.4   1
Asp_Glu_race    Asp/Glu/Hydantoin racemase                2.3        3.7   1
AAT             Acyl-coenzyme A:6-aminopenicillanic a     1.6        4.1   1
Peptidase_M16   Insulinase (Peptidase family M16)         2.4        4.2   1
FMN_bind        FMN-binding domain                        2.4        4.4   1
3HBOH           3HB-oligomer hydrolase (3HBOH)           -0.1        4.9   1
PsiA            PsiA protein                              0.8          5   1
Cadherin_pro    Cadherin prodomain like                   2.4        5.3   1
LIP             Secretory lipase                          0.2        5.6   1
Methyltransf_12 Methyltransferase domain                  2.6        5.9   1
DUF1196         Protein of unknown function (DUF1196)     2.5        6.4   1
Y_Y_Y           Y_Y_Y domain                              2.0          7   1
PAP1            Transcription factor PAP1                -0.3        7.6   1
Peptidase_M7    Streptomyces extracellular neutral pr     0.7        7.6   1
Methyltransf_2  O-methyltransferase                       0.1        7.8   1
DUF11           Domain of unknown function DUF11          2.4        8.9   2
DUF2239         Uncharacterized protein conserved in     -0.2        9.1   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
DUF1321           1/1       2    52 ..   111   161 .]     6.6    0.056
Asp_Glu_race      1/1      57    87 ..   224   254 .]     2.3      3.7
LIP               1/1     115   137 ..     1    26 [.     0.2      5.6
Methyltransf_12   1/1     116   140 ..    85   109 .]     2.6      5.9
Peptidase_M7      1/1     187   213 ..     1    27 [.     0.7      7.6
3HBOH             1/1     189   199 ..   711   721 .]    -0.1      4.9
DUF2239           1/1     196   205 ..   184   193 .]    -0.2      9.1
ChW               1/2     258   268 ..    10    20 ..     4.0      3.1
RTC_insert        1/1     262   276 ..   100   114 .]     2.4      3.4
ChW               2/2     453   464 ..     8    19 ..     4.6      2.1
Peptidase_M6      1/1     500   531 ..    86   117 ..     2.3     0.56
AAT               1/1     526   546 ..   248   268 .]     1.6      4.1
GSPII_G           1/1     604   619 ..    98   114 .]     2.8      2.7
PPC               1/2     649   704 ..     6    76 ..     3.2      3.3
DUF11             1/2     703   720 ..    29    46 ..     1.2       19
He_PIG            1/2     715   740 ..    39    61 .]     1.3       14
Y_Y_Y             1/1     730   752 ..    44    69 .]     2.0        7
Methyltransf_2    1/1     735   753 ..     1    20 [.     0.1      7.8
PPC               2/2     743   813 ..     1    76 [.     2.1      6.8
PAP1              1/1     771   822 ..   133   184 ..    -0.3      7.6
Secretin_N_2      1/1     800   813 ..    94   107 .]     3.2        2
DUF11             2/2     812   829 ..    29    46 ..     1.2       19
FMN_bind          1/1     833   854 ..     1    26 [.     2.4      4.4
Lamprin           1/1     950   962 ..   126   138 .]     1.5      3.1
DAG1              1/1    1017  1069 ..    44    98 ..    12.0   0.0015
DUF1196           1/1    1018  1026 ..     1     9 [.     2.5      6.4
PsiA              1/1    1026  1040 ..     1    15 [.     0.8        5
He_PIG            2/2    1035  1082 ..     1    61 []    24.9  2.7e-06
BiPBP_C           1/1    1074  1091 ..    78    94 .]     4.4      1.2
Peptidase_M16     1/1    1074  1092 ..     1    20 [.     2.4      4.2
Cadherin_pro      1/1    1075  1091 ..    75    94 .]     2.4      5.3

Alignments of top-scoring domains:
DUF1321: domain 1 of 1, from 2 to 52: score 6.6, E = 0.056
                   *->Feqaeeddeeeeeeipekiedededepdeaapapaplaaak......
                      F+ a++ d++ +++      d ++ +  + +pap+ ++aa+++++++
  gi|8331237     2    FDGAAAMDAAHAPP------DSAAKALIPDSPAPVQVRAADqsqdgg 42

                   gaeVVsLDaF<-*
                   + +VV++D+
  gi|8331237    43 KKQVVFVDTS    52

Asp_Glu_race: domain 1 of 1, from 57 to 87: score 2.3, E = 3.7
                CS    HHHHHHC.S-SSEE .E-HHHHHHHCCCCCHH
                   *->peiekalGdlgvpv.eIDsgaataeravrlll<-*
                      + +e+a+Gd g+ ++eI++++    +++++++
  gi|8331237    57    KTLEAAVGD-GIEIqEISGVQSGLAQIAKWAE    87

LIP: domain 1 of 1, from 115 to 137: score 0.2, E = 5.6
                   *->lqfgsplsTvlTQaemllivplLdqG<-*
                         +s+ls+ +TQae++ i  +L+ G
  gi|8331237   115    ---ASNLSGAVTQAELAQIGHALKAG    137

Methyltransf_12: domain 1 of 1, from 116 to 140: score 2.6, E = 5.9
                   *->hhldpedprevLrnlrrlLkPGGvl<-*
                      + l+ + +++ L+++ ++Lk GG l
  gi|8331237   116    SNLSGAVTQAELAQIGHALKAGGDL    140

Peptidase_M7: domain 1 of 1, from 187 to 213: score 0.7, E = 7.6
                CS    -EEEEEEEEE-GGGHHHHHHHHHHHHH
                   *->avtvtYdasnAPsFrsqiarsaqiWns<-*
                      + t+t +a   P ++  +a +++iW s
  gi|8331237   187    TGTITSSAIDVPDYAAALAVTTNIWVS    213

3HBOH: domain 1 of 1, from 189 to 199: score -0.1, E = 4.9
                   *->tvaaGaVqVPd<-*
                      t+++ a++VPd
  gi|8331237   189    TITSSAIDVPD    199

DUF2239: domain 1 of 1, from 196 to 205: score -0.2, E = 9.1
                   *->DVRdHAlaLA<-*
                      DV d+A aLA
  gi|8331237   196    DVPDYAAALA    205

ChW: domain 1 of 2, from 258 to 268: score 4.0, E = 3.1
                   *->wVkDGaisGtv<-*
                      wV+DG+++Gt+
  gi|8331237   258    WVTDGTEAGTQ    268

RTC_insert: domain 1 of 1, from 262 to 276: score 2.4, E = 3.4
                   *->GeeAAkeLLeelesG<-*
                      G eA ++L +++++G
  gi|8331237   262    GTEAGTQLVKDIRPG    276

ChW: domain 2 of 2, from 453 to 464: score 4.6, E = 2.1
                   *->qnwVkDGaisGt<-*
                      ++wV+DG+++Gt
  gi|8331237   453    EPWVSDGTTAGT    464

Peptidase_M6: domain 1 of 1, from 500 to 531: score 2.3, E = 0.56
                   *->KqYYEeQSGGSYsvdGtVtgWykvpgnAAyYG<-*
                      K Y   QSG  Ys+dGt++g  kv g  + YG
  gi|8331237   500    KVYFTTQSGDLYSTDGTAAGTAKVNGISSVYG    531

AAT: domain 1 of 1, from 526 to 546: score 1.6, E = 4.1
                   *->rtalydpadrkatlclgnprn<-*
                      ++++y +   +at++lg+++
  gi|8331237   526    ISSVYGFESSTATMYLGGNDG    546

GSPII_G: domain 1 of 1, from 604 to 619: score 2.8, E = 2.7
                CS    TS--...EEE--.TT-E
                   *->DGqpGGeGtdaDpIgnW<-*
                      DG  GG++   D I+++
  gi|8331237   604    DGTSGGTALVKD-INSG    619

PPC: domain 1 of 2, from 649 to 704: score 3.2, E = 3.3
                CS    EEEESTTCEEEEEEECTSSS...S...CCEEEEEEECCCSESSSSTT
                   *->sFtvpaggtlsisldggsslrslsgnGdadtlLywlldgdpslsayd
                      sF+  + ++ls++ +g ++        d++++L  ++d+d s ++ +
  gi|8331237   649    SFVTGTAQSLSVAFNGAAV--------DLKSYLH-VSDSD-SSQTET 685

                CS CE-.....ECCTTEEEEEECC.-S
                   aystTrdvdnggsdelisftapea<-*
                   +++     + ++s+ ++sf+ ++a
  gi|8331237   686 WSQ-----SVAPSHGTLSFSSATA    704

DUF11: domain 1 of 2, from 703 to 720: score 1.2, E = 19
                   *->tktvsnatarpGdtvtYT<-*
                      t t++ + ++pG t+tYT
  gi|8331237   703    TATSGSTDVTPGGTITYT    720

He_PIG: domain 1 of 2, from 715 to 740: score 1.3, E = 14
                   *->GtPtptvqp....Gsytftvtatdgsg<-*
                      Gt+t+t ++++ +Gs tftv+++dg g
  gi|8331237   715    GTITYT-PTtgysGSDTFTVQVSDGNG    740

Y_Y_Y: domain 1 of 1, from 730 to 752: score 2.0, E = 7
                   *->tikvkakdkdgnwsyddiasltftvl<-*
                      t++v++ d +g ++    + +++tv+
  gi|8331237   730    TFTVQVSDGNGGTAT---RVFNVTVA    752

Methyltransf_2: domain 1 of 1, from 735 to 753: score 0.1, E = 7.8
                CS    CCCEC.TS-EEEEEEETTGG
                   *->trggeeDGeeervYgltpas<-*
                        +g ++G+++rv+  t+as
  gi|8331237   735    VSDG-NGGTATRVFNVTVAS    753

PPC: domain 2 of 2, from 743 to 813: score 2.1, E = 6.8
                CS    -EEEEEEEESTTCE EEEEEECTSSS...S... CCEEEEEEECCCS
                   *->dvdvysFtvpaggt.lsisldggsslrslsgnG.dadtlLywlldgd
                       ++v+ +tv+++ ++  ++ ++ +++ s+++   d+++ L  ++d+d
  gi|8331237   743    ATRVFNVTVASNVSpTFVTATAKTLSVSYNSAAiDLKPELH-ISDSD 788

                CS ESSSSTTCE-.....ECCTTEEEEEECC.-S
                   pslsaydaystTrdvdnggsdelisftapea<-*
                    s ++ ++++     + ++s+ ++sf+ ++a
  gi|8331237   789 -SSQTETWSQ-----SVAPSHGSLSFSSATA    813

PAP1: domain 1 of 1, from 771 to 822: score -0.3, E = 7.6
                CS    XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                   *->eassrstaspnglqssatqyasndnsssdsPSsgsdgftnqllsslg
                      + s++ + +p++  s +  +++ + s+s++PS gs++f +++++s +
  gi|8331237   771    YNSAAIDLKPELHISDSDSSQTETWSQSVAPSHGSLSFSSATATSGS 817

                CS XXXXX
                   tspeP<-*
                   t++ P
  gi|8331237   818 TDVTP    822

Secretin_N_2: domain 1 of 1, from 800 to 813: score 3.2, E = 2
                   *->aPgdGryslStsta<-*
                      aP+ G++s S +ta
  gi|8331237   800    APSHGSLSFSSATA    813

DUF11: domain 2 of 2, from 812 to 829: score 1.2, E = 19
                   *->tktvsnatarpGdtvtYT<-*
                      t t++ + ++pG t+tYT
  gi|8331237   812    TATSGSTDVTPGGTITYT    829

FMN_bind: domain 1 of 1, from 833 to 854: score 2.4, E = 4.4
                   *->GywEkgpitvlvtvPdddGkItgvki<-*
                      Gy+  g+ t++v v + dG++t+ ++
  gi|8331237   833    GYS--GTDTFTVQV-S-DGTVTATRV    854

Lamprin: domain 1 of 1, from 950 to 962: score 1.5, E = 3.1
                   *->KvAAPLAPvvAAi<-*
                      KvA PLAPvv A
  gi|8331237   950    KVAVPLAPVVVAP    962

DAG1: domain 1 of 1, from 1017 to 1069: score 12.0, E = 0.0015
                CS    XXXXXXXXXXXXXX..XXXXXXXXXXX..X..XXXXXXXXXXXXXXX
                   *->rlhvptellassedqGiikiseadKdgheLkapswLhwdadsrtLqG
                      r+++p +++  s    ++ +s+a   g  L  pswL +d+ s+tL G
  gi|8331237  1017    RVTIPLDAFVHSRSDAVVTLSAARVTGQPL--PSWLNFDSRSGTLAG 1061

                CS XXXXXXXX
                   LPLdtDKG<-*
                    P  + KG
  gi|8331237  1062 QPPADFKG    1069

DUF1196: domain 1 of 1, from 1018 to 1026: score 2.5, E = 6.4
                   *->mtvPLEAFv<-*
                      +t+PL+AFv
  gi|8331237  1018    VTIPLDAFV    1026

PsiA: domain 1 of 1, from 1026 to 1040: score 0.8, E = 5
                   *->MsarSrALvpLsaeq<-*
                         rS A v+Lsa++
  gi|8331237  1026    VHSRSDAVVTLSAAR    1040

He_PIG: domain 2 of 2, from 1035 to 1082: score 24.9, E = 2.7e-06
                   *->tytlTkpsdgslasysttpggggLPsGLtLdsstGritGtPtptvqp
                      t ++               +g +LPs+L++ds +G+++G P+
  gi|8331237  1035    TLSA------------ARVTGQPLPSWLNFDSRSGTLAGQPPADFK- 1068

                   Gsytftvtatdgsg<-*
                   G+  +++ a d +g
  gi|8331237  1069 GTMVVRIVARDDKG    1082

BiPBP_C: domain 1 of 1, from 1074 to 1091: score 4.4, E = 1.2
                   *->tLtVvDadGrsdrv.Vrf<-*
                      ++++ D+ G+ ++++Vr+
  gi|8331237  1074    RIVARDDKGQEATItVRI    1091

Peptidase_M16: domain 1 of 1, from 1074 to 1092: score 2.4, E = 4.2
                CS    EEEEEE-SSSSEEEEEEEES
                   *->rVasesdppadtsavglwid<-*
                      r++ ++d  ++ ++++++i+
  gi|8331237  1074    RIVARDD-KGQEATITVRIN    1092

Cadherin_pro: domain 1 of 1, from 1075 to 1091: score 2.4, E = 5.3
                CS    EEEEETTTTEEEEEEEEE--
                   *->VhAwDsetreqWeaevkvtl<-*
                      + A+D +++e   a++ v+
  gi|8331237  1075    IVARDDKGQE---ATITVRI    1091

//