hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /usr1/pfam-23.0/Pfam_fs
Sequence file:            90578280.fa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|90578280|ref|ZP_01234091.1|
Accession:      [none]
Description:    hypothetical protein VAS14_14554 [Vibrio angustum S14]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N
--------        -----------                             -----    ------- ---
Cna_B           Cna protein B-type domain                15.3    0.00036   1
TSP_3           Thrombospondin type 3 repeat             17.9    0.00036   6
Dockerin_1      Dockerin type I repeat                    9.5      0.089   4
CBM_4_9         Carbohydrate binding domain               7.0       0.16   1
UCR_TM          Ubiquinol cytochrome reductase transm     6.4       0.36   1
Binary_toxB     Clostridial binary toxin B/anthrax to     3.7       0.38   2
Vac_Fusion      Chordopoxvirus fusion protein             3.1       0.44   1
DUF302          Domain of unknown function DUF302         6.0       0.73   1
Ku_PK_bind      Ku C terminal domain like                 4.0       0.82   1
MAP1B_neuraxin  Neuraxin and MAP1B repeat                 5.4       0.89   3
LRR_1           Leucine Rich Repeat                       6.2          1   1
PilS            PilS N terminal                           3.7          1   2
YL1_C           YL1 nuclear protein C-terminal domain     6.7        1.1   1
SurA_N          SurA N-terminal domain                    3.7        1.1   1
CRAM_rpt        Cysteine-rich, acidic integral membra     3.2        1.1   1
DUF836          Glutaredoxin-like domain (DUF836)         4.4        1.4   1
UPF0300         Uncharacterised protein family (UPF03     3.6        1.5   1
Herpes_ORF11    Herpesvirus dUTPase protein               1.9        1.6   1
PPC             Bacterial pre-peptidase C-terminal do     4.2        1.6   1
NLE             NLE (NUC135) domain                       4.6        1.7   1
Sipho_tail      Siphovirus tail component protein         0.9        1.7   1
DicB            DicB protein                              2.8        1.7   1
MIP             Major intrinsic protein                   1.9        1.7   1
DUF1727         Domain of unknown function (DUF1727)      1.0          2   1
efhand          EF hand                                   5.6        2.3   2
Fasciclin       Fasciclin domain                          2.3        2.9   1
DUF1558         Protein of unknown function (DUF1558)     3.0        2.9   1
DUF823          Salmonella repeat of unknown function     1.1        3.1   1
Plasmodium_HRP  Plasmodium histidine-rich protein (HR     1.1        3.2   1
PIR             Yeast PIR protein repeat                  4.5        3.2   1
DUF1683         Protein of unknown function (DUF1683)     2.6        3.3   1
PC_rep          Proteasome/cyclosome repeat               3.8        3.3   2
BPL_LipA_LipB   Biotin/lipoate A/B protein ligase fam     2.8        3.3   1
Peptidase_M4_C  Thermolysin metallopeptidase, alpha-h     1.5        3.4   1
PKD             PKD domain                                2.4        3.5   1
tRNA-synt_1d    tRNA synthetases class I (R)              0.9        3.5   1
RanGAP1_C       RanGAP1 C-terminal domain                 1.2        3.7   1
DUF1968         Domain of unknown function (DUF1968)      1.8        3.8   1
DUF1989         Domain of unknown function (DUF1989)      1.4        3.8   1
Lant_dehyd_C    Lantibiotic dehydratase, C terminus       0.6        4.1   1
RHS_repeat      RHS Repeat                                3.4        4.1   1
Clat_adaptor_s  Clathrin adaptor complex small chain      2.3        4.2   1
ExoD            Exopolysaccharide synthesis, ExoD         2.3        4.4   1
Pox_A30L_A26L   Orthopoxvirus A26L/A30L protein           0.4        4.5   1
PD40            WD40-like Beta Propeller Repeat           2.5        4.7   1
Stap_Strp_toxin Staphylococcal/Streptococcal toxin, O     2.5        4.8   1
WD40            WD domain, G-beta repeat                  2.6        4.8   2
TrwC            TrwC relaxase                            -0.1        4.9   1
DUF328          Protein of unknown function (DUF328)      1.3        4.9   1
OstA_C          Organic solvent tolerance protein         0.4        4.9   1
DUF2098         Uncharacterized protein conserved in      2.9        5.2   1
ClpB_D2-small   C-terminal, D2-small domain, of ClpB      1.6        5.3   1
TraG_N          TraG-like protein, N-terminal region      0.8        5.3   1
Adhesin_Dr      Dr-family adhesin                         2.8        5.3   1
PPP5            PPP5                                      1.4        5.5   1
YMF19           Plant ATP synthase F0                     2.3        5.6   1
DUF1923         Domain of unknown function (DUF1923)      1.1        5.7   1
MNNL            N terminus of Notch ligand                2.5        5.7   1
Phage_sheath_1  Phage tail sheath protein                -0.9          6   1
Pterin_4a       Pterin 4 alpha carbinolamine dehydrat     1.8        6.4   1
Staphylokinase  Staphylokinase/Streptokinase family       1.9        6.5   1
Pox_IFNR        Poxvirus interferon gamma receptor       -0.4        6.5   1
YfkB            YfkB-like domain                         -0.3        6.5   1
A2M             Alpha-2-macroglobulin family              1.1        6.6   1
ig              Immunoglobulin domain                     2.2        6.6   1
Nup133_N        Nup133 N terminal like                   -0.6        6.6   1
Reovirus_L2     Reovirus core-spike protein lambda-2     -1.8        6.8   1
Big_2           Bacterial Ig-like domain (group 2)        1.9          7   1
Arteri_Gl       Arterivirus GL envelope glycoprotein      0.9        7.1   1
CT20            CT20 family                               0.7        7.1   1
DNA_pol_viral_C DNA polymerase (viral) C-terminal dom    -1.9        7.2   1
Methyltransf_6  Demethylmenaquinone methyltransferase     0.8        7.2   1
HisG_C          HisG, C-terminal domain                   2.1        7.3   1
Chal_sti_synt_N Chalcone and stilbene synthases, N-te    -0.4        7.3   1
CoA_trans       Coenzyme A transferase                    0.8        7.4   1
DUF1638         Protein of unknown function (DUF1638)     1.4        7.5   1
DUF297          TM1410 hypothetical-related protein       0.2        7.6   1
Autotransporter Autotransporter beta-domain               0.8        7.6   1
RE_Bpu10I       Bpu10I restriction endonuclease           0.0        7.9   1
DUF1833         Domain of unknown function (DUF1833)      1.3          8   1
DUF2202         Uncharacterized protein conserved in      1.1          8   1
DUF1512         Protein of unknown function (DUF1512)    -1.6        8.2   1
GlcNAc_2-epim   N-acylglucosamine 2-epimerase (GlcNAc    -0.8        8.3   1
Osmo_CC         Osmosensory transporter coiled coil       1.7        8.3   1
Bap31           B-cell receptor-associated protein 31     0.2        8.6   1
Harpin          Harpin protein (HrpN)                    -1.0        8.8   1
DUF1450         Protein of unknown function (DUF1450)     1.0        8.8   1
DUF1897         Domain of unknown function (DUF1897)      2.2        9.3   1
PTS_EIIB        phosphotransferase system, EIIB           2.4        9.3   1
Filamin         Filamin/ABP280 repeat                     1.4        9.5   1
P68HR           P68HR (NUC004) repeat                     2.5        9.5   1
COesterase      Carboxylesterase                         -2.1        9.7   1
FAD_binding_3   FAD binding domain                       -0.8        9.8   1
Germane         Sporulation and spore germination         1.5        9.8   1
DUF548          Protein of unknown function (DUF548)     -0.2        9.8   1
RNA_lig_T4_1    T4 RNA ligase (RNA_lig_T4_1)              0.6         10   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
CT20              1/1      26    35 ..   128   137 .]     0.7      7.1
LRR_1             1/1      40    60 ..     1    25 []     6.2        1
DUF1638           1/1      42    59 ..   137   154 ..     1.4      7.5
PPP5              1/1      72    86 ..    83    97 .]     1.4      5.5
DUF836            1/1     101   131 ..    85   116 .]     4.4      1.4
PC_rep            1/2     133   155 ..    10    38 .]     0.1       42
TrwC              1/1     150   290 ..   282   315 ..    -0.1      4.9
Binary_toxB       1/2     198   206 ..     1     9 [.     1.8      1.4
efhand            1/2     198   211 ..     8    21 ..     0.7       48
TSP_3             1/6     199   214 ..     1    15 []     4.1      4.9
DUF2098           1/1     241   258 ..    88   102 .]     2.9      5.2
Adhesin_Dr        1/1     271   277 ..   140   146 .]     2.8      5.3
CBM_4_9           1/1     345   389 ..   122   172 .]     7.0     0.16
Binary_toxB       2/2     397   409 ..     1    13 [.     1.9      1.3
TSP_3             2/6     398   410 ..     1    15 []     6.5     0.93
TSP_3             3/6     411   423 ..     1    15 []     2.6       14
NLE               1/1     421   450 ..     1    32 [.     4.6      1.7
DUF823            1/1     425   431 ..     1     7 [.     1.1      3.1
Dockerin_1        1/4     428   438 ..     1    11 [.     6.3     0.86
Staphylokinase    1/1     431   456 ..     1    26 [.     1.9      6.5
RHS_repeat        1/1     440   454 ..     1    18 [.     3.4      4.1
TSP_3             4/6     456   468 ..     1    15 []     1.9       23
Pox_IFNR          1/1     583   593 ..    53    63 ..    -0.4      6.5
Herpes_ORF11      1/1     591   606 ..     1    16 [.     1.9      1.6
DUF1968           1/1     656   681 ..    65    91 .]     1.8      3.8
Fasciclin         1/1     825   838 ..   132   145 ..     2.3      2.9
Dockerin_1        2/4     855   864 ..     1    10 [.     0.2       66
WD40              1/2     873   921 ..    15    38 .]     1.6       10
YfkB              1/1     888   908 ..   133   153 .]    -0.3      6.5
Dockerin_1        3/4     922   927 ..     1     6 [.     0.1       68
A2M               1/1     952   964 ..    67    79 ..     1.1      6.6
Lant_dehyd_C      1/1     969   994 ..     1    26 [.     0.6      4.1
SurA_N            1/1     986   994 ..   129   137 .]     3.7      1.1
Bap31             1/1    1025  1033 ..   208   216 .]     0.2      8.6
CoA_trans         1/1    1080  1100 ..   224   244 .]     0.8      7.4
PD40              1/1    1095  1116 ..     1    19 [.     2.5      4.7
DUF1989           1/1    1156  1168 ..     1    13 [.     1.4      3.8
Reovirus_L2       1/1    1156  1168 ..  1310  1323 .]    -1.8      6.8
DUF1897           1/1    1198  1209 ..     1    12 [.     2.2      9.3
DUF1833           1/1    1203  1221 ..   144   162 .]     1.3        8
YMF19             1/1    1251  1290 ..    51   101 .]     2.3      5.6
Arteri_Gl         1/1    1261  1280 ..     1    22 [.     0.9      7.1
efhand            2/2    1290  1310 ..     9    29 .]     4.9      3.5
Pterin_4a         1/1    1393  1407 ..     1    15 [.     1.8      6.4
DUF1727           1/1    1407  1413 ..   110   116 .]     1.0        2
FAD_binding_3     1/1    1413  1447 ..    78   115 ..    -0.8      9.8
PKD               1/1    1548  1568 ..    71    92 .]     2.4      3.5
Filamin           1/1    1698  1717 ..    29    55 ..     1.4      9.5
Phage_sheath_1    1/1    1764  1775 ..   685   696 .]    -0.9        6
PTS_EIIB          1/1    1764  1775 ..    24    35 .]     2.4      9.3
BPL_LipA_LipB     1/1    1798  1807 ..   147   156 .]     2.8      3.3
ExoD              1/1    1955  1986 ..     1    32 [.     2.3      4.4
Clat_adaptor_s    1/1    1973  1989 ..   148   164 .]     2.3      4.2
PPC               1/1    2042  2102 ..     6    85 .]     4.2      1.6
ig                1/1    2100  2145 ..    19    67 .]     2.2      6.6
Chal_sti_synt_N   1/1    2161  2182 ..     1    22 [.    -0.4      7.3
COesterase        1/1    2189  2216 ..   556   591 .]    -2.1      9.7
RE_Bpu10I         1/1    2204  2215 ..   212   225 .]     0.0      7.9
OstA_C            1/1    2210  2233 ..     1    26 [.     0.4      4.9
GlcNAc_2-epim     1/1    2238  2259 ..   353   381 .]    -0.8      8.3
DUF302            1/1    2241  2254 ..    52    66 .]     6.0     0.73
Harpin            1/1    2248  2270 ..     1    23 [.    -1.0      8.8
P68HR             1/1    2269  2298 ..     1    35 []     2.5      9.5
UCR_TM            1/1    2298  2313 ..     1    18 [.     6.4     0.36
DUF1558           1/1    2340  2362 ..    94   116 .]     3.0      2.9
Peptidase_M4_C    1/1    2366  2375 ..     1    10 [.     1.5      3.4
RanGAP1_C         1/1    2606  2622 ..   169   185 .]     1.2      3.7
DUF548            1/1    2619  2627 ..   230   238 .]    -0.2      9.8
TSP_3             5/6    2630  2645 ..     1    15 []     0.4       65
Dockerin_1        4/4    2631  2644 ..     1    14 [.     2.9      9.4
PilS              1/2    2720  2736 ..   138   161 .]     2.6      2.3
PIR               1/1    2739  2755 ..     1    18 []     4.5      3.2
MAP1B_neuraxin    1/3    2752  2761 ..     1    10 [.     3.9      2.7
Cna_B             1/1    2813  2857 ..     1    43 [.    15.3  0.00036
Pox_A30L_A26L     1/1    2900  2919 ..     1    21 [.     0.4      4.5
Sipho_tail        1/1    3012  3023 ..     1    12 [.     0.9      1.7
WD40              2/2    3066  3089 ..    14    38 .]     1.0       18
DUF1923           1/1    3159  3173 ..    24    38 ..     1.1      5.7
DUF297            1/1    3213  3230 ..   270   289 .]     0.2      7.6
MAP1B_neuraxin    2/3    3257  3265 ..     1     9 [.     0.1       51
Big_2             1/1    3268  3296 ..    55    90 .]     1.9        7
RNA_lig_T4_1      1/1    3306  3315 ..   287   296 .]     0.6       10
PilS              2/2    3319  3334 ..   146   161 .]     1.2      5.9
tRNA-synt_1d      1/1    3391  3403 ..   363   375 .]     0.9      3.5
Vac_Fusion        1/1    3475  3480 ..    52    57 .]     3.1     0.44
Autotransporter   1/1    3541  3568 ..   143   168 ..     0.8      7.6
YL1_C             1/1    3560  3576 ..    14    30 .]     6.7      1.1
DUF1450           1/1    3613  3621 ..    47    55 ..     1.0      8.8
TSP_3             6/6    3621  3633 ..     1    15 []     2.4       16
Ku_PK_bind        1/1    3664  3672 ..     1     9 [.     4.0     0.82
MIP               1/1    3664  3673 ..   212   221 ..     1.9      1.7
Germane           1/1    3769  3796 ..    97   124 .]     1.5      9.8
UPF0300           1/1    3801  3816 ..   206   221 .]     3.6      1.5
MNNL              1/1    3855  3861 ..     1     7 [.     2.5      5.7
Plasmodium_HRP    1/1    3950  3962 ..     1    14 [.     1.1      3.2
Osmo_CC           1/1    3973  3993 ..     1    21 [.     1.7      8.3
DUF1683           1/1    3993  4012 ..    64    85 ..     2.6      3.3
DUF328            1/1    4019  4032 ..   240   254 .]     1.3      4.9
DUF1512           1/1    4152  4159 ..   367   374 .]    -1.6      8.2
Methyltransf_6    1/1    4188  4194 ..   179   185 .]     0.8      7.2
CRAM_rpt          1/1    4281  4295 ..     9    24 .]     3.2      1.1
Stap_Strp_toxin   1/1    4324  4330 ..    88    94 .]     2.5      4.8
MAP1B_neuraxin    3/3    4365  4374 ..     1    10 [.     1.4       18
DUF2202           1/1    4379  4394 ..   148   163 .]     1.1        8
TraG_N            1/1    4464  4474 ..     1    11 [.     0.8      5.3
Nup133_N          1/1    4502  4543 ..   359   408 ..    -0.6      6.6
DicB              1/1    4523  4531 ..    42    50 ..     2.8      1.7
ClpB_D2-small     1/1    4563  4581 ..    75    95 .]     1.6      5.3
PC_rep            2/2    4595  4622 ..     7    38 .]     3.7      3.5
HisG_C            1/1    4604  4613 ..    71    80 .]     2.1      7.3
DNA_pol_viral_C   1/1    4649  4657 ..    92   100 ..    -1.9      7.2

Alignments of top-scoring domains:
CT20: domain 1 of 1, from 26 to 35: score 0.7, E = 7.1
                   *->FsLPesiyge<-*
                      FsLP ++y+e
  gi|9057828    26    FSLPLEDYSE    35

LRR_1: domain 1 of 1, from 40 to 60: score 6.2, E = 1
                CS    T-EEEETTSSS.BCHSCHHHHHH HH
                   *->nLeeLdLsgCNPpsltgslpssl.nl<-*
                      nLe + L + N  +++   p  +++l
  gi|9057828    40    NLERVVLVD-N--HIS-MSPE-FeKL    60

DUF1638: domain 1 of 1, from 42 to 59: score 1.4, E = 7.5
                   *->krVaKIdTGlsyekdFdk<-*
                      +rV+ +d+ +s+ ++F+k
  gi|9057828    42    ERVVLVDNHISMSPEFEK    59

PPP5: domain 1 of 1, from 72 to 86: score 1.4, E = 5.5
                   *->dvkelLkklPsLVei<-*
                      dv++lLk+  + V+i
  gi|9057828    72    DVINLLKSDTNVVDI    86

DUF836: domain 1 of 1, from 101 to 131: score 4.4, E = 1.4
                CS    EEEETT........SEEEESS--HHHHHHHHH
                   *->VlalvgikkffvlelellswrldeeqLrawLe<-*
                      V+ l++i+++++   +++ ++l  + ++++L+
  gi|9057828   101    VITLNNINQYKNK-IKHIGHKLGSDGVINFLA    131

PC_rep: domain 1 of 2, from 133 to 155: score 0.1, E = 42
                   *->haGsgnedealelLlvpyllsdtsnevra<-*
                      ++G +ne e+++lL+ ++   ++ ++v +
  gi|9057828   133    DLG-NNE-EGINLLD-QF---SKLANVTV    155

TrwC: domain 1 of 1, from 150 to 290: score -0.1, E = 4.9
                CS    EES-E
                   *->vaNmt..........................................
                      +aN+t   ++++++++ ++++ + +   ++++ + ++ ++  + ++
  gi|9057828   150    LANVTvlasndktgsslkggdwdlellfgdnsfsftpfpeylqytdi 196

                CS
                   ..................................................
                    + ++++++  + +++ + ++ +++  ++++ +++ ++++++++  ++++
  gi|9057828   197 ldldsdndgildvdegcsvnsadtnlftngsldgtvgqnstpnpwlksns 246

                CS                    ..EECTT EEE-SC-C...SSS..HHHHHH
                   ...................palraDG.kWRsLdsdkqKgvknGfgEely<
                   ++++++++ +++ ++ +++p +  DG++W+s++s      + Gf+E++y
  gi|9057828   247 pdtdngtgctggmsncgttPTISNDGgTWVSIASN-----DSGFSEMIY  290

                CS
                   -*

  gi|9057828     -    -

Binary_toxB: domain 1 of 2, from 198 to 206: score 1.8, E = 1.4
                   *->dlDtDnDgI<-*
                      dlD+DnDgI
  gi|9057828   198    DLDSDNDGI    206

efhand: domain 1 of 2, from 198 to 211: score 0.7, E = 48
                CS    HHTTTSSSEEHHHH
                   *->efDkDgDGkIsfeE<-*
                      ++D D+DG ++++E
  gi|9057828   198    DLDSDNDGILDVDE    211

TSP_3: domain 1 of 6, from 199 to 214: score 4.1, E = 4.9
                CS    --TT-SSS-.. GGGS
                   *->eDsDnDgvgdn.DaCd<-*
                       DsDnDg+ d +  C
  gi|9057828   199    LDSDNDGILDVdEGCS    214

DUF2098: domain 1 of 1, from 241 to 258: score 2.9, E = 5.2
                   *->dle....dgdngceGaGAG<-*
                      +l+++++d+dng ++ G G
  gi|9057828   241    WLKsnspDTDNGTGCTG-G    258

Adhesin_Dr: domain 1 of 1, from 271 to 277: score 2.8, E = 5.3
                CS    EEEEEES
                   *->dGGYWas<-*
                      dGG+W+s
  gi|9057828   271    DGGTWVS    277

CBM_4_9: domain 1 of 1, from 345 to 389: score 7.0, E = 0.16
                   *->vltgeWtklegtFTipakgtastvvlyvelggtepdsttdfyvDdvs
                      +l + W++ ++tFT++     ++ +l+++      + +t++ +D +s
  gi|9057828   345    TLGTNWQQQTFTFTPS----VTGSYLIIFKNA--NTVNTTLSIDGIS 385

                   ltdv<-*
                   +++
  gi|9057828   386 ISGG    389

Binary_toxB: domain 2 of 2, from 397 to 409: score 1.9, E = 1.3
                   *->dlDtDnDgIPDlw<-*
                        DtDnDg PD +
  gi|9057828   397    GQDTDNDGTPDHL    409

TSP_3: domain 2 of 6, from 398 to 410: score 6.5, E = 0.93
                CS    --TT-SSS-..GGGS
                   *->eDsDnDgvgdnDaCd<-*
                      +D+DnDg    D+ d
  gi|9057828   398    QDTDNDGTP--DHLD    410

TSP_3: domain 3 of 6, from 411 to 423: score 2.6, E = 14
                CS    --TT-SSS-..GGGS
                   *->eDsDnDgvgdnDaCd<-*
                      +DsD+D     Da +
  gi|9057828   411    TDSDGDSCN--DAVE    423

NLE: domain 1 of 1, from 421 to 450: score 4.6, E = 1.7
                   *->qVqvrFvTkegdellavpdspfaiPvdltrae<-*
                       V++ F++ +gd +  v+++ ++ + ++t  +
  gi|9057828   421    AVEAGFTDANGDGE--VDGTGYDADGKVTGSD    450

DUF823: domain 1 of 1, from 425 to 431: score 1.1, E = 3.1
                   *->GvTgAdG<-*
                      G+T+A+G
  gi|9057828   425    GFTDANG    431

Dockerin_1: domain 1 of 4, from 428 to 438: score 6.3, E = 0.86
                CS    -TT-SS--SHH
                   *->DvNgDGkVnal<-*
                      D NgDG V+++
  gi|9057828   428    DANGDGEVDGT    438

Staphylokinase: domain 1 of 1, from 431 to 456: score 1.9, E = 6.5
                CS    CSESCCCSSEEEEEEEEEEETTS-CC
                   *->npaesvnteykvsfnvkgvDldfnel<-*
                       ++e+++t+y+ +++v+g+D+ ++++
  gi|9057828   431    GDGEVDGTGYDADGKVTGSDGYTTPA    456

RHS_repeat: domain 1 of 1, from 440 to 454: score 3.4, E = 4.1
                   *->YDanGrLtavtdpsgpvg<-*
                      YDa+G++t+   ++g ++
  gi|9057828   440    YDADGKVTG---SDGYTT    454

TSP_3: domain 4 of 6, from 456 to 468: score 1.9, E = 23
                CS    --TT-SSS-..GGGS
                   *->eDsDnDgvgdnDaCd<-*
                      +D+Dn g g  D+ +
  gi|9057828   456    ADTDNSGTG--DHLE    468

Pox_IFNR: domain 1 of 1, from 583 to 593: score -0.4, E = 6.5
                   *->qtmYtnvPEGt<-*
                      qtmYt vP Gt
  gi|9057828   583    QTMYTVVPQGT    593

Herpes_ORF11: domain 1 of 1, from 591 to 606: score 1.9, E = 1.6
                   *->fdlgaWtvtihpgyft<-*
                      ++ gaW+vt+ +g+f+
  gi|9057828   591    QGTGAWRVTWPNGRFL    606

DUF1968: domain 1 of 1, from 656 to 681: score 1.8, E = 3.8
                   *->NqsdfaCedaFkktNatiPfsdvleps<-*
                      N +  + eda+++t  +iP sd + +s
  gi|9057828   656    NSTGSGDEDAYQNTSHSIP-SDNFSIS    681

Fasciclin: domain 1 of 1, from 825 to 838: score 2.3, E = 2.9
                CS    EESSEEEEEESS-T
                   *->eatNGViHvIDkVL<-*
                      +a+NG+ H+ID+V+
  gi|9057828   825    DANNGAKHIIDSVI    838

Dockerin_1: domain 2 of 4, from 855 to 864: score 0.2, E = 66
                CS    -TT-SS--SH
                   *->DvNgDGkVna<-*
                      Dv+g+  +na
  gi|9057828   855    DVDGNSDINA    864

WD40: domain 1 of 2, from 873 to 921: score 1.6, E = 10
                CS    EEEETT                         SSSEEEEEETTSEEEE
                   *->vafspd.........................sgpllasgSrDgtiki
                      v f+p++++ ++++++   ++  +++ + + s ++++++S+ g + +
  gi|9057828   873    VQFNPNnadispssnnilitnhyandvditlSNEVVITASASGFVSL 919

                CS EE
                   Wd<-*
                   W
  gi|9057828   920 WI    921

YfkB: domain 1 of 1, from 888 to 908: score -0.3, E = 6.5
                   *->nvLVknsYYpdvDFkkrsarl<-*
                      n+L+ n Y +dvD +  + ++
  gi|9057828   888    NILITNHYANDVDITLSNEVV    908

Dockerin_1: domain 3 of 4, from 922 to 927: score 0.1, E = 68
                CS    -TT-SS
                   *->DvNgDG<-*
                      D+N+DG
  gi|9057828   922    DLNQDG    927

A2M: domain 1 of 1, from 952 to 964: score 1.1, E = 6.6
                   *->vdLnLPYSVvRGE<-*
                      ++++LP SVv GE
  gi|9057828   952    LSFSLPSSVVHGE    964

Lant_dehyd_C: domain 1 of 1, from 969 to 994: score 0.6, E = 4.1
                   *->isyaeLvdlLaeefpdapaekvetyL<-*
                      i+ya+ ++++a+  ++a+ ++ve+yL
  gi|9057828   969    IRYATDAAEIASPTGEASDGEVEDYL    994

SurA_N: domain 1 of 1, from 986 to 994: score 3.7, E = 1.1
                   *->sdqEVdnfL<-*
                      sd+EV+++L
  gi|9057828   986    SDGEVEDYL    994

Bap31: domain 1 of 1, from 1025 to 1033: score 0.2, E = 8.6
                   *->aegLqkEYd<-*
                      +egL++EY+
  gi|9057828  1025    SEGLTNEYF    1033

CoA_trans: domain 1 of 1, from 1080 to 1100: score 0.8, E = 7.4
                CS    CSSCGGCEBCCGGHCCEEETT
                   *->geldpltvhtPGvlvdrvvea<-*
                      g++  l+ ++P ++ +++v
  gi|9057828  1080    GKIAELNTLIPQMYYQDIVTT    1100

PD40: domain 1 of 1, from 1095 to 1116: score 2.5, E = 4.7
                   *->grltntsg...eggPtwSPDGk<-*
                      +++++t+g++  +g++wSP++k
  gi|9057828  1095    QDIVTTPGqeiTWGFYWSPRRK    1116

DUF1989: domain 1 of 1, from 1156 to 1168: score 1.4, E = 3.8
                   *->detvpagsgwsfv<-*
                      ++tvpag + ++v
  gi|9057828  1156    SYTVPAGQYITRV    1168

Reovirus_L2: domain 1 of 1, from 1156 to 1168: score -1.8, E = 6.8
                CS    -EEE-SS-EEEEE-
                   *->TyiVPpGrYtlVvv<-*
                      +y+VP+G+Y  ++v
  gi|9057828  1156    SYTVPAGQY-ITRV    1168

DUF1897: domain 1 of 1, from 1198 to 1209: score 2.2, E = 9.3
                   *->aggaatGqaDYS<-*
                      + ++ tG aDYS
  gi|9057828  1198    GDAPDTGTADYS    1209

DUF1833: domain 1 of 1, from 1203 to 1221: score 1.3, E = 8
                   *->sgtAGydDllNqravrlry<-*
                      +gtA y++ll  +++r+ +
  gi|9057828  1203    TGTADYSSLLTSNGPRHSF    1221

YMF19: domain 1 of 1, from 1251 to 1290: score 2.3, E = 5.6
                   *->lsslisevsklqkeqsllpvskdsllansslstsdlsvyNivsnsyl
                      +s +++ +  l+ ++s+ ++s+++l+ n+   +s         n y+
  gi|9057828  1251    SSNDEDAIAGLGLYDSSASLSFSQLVHNT--TSS---------NAYF 1286

                   yssl<-*
                   y ++
  gi|9057828  1287 YAWV    1290

Arteri_Gl: domain 1 of 1, from 1261 to 1280: score 0.9, E = 7.1
                   *->mgslddcvngnsstyqyiYtlT<-*
                      +g++d+  + ++s +q+++++T
  gi|9057828  1261    LGLYDS--SASLSFSQLVHNTT    1280

efhand: domain 2 of 2, from 1290 to 1310: score 4.9, E = 3.5
                CS    HTTTSSSEEHHHHHHHHHHHH
                   *->fDkDgDGkIsfeEfkaalkkl<-*
                      +D D++Gk +++Ef+++ ++
  gi|9057828  1290    VDWDKNGKFERDEFIEGGTES    1310

Pterin_4a: domain 1 of 1, from 1393 to 1407: score 1.8, E = 6.4
                CS    -S--B--HHHHHHHH
                   *->rakasaLsdeelsek<-*
                      +  ++aL+++e+se+
  gi|9057828  1393    ASSSQALTGAEISEL    1407

DUF1727: domain 1 of 1, from 1407 to 1413: score 1.0, E = 2
                   *->LaTYTAM<-*
                      La+YT++
  gi|9057828  1407    LANYTSF    1413

FAD_binding_3: domain 1 of 1, from 1413 to 1447: score -0.8, E = 9.8
                CS    ECCE....TTTTT---EE-SEEEEEECC...HHHTT-T
                   *->fyntSlaGDElgdirtwgtrpraradldfsvlltsptr<-*
                      f+++S +GDEl+ +++ g++p  r +l+   +l+++++
  gi|9057828  1413    FGGVSIVGDELHSTPASGSHPAKRFELE---ILAPGQQ    1447

PKD: domain 1 of 1, from 1548 to 1568: score 2.4, E = 3.5
                CS    EEEEEEEETTCEEEEEEEEEEE
                   *->tVtLtvsngvgsasattttvtV<-*
                      t++Lt++n+ gs   +  ++ V
  gi|9057828  1548    TIQLTAMNDDGSLIEQ-SPIFV    1568

Filamin: domain 1 of 1, from 1698 to 1717: score 1.4, E = 9.5
                CS    EEEE-S. SSSSSSTT--EEEEEE...S
                   *->tVdtkdr.AgvpvgGggeLeVtvtlgng<-*
                      tV ++d +A     G+g+L++tv+   g
  gi|9057828  1698    TVSCNDFsA-----GSGDLGATVH---G    1717

Phage_sheath_1: domain 1 of 1, from 1764 to 1775: score -0.9, E = 6
                   *->FrfviTstylvd<-*
                      +r++iT++ l+d
  gi|9057828  1764    LRLRITDDALTD    1775

PTS_EIIB: domain 1 of 1, from 1764 to 1775: score 2.4, E = 9.3
                CS    EEEEES-GCC--
                   *->LRlvvkDeskvD<-*
                      LRl + D++++D
  gi|9057828  1764    LRLRITDDALTD    1775

BPL_LipA_LipB: domain 1 of 1, from 1798 to 1807: score 2.8, E = 3.3
                CS    EEEEEEEEEC
                   *->hhgtlgvgiN<-*
                      h++t++v+i+
  gi|9057828  1798    HQITINVDID    1807

ExoD: domain 1 of 1, from 1955 to 1986: score 2.3, E = 4.4
                   *->aslsdlLdrladaeegeiVslgdlldalGeRs<-*
                        +sd++ rl+  +++  + ++++l +++eRs
  gi|9057828  1955    LVISDTVMRLRIVPDDQFTNVDEVLTSVDERS    1986

Clat_adaptor_s: domain 1 of 1, from 1973 to 1989: score 2.3, E = 4.2
                CS    --HHHHHHHHHHHHHHH
                   *->tskkeVlkrvalldele<-*
                      t+++eVl +v+++ +++
  gi|9057828  1973    TNVDEVLTSVDERSTAD    1989

PPC: domain 1 of 1, from 2042 to 2102: score 4.2, E = 1.6
                CS    EEEESTTCEEEEEEECTSSS...S...CCEEEEEEECCCS ESSSST
                   *->sFtvpaggtlsisldggsslrslsgnGdadtlLywlldgd.pslsay
                      +++v+ g++ls++ dg+++        d d + + +l+++   +s+
  gi|9057828  2042    RWSVSDGDDLSVDDDGNGD--------DEDGVTF-ALYKGvVGDSSI 2079

                CS TCE-.....ECCTTEEEEEECC.-SEEEEEEEEE
                   daystTrdvdnggsdelisftapeaGtYyirVyg<-*
                   +++s           ++i +   e+G   i+V+
  gi|9057828  2080 TWNS-----------SSIAVETSEDGYVSIWVDW    2102

ig: domain 1 of 1, from 2100 to 2145: score 2.2, E = 6.6
                CS    EEEEEETTC-SS-CEEEEEEETSSCCCEEEEEEESSE-GGG-EEEEE
                   *->vtWfkegkgleessetgtdenrvssqtstslLtisnvteedsGtYtC
                      v+W+ +g+ +e+ ++++ d+  ++++++   ++ s      +GtY+
  gi|9057828  2100    VDWQNDGQFTESDDDIVLDWAVDKGSNI---YRMSIPGSVGNGTYWA 2143

                CS EE
                   vv<-*
                   +v
  gi|9057828  2144 RV    2145

Chal_sti_synt_N: domain 1 of 1, from 2161 to 2182: score -0.4, E = 7.3
                CS    -------------SS-EEEEEE
                   *->vsveeirkaqraeGpAtiLAiG<-*
                      ++  e++ +q   Gp t LA+G
  gi|9057828  2161    AATGEVEDSQVTVGPVTCLALG    2182

COesterase: domain 1 of 1, from 2189 to 2216: score -2.1, E = 9.7
                CS    -BB-TTTSEEEEECSSCEECSC EECCSCC..HHHHH
                   *->ppytseeqkYyllntllnittk.lreedPrkvkcafw<-*
                      p ++s+    +l +t++ i+t++ r+++      afw
  gi|9057828  2189    PSSNSS----ILGTTNEVIVTPnARMQR-----GAFW    2216

RE_Bpu10I: domain 1 of 1, from 2204 to 2215: score 0.0, E = 7.9
                   *->wkpkvndrLeRGkl<-*
                      + p  n+r++RG +
  gi|9057828  2204    VTP--NARMQRGAF    2215

OstA_C: domain 1 of 1, from 2210 to 2233: score 0.4, E = 4.9
                   *->knRgyrfnwkhqfrindnWsGfgvdy<-*
                      ++Rg+ f ++ +f++n+ ++ +++ +
  gi|9057828  2210    MQRGA-FWTQNRFDMNSEFR-LRFGI    2233

GlcNAc_2-epim: domain 1 of 1, from 2238 to 2259: score -0.8, E = 8.3
                   *->ydkldedGeKsvaepvpaGKsdFYHllgA<-*
                      +d++ +dG+ +v++++p    +     gA
  gi|9057828  2238    RDRYGADGVVFVMHNDPS--GT-----GA    2259

DUF302: domain 1 of 1, from 2241 to 2254: score 6.0, E = 0.73
                CS    E.EETTEEEEEE--H
                   *->yededGkvevsyidP<-*
                      y  +dG+v+v+++dP
  gi|9057828  2241    Y-GADGVVFVMHNDP    2254

Harpin: domain 1 of 1, from 2248 to 2270: score -1.0, E = 8.8
                   *->MslntsplgasalqvsllGggnn<-*
                        +   p g++al+v + G+g++
  gi|9057828  2248    FVMHNDPSGTGALGVVGSGLGAQ    2270

P68HR: domain 1 of 1, from 2269 to 2298: score 2.5, E = 9.5
                   *->sAGkqgGFrtgnprgtYqnGYdsLlkrdfGskaqn<-*
                      + ++q +F  g +  t++nG  +    d G+++
  gi|9057828  2269    AQNIQNSF--GVEFDTFENGARA---NDLGNQSDH    2298

UCR_TM: domain 1 of 1, from 2298 to 2313: score 6.4, E = 0.36
                   *->AhTDvPevPDfSeLSSVP<-*
                       hT++  +P  S+LSSVP
  gi|9057828  2298    -HTAI-MIPSTSNLSSVP    2313

DUF1558: domain 1 of 1, from 2340 to 2362: score 3.0, E = 2.9
                   *->rhvElvndedkkksLkiaelkre<-*
                      +  E   d+d++ sL+i +++ +
  gi|9057828  2340    QNFEYYFDGDLYDSLNIDLVNTY    2362

Peptidase_M4_C: domain 1 of 1, from 2366 to 2375: score 1.5, E = 3.4
                CS    T---SSCCHH
                   *->aGLvYegqSG<-*
                      ++L+Y+g+ G
  gi|9057828  2366    SNLIYYGMTG    2375

RanGAP1_C: domain 1 of 1, from 2606 to 2622: score 1.2, E = 3.7
                CS    GGTTHHHHHHHHHHHHH
                   *->LEscasARhaLlitLyk<-*
                      LEs+  ARh L  + y
  gi|9057828  2606    LESNNGARHGLGTNRYD    2622

DUF548: domain 1 of 1, from 2619 to 2627: score -0.2, E = 9.8
                   *->hRFDIYlpa<-*
                      +R+D Yl++
  gi|9057828  2619    NRYDLYLGT    2627

TSP_3: domain 5 of 6, from 2630 to 2645: score 0.4, E = 65
                CS    --TT-SSS-.. GGGS
                   *->eDsDnDgvgdn.DaCd<-*
                       D+DnDg+ +  D
  gi|9057828  2630    PDADNDGFVNGvDVST    2645

Dockerin_1: domain 4 of 4, from 2631 to 2644: score 2.9, E = 9.4
                CS    -TT-SS--SHHHHH
                   *->DvNgDGkVnalDla<-*
                      D ++DG Vn+ D +
  gi|9057828  2631    DADNDGFVNGVDVS    2644

PilS: domain 1 of 2, from 2720 to 2736: score 2.6, E = 2.3
                   *->AtmItaCtaDnGrtGtNTltfTsn<-*
                      At  +aC ++     ++Tl f  +
  gi|9057828  2720    AT--AACVDG-----SATLSFSGF    2736

PIR: domain 1 of 1, from 2739 to 2755: score 4.5, E = 3.2
                   *->aaavSQItDGQvQatttt<-*
                       +a+SQIt + + +tt t
  gi|9057828  2739    -SATSQITFSRIRITTDT    2755

MAP1B_neuraxin: domain 1 of 3, from 2752 to 2761: score 3.9, E = 2.7
                   *->TTrtPddsgY<-*
                      TT t+d++gY
  gi|9057828  2752    TTDTLDAEGY    2761

Cna_B: domain 1 of 1, from 2813 to 2857: score 15.3, E = 0.00036
                CS    -TT-EEEEEETTEEE      E--TTSEEEEEEE....-SEEEEEEE
                   *->LeGAeftLldkdgnv......tTdenGkytftnLPKykppGdYtvkE
                      ++G+++tL++ + + ++ ++  Td++G+y+   L    + G Yt+ E
  gi|9057828  2813    IPGVTITLYNRTPGNescqsiQTDADGNYSLAAL----EGGLYTIFE 2855

                CS EE
                   tk<-*
                   t+
  gi|9057828  2856 TA    2857

Pox_A30L_A26L: domain 1 of 1, from 2900 to 2919: score 0.4, E = 4.5
                   *->mAniinLWnGivPtvqDvnvA<-*
                       An i + n iv  vqD n A
  gi|9057828  2900    -ANQIVINNPIVASVQDQNFA    2919

Sipho_tail: domain 1 of 1, from 3012 to 3023: score 0.9, E = 1.7
                   *->asviFNGvdLSe<-*
                      ++v+FN vd+++
  gi|9057828  3012    FNVSFNQVDITD    3023

WD40: domain 2 of 2, from 3066 to 3089: score 1.0, E = 18
                CS    EEEEETTSSSEEEEEETTSEEEEEE
                   *->cvafspdsgpllasgSrDgtikiWd<-*
                      +va++p   +++    rDgt+k +d
  gi|9057828  3066    DVAINPL-NNVMYGVLRDGTVKRYD    3089

DUF1923: domain 1 of 1, from 3159 to 3173: score 1.1, E = 5.7
                CS    EEEEE-SSS-EEEEE
                   *->viAAnvGKEPKEitG<-*
                      ++A  +G EPK itG
  gi|9057828  3159    IVAVPIGNEPKNITG    3173

DUF297: domain 1 of 1, from 3213 to 3230: score 0.2, E = 7.6
                CS    EEEE-SS--H HHH...HHHH
                   *->DYvddgakid.eniYTTtRar<-*
                      DY+ ++++ ++e i   tR++
  gi|9057828  3213    DYIVTSDDGGpEHI---TRNN    3230

MAP1B_neuraxin: domain 2 of 3, from 3257 to 3265: score 0.1, E = 51
                   *->TTrtPddsg<-*
                      +++tPdd++
  gi|9057828  3257    IGSTPDDED    3265

Big_2: domain 1 of 1, from 3268 to 3296: score 1.9, E = 7
                CS    E....TTTEEEEE-SSS-EEEEEEETT.TEEEEEEE
                   *->sntnSgstGlVtalakGtatItatsgdgnksasvtv<-*
                      s     ++ +V  +a G a It+ + + n++ ++t+
  gi|9057828  3268    S-----NQVRVFVNA-GAAEITVPFTN-NSGSEATI    3296

RNA_lig_T4_1: domain 1 of 1, from 3306 to 3315: score 0.6, E = 10
                CS    TT-HHHHHHH
                   *->ngehDDLkal<-*
                      ng +DDL+a+
  gi|9057828  3306    NGFSDDLRAQ    3315

PilS: domain 2 of 2, from 3319 to 3334: score 1.2, E = 5.9
                   *->aDnGrtGtNTltfTsn<-*
                      ++++ tG++Tlt+T
  gi|9057828  3319    SAGETTGDKTLTWTGL    3334

tRNA-synt_1d: domain 1 of 1, from 3391 to 3403: score 0.9, E = 3.5
                   *->lssnrdtdydfDl<-*
                      +ss ++t+yd Dl
  gi|9057828  3391    TSSANTTSYDLDL    3403

Vac_Fusion: domain 1 of 1, from 3475 to 3480: score 3.1, E = 0.44
                   *->IDvQTG<-*
                      +DvQTG
  gi|9057828  3475    VDVQTG    3480

Autotransporter: domain 1 of 1, from 3541 to 3568: score 0.8, E = 7.6
                CS    EEEEEEEEEEE-- - -EEEEEEEEEEE
                   *->lgasleagydfkl.e.lrltPfaglqys<-*
                      lg s+++gy+++++ ++ + P  +l y+
  gi|9057828  3541    LGMSAGGGYTLPFdSdWAYDPTTQLIYA    3568

YL1_C: domain 1 of 1, from 3560 to 3576: score 6.7, E = 1.1
                   *->DPkTglpYanaeaFkvI<-*
                      DP T+l Ya+  +F v+
  gi|9057828  3560    DPTTQLIYATEMEFGVL    3576

DUF1450: domain 1 of 1, from 3613 to 3621: score 1.0, E = 8.8
                   *->lfALVnGev<-*
                      l+ALV+Ge+
  gi|9057828  3613    LYALVDGEY    3621

TSP_3: domain 6 of 6, from 3621 to 3633: score 2.4, E = 16
                CS    --TT-SSS-..GGGS
                   *->eDsDnDgvgdnDaCd<-*
                       DsD++g+   D+
  gi|9057828  3621    YDSDGNGIL--DTTG    3633

Ku_PK_bind: domain 1 of 1, from 3664 to 3672: score 4.0, E = 0.82
                CS    SS-HHHHHH
                   *->GsvNPaqDF<-*
                      G +NPa+DF
  gi|9057828  3664    GCINPARDF    3672

MIP: domain 1 of 1, from 3664 to 3673: score 1.9, E = 1.7
                CS    -SSCHHHHHH
                   *->asMNPARSFG<-*
                      +++NPAR+FG
  gi|9057828  3664    GCINPARDFG    3673

Germane: domain 1 of 1, from 3769 to 3796: score 1.5, E = 9.8
                   *->siVnTLtqfpgvdkVqilveGkplellg<-*
                      ++  T+  + g + V + v+G +l ++
  gi|9057828  3769    QVIATALPAAGTHAVDLVVDGAKLGTYS    3796

UPF0300: domain 1 of 1, from 3801 to 3816: score 3.6, E = 1.5
                   *->mrkelleDLslCekfe<-*
                      +r ++ ++++ C+kf+
  gi|9057828  3801    LRFRFCKEANHCDKFN    3816

MNNL: domain 1 of 1, from 3855 to 3861: score 2.5, E = 5.7
                   *->ssGvFEL<-*
                      ssG+FEL
  gi|9057828  3855    SSGNFEL    3861

Plasmodium_HRP: domain 1 of 1, from 3950 to 3962: score 1.1, E = 3.2
                CS    XXXXXXXXXXXX--
                   *->mvsFsKnKvLsAAv<-*
                       vsF Kn++Ls  v
  gi|9057828  3950    -VSFTKNQLLSRMV    3962

Osmo_CC: domain 1 of 1, from 3973 to 3993: score 1.7, E = 8.3
                   *->sDieEAkElLqehydniEqKi<-*
                      +D++   E L  h+dn  q i
  gi|9057828  3973    GDVDPSGEFLYVHHDNWQQMI    3993

DUF1683: domain 1 of 1, from 3993 to 4012: score 2.6, E = 3.3
                   *->vrveLkNpTklvqEveanline<-*
                      +r++L N+T +++E+++++  +
  gi|9057828  3993    IRIHLINRTFEIVEFDTAV--N    4012

DUF328: domain 1 of 1, from 4019 to 4032: score 1.3, E = 4.9
                   *->gFadldGYafdeelS<-*
                      +F  +dG+ ++++l
  gi|9057828  4019    AF-ASDGFLYNPDLP    4032

DUF1512: domain 1 of 1, from 4152 to 4159: score -1.6, E = 8.2
                   *->GNTVGVpq<-*
                      GN+ G+++
  gi|9057828  4152    GNSNGIAD    4159

Methyltransf_6: domain 1 of 1, from 4188 to 4194: score 0.8, E = 7.2
                CS    ETTEEEE
                   *->DndGivV<-*
                      D+dG+vV
  gi|9057828  4188    DEDGVVV    4194

CRAM_rpt: domain 1 of 1, from 4281 to 4295: score 3.2, E = 1.1
                   *->GDCnEtDDCditGDCn<-*
                      GDCnE DD  + GD
  gi|9057828  4281    GDCNEPDDVSL-GDIA    4295

Stap_Strp_toxin: domain 1 of 1, from 4324 to 4330: score 2.5, E = 4.8
                CS    SEEEEST
                   *->GGVTlhe<-*
                      GGVT h+
  gi|9057828  4324    GGVTAHD    4330

MAP1B_neuraxin: domain 3 of 3, from 4365 to 4374: score 1.4, E = 18
                   *->TTrtPddsgY<-*
                      TTrt + ++Y
  gi|9057828  4365    TTRTRGNGSY    4374

DUF2202: domain 1 of 1, from 4379 to 4394: score 1.1, E = 8
                   *->PQYiSesEfdEIvssp<-*
                      P+ i e+++d Iv s
  gi|9057828  4379    PVEIAEEQVDLIVESQ    4394

TraG_N: domain 1 of 1, from 4464 to 4474: score 0.8, E = 5.3
                   *->leIYTvGggef<-*
                      + +YT+G+++f
  gi|9057828  4464    FKYYTLGSVDF    4474

Nup133_N: domain 1 of 1, from 4502 to 4543: score -0.6, E = 6.6
                   *->edessftvfsthplntytsppsfqsesdllkprLviPksgatatavt
                      +d+s++ ++ t+ l t+++ ++    + ++  r++iP++ + +
  gi|9057828  4502    IDTSEAIINTTVSLTTFNETDN----DICIVSRIYIPENAPLN---- 4540

                   svF<-*
                   s+F
  gi|9057828  4541 SIF    4543

DicB: domain 1 of 1, from 4523 to 4531: score 2.8, E = 1.7
                   *->NevcIlSmL<-*
                      N++cI+S++
  gi|9057828  4523    NDICIVSRI    4531

ClpB_D2-small: domain 1 of 1, from 4563 to 4581: score 1.6, E = 5.3
                CS    S-TT-EEEEEE- .....SSSE
                   *->lkeGdtvrvdvd.dgeggelvf<-*
                      +k++dtv+v+ +++g   +l++
  gi|9057828  4563    VKDNDTVKVSFKgAG---QLTI    4581

PC_rep: domain 2 of 2, from 4595 to 4622: score 3.7, E = 3.5
                   *->GlihaGsgnedealelLlvpyllsdtsnevra<-*
                      G+ ++G +n+  +le+   ++ +++ s+++r+
  gi|9057828  4595    GISNLGKPND--ILEYEI-QF-MNHGSDDIRS    4622

HisG_C: domain 1 of 1, from 4604 to 4613: score 2.1, E = 7.3
                   *->gILVlpIekc<-*
                      +IL+++I  +
  gi|9057828  4604    DILEYEIQFM    4613

DNA_pol_viral_C: domain 1 of 1, from 4649 to 4657: score -1.9, E = 7.2
                   *->gvlCsVFAD<-*
                      gv C+VFAD
  gi|9057828  4649    GVTCQVFAD    4657

//