hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /usr1/pfam-23.0/Pfam_fs
Sequence file: 86476082.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: gi|86476082|ref|NP_001034475.1|
Accession: [none]
Description: nasal embryonic LHRH factor isoform A [Mus musculus]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
UPF0547 Uncharacterised protein family UPF054 11.1 0.052 1
IQ IQ calmodulin-binding motif 7.8 0.4 1
TP1 Nuclear transition protein 1 3.4 2 1
PRD PRD domain 3.7 2.6 1
DUF551 Protein of unknown function (DUF551) 1.9 3.2 1
Agro_virD5 Agrobacterium VirD5 protein -0.8 3.6 1
AMP_N Aminopeptidase P, N-terminal domain 1.9 4.4 1
TIR TIR domain 0.9 5.4 1
IMPDH IMP dehydrogenase / GMP reductase dom 0.6 6 1
c-SKI_SMAD_bind c-SKI Smad4 binding domain 1.6 6.1 1
NUP Purine nucleoside permease (NUP) -0.2 6.3 1
Orthopox_N1 Orthopoxvirus N1 protein 0.7 6.4 1
IFRD Interferon-related developmental regu -0.2 6.5 1
PSI Plexin repeat 1.7 7.6 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
Agro_virD5 1/1 102 131 .. 740 769 .. -0.8 3.6
PSI 1/1 157 170 .. 50 63 .] 1.7 7.6
UPF0547 1/1 167 177 .. 1 11 [. 11.1 0.052
DUF551 1/1 190 196 .. 74 80 .] 1.9 3.2
TP1 1/1 248 268 .. 38 54 .] 3.4 2
IQ 1/1 254 268 .. 1 15 [. 7.8 0.4
AMP_N 1/1 276 287 .. 1 12 [. 1.9 4.4
NUP 1/1 346 354 .. 1 9 [. -0.2 6.3
c-SKI_SMAD_bind 1/1 382 398 .. 82 98 .] 1.6 6.1
IFRD 1/1 383 394 .. 354 365 .] -0.2 6.5
PRD 1/1 387 399 .. 1 13 [. 3.7 2.6
TIR 1/1 434 449 .. 131 150 .] 0.9 5.4
Orthopox_N1 1/1 503 516 .. 100 113 .] 0.7 6.4
IMPDH 1/1 524 532 .] 1 9 [. 0.6 6
Alignments of top-scoring domains:
Agro_virD5: domain 1 of 1, from 102 to 131: score -0.8, E = 3.6
*->YtvsRDPvLsPPsKeqapqLLHLGpRGqtE<-*
Yt+sR+P L+P s +a +L + R q E
gi|8647608 102 YTISREPALLPGSEAEAIELAVVKGRRQRE 131
PSI: domain 1 of 1, from 157 to 170: score 1.7, E = 7.6
CS ..B..TT-BCCCSS
*->dqwldwswsssqCp<-*
++w ++ + s+ Cp
gi|8647608 157 QSWAGSRQGSKECP 170
UPF0547: domain 1 of 1, from 167 to 177: score 11.1, E = 0.052
*->KtCPeCdaivp<-*
K+CP+C ++vp
gi|8647608 167 KECPGCAQLVP 177
DUF551: domain 1 of 1, from 190 to 196: score 1.9, E = 3.2
*->PLPEPPq<-*
PLPE+P
gi|8647608 190 PLPEAPG 196
TP1: domain 1 of 1, from 248 to 268: score 3.4, E = 2
*->KsRKRgDDAn....RnyRsHL<-*
K RKR D + +Rn+R HL
gi|8647608 248 KRRKRENDSAsviqRNFRKHL 268
IQ: domain 1 of 1, from 254 to 268: score 7.8, E = 0.4
CS HHHCHHHHHHHHHHH
*->rraaikIQaawRGyl<-*
++a +IQ+ +R +l
gi|8647608 254 NDSASVIQRNFRKHL 268
AMP_N: domain 1 of 1, from 276 to 287: score 1.9, E = 4.4
*->ipadefaaRRkr<-*
++a+ fa+RR+r
gi|8647608 276 VKAQTFAERRER 287
NUP: domain 1 of 1, from 346 to 354: score -0.2, E = 6.3
*->iqpKVmvIt<-*
+pKVm+I+
gi|8647608 346 LPPKVMLIS 354
c-SKI_SMAD_bind: domain 1 of 1, from 382 to 398: score 1.6, E = 6.1
CS CHHHHHHHHHHHHCC--
*->eeakLeqvLeevkekFd<-*
e+a+ e +Lee++ k +
gi|8647608 382 EHATFEDILEEIEKKLN 398
IFRD: domain 1 of 1, from 383 to 394: score -0.2, E = 6.5
*->RstFRDVlrfvE<-*
++tF D+l+ +E
gi|8647608 383 HATFEDILEEIE 394
PRD: domain 1 of 1, from 387 to 399: score 3.7, E = 2.6
CS HHHHHHHHHHHTS
*->eelleeiekklqi<-*
e++leeiekkl+i
gi|8647608 387 EDILEEIEKKLNI 399
TIR: domain 1 of 1, from 434 to 449: score 0.9, E = 5.4
CS SG.....GGCCHHHHHHHHH
*->dktersqsdrikfWkkalya<-*
+k+e d+i+fWk++
gi|8647608 434 EKEE----DMIHFWKRLSRL 449
Orthopox_N1: domain 1 of 1, from 503 to 516: score 0.7, E = 6.4
*->rmiekyfddlmidl<-*
+mie+yfd + l
gi|8647608 503 QMIETYFDFRLYRL 516
IMPDH: domain 1 of 1, from 524 to 532: score 0.6, E = 6
CS EB-GGGGEE
RF xxxxxxxxx
*->egLTFDDVL<-*
+ L+FDDVL
gi|8647608 524 KLLDFDDVL 532
//